HHsearch alignment for GI: 254780583 and conserved domain: pfam02112

>pfam02112 PDEase_II cAMP phosphodiesterases class-II.
Probab=97.91  E-value=0.00011  Score=51.13  Aligned_cols=125  Identities=19%  Similarity=0.237  Sum_probs=70.6

Q ss_pred             EECCC-EEEEEEECCCCEEEEECCCC-HHHHHHHHHHC---------------------------CCCEEEEEECCCCHH
Q ss_conf             10576-26999988998499986999-89999999985---------------------------996439998589843
Q gi|254780583|r   10 LYHDN-FCILIHNHKYRLTAAIDAPD-TYIISKMLREK---------------------------GWFLTHIFNTHHHID   60 (256)
Q Consensus        10 ~~~DN-y~YlI~d~~t~~~viIDpgd-~~~i~~~l~~~---------------------------~~~i~~Il~TH~H~D   60 (256)
T Consensus        12 p~E~n~ts~Lvr~~~~~~~ialDAGt~l~gI~~~~~~~~~~~~~~~~~p~~~~~~~p~~~a~~i~~~~I~~ylITH~HLD   91 (323)
T pfam02112        12 IDEGNLSSFLIEDEAQETFIKLDAGSVLQGYPCLTVSKYLSPNVTITTPFSNFESGPYIKHTYLLFNRIKNYLITHSHLD   91 (323)
T ss_pred             CCCCCEEEEEEEECCCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCHH
T ss_conf             78887248996546988689997765588899998641047754235776553457135678999852213993265277


Q ss_pred             HHCHHHHHHH-----HCCCEEEECCCCCCCC----------CCC-------------CEEEEEHHCCCCCCCCCCCCCCC
Q ss_conf             3000001111-----0001012000123432----------332-------------20331010011112223310255
Q gi|254780583|r   61 HTRANLNLKK-----FFNCTIFGPLEESSKI----------PGI-------------DHGLSDGDTFDFGSHPIKIIATP  112 (256)
Q Consensus        61 Higg~~~l~~-----~~~~~v~~~~~~~~~i----------~~~-------------~~~l~dgd~i~ig~~~~~vi~tP  112 (256)
T Consensus        92 HIaGLvinsp~~~~~~~~K~i~gl~~ti~aLk~hiFN~~iWPNl~~~g~~~~~~~~~~~~l~~~~~~~~~~~~~~v~~fp  171 (323)
T pfam02112        92 HVCGLVINSPGFYKQMSKKTIYGLPYTINALQKHLFNNLVWPNLPSFGIVNLIYKVKMFDLSPGEFNKLTETTMSVVPFP  171 (323)
T ss_pred             HHHHHHCCCCCCCCCCCCCEEEECHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCEEEEEC
T ss_conf             66454305854334679951886589999998733167426788667887743169988738775102467763156744


Q ss_pred             -CCC------CCCCEEEECCC----CCCCCCCE
Q ss_conf             -445------67522686146----54313770
Q gi|254780583|r  113 -GHT------IGHICYHFMND----HFLCVGDT  134 (256)
Q Consensus       113 -GHT------~g~i~~~~~~~----~~lFtGDt  134 (256)
T Consensus       172 ~sH~~~~~~~~~SsAflird~~t~~~il~fGD~  204 (323)
T pfam02112       172 VNHGGLIIKEALSTAFLFTDSVSGDSILVFGDV  204 (323)
T ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCEEEEECCC
T ss_conf             537887677634407999955899789998288