HHsearch results for GI: 254780583 and protein with PDBid: 2cfu_A

>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A*
Probab=99.89  E-value=4.3e-22  Score=162.43  Aligned_cols=206  Identities=12%  Similarity=0.080  Sum_probs=129.7

Q ss_pred             CEEEEEEECCCCEEEEECCCC----HHHHHHHH-HHCC-CCEEEEEECCCCHHHHCHHHHHHHH-----CCCEEEECCCC
Q ss_conf             626999988998499986999----89999999-9859-9643999858984330000011110-----00101200012
Q gi|254780583|r   14 NFCILIHNHKYRLTAAIDAPD----TYIISKML-REKG-WFLTHIFNTHHHIDHTRANLNLKKF-----FNCTIFGPLEE   82 (256)
Q Consensus        14 Ny~YlI~d~~t~~~viIDpgd----~~~i~~~l-~~~~-~~i~~Il~TH~H~DHigg~~~l~~~-----~~~~v~~~~~~   82 (256)
                      | +|+|.+++  ..+|||||.    +..+++.+ ++.+ ..|++|++||+|.||+||+..+.+.     ..++||++...
T Consensus       124 N-~~~I~gdd--G~IVIDtg~s~e~A~aale~~~~~l~~kPV~aVI~TH~H~DH~GGa~~~~e~~~~~~~~~~IiA~~~~  200 (658)
T 2cfu_A          124 N-ITFIRGDS--GWIVVDTLTTPATARAAYELVSRELGERPIRTVIYSHAHADHFGGVRGLVEPQQVASGAVQIIAPAGF  200 (658)
T ss_dssp             C-EEEEECSS--SEEEECCCSSHHHHHHHHHHHHHHHCCCCEEEEECSBSCHHHHTTGGGTCCHHHHHTTSSEEEEETTH
T ss_pred             E-EEEEEECC--EEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCCCHHHHHCCCCCCCCCCEEEEECCH
T ss_conf             1-89999399--89999799998999999999998657998489998999701057479881354214677428973446


Q ss_pred             CC-----------------------------------------------CCCCCCEEEEEHHCCCCCCCCCCCCCCCC-C
Q ss_conf             34-----------------------------------------------32332203310100111122233102554-4
Q gi|254780583|r   83 SS-----------------------------------------------KIPGIDHGLSDGDTFDFGSHPIKIIATPG-H  114 (256)
Q Consensus        83 ~~-----------------------------------------------~i~~~~~~l~dgd~i~ig~~~~~vi~tPG-H  114 (256)
                      ..                                               .++.......+++.+.+|+.+++++++|| |
T Consensus       201 ~~~~~~e~~~~~~~~~rRa~~~~g~~lp~~~~g~~~~glg~~~~~~~~~~~~p~~~~~~~~~~l~igG~~~e~i~tPG~H  280 (658)
T 2cfu_A          201 MEAAIKENVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARGPLSLLAPTRLIEGEGEDLVLDGVPFTFQNTPGTE  280 (658)
T ss_dssp             HHHHC---CTTHHHHHHHHHHHTTTTSCBSTTSBCCCSSSSCCCCSCCCCCCCSEEECTTEEEEEETTEEEEEEECTTSS
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCEEEEECCEEEEEEECCCCC
T ss_conf             89976300110277888998876322785501044534456766686543589658741524677799899999768999


Q ss_pred             CCCCCEEEECCCCCCCCCCEEEECC----CCC-CCCCCHHHHHHHHHHHH---CCCCCCEEECCCCC-HHHHHHHHHHCC
Q ss_conf             5675226861465431377043046----134-46663156776654420---13446502016652-045889877502
Q gi|254780583|r  115 TIGHICYHFMNDHFLCVGDTLFSLG----CGR-IFEDSYAEMFESLEKIK---SFSDKTHIYFGHEY-TENNAYFALSCD  185 (256)
Q Consensus       115 T~g~i~~~~~~~~~lFtGDtLF~~g----~Gr-~~~G~~~~l~~Sl~kl~---~Lp~~t~i~pGHeY-t~~nl~Fa~~~~  185 (256)
                      |++|+++|+++.++||+||.++..-    ..| ...+++..+.++|+++.   .+..+ .++|||-. +.++-+-...+.
T Consensus       281 Tp~~l~vy~Pe~kvLf~GD~v~~~~~nl~t~rg~~~rd~~~w~~~Ld~l~~l~~~~ae-vl~p~Hg~Pi~G~e~I~~~L~  359 (658)
T 2cfu_A          281 SPAEMNIWLPRQKALLMAENVVGTLHNLYTLRGAEVRDALGWSKYINQALHRFGRQAE-VMFAVHNWPRWGNAEIVEVLE  359 (658)
T ss_dssp             SSSBEEEEETTTTEEECTTTSCSSCCCSSCTTCCCCCCHHHHHHHHHHHHHHTGGGCS-EEECSSSCCEESHHHHHHHHH
T ss_pred             CCCCEEEEECCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC-EEECCCCCCCCCHHHHHHHHH
T ss_conf             8774799975789687436656666565455677666668899999999986055753-674489875357478999999


Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCC------HHHHHHHCCCCCC
Q ss_conf             344789999999998885789866787------8999872822467
Q gi|254780583|r  186 PHNLELQKYCSKVKSMRSQNLYTNPST------ISLEKKVNPFLRI  225 (256)
Q Consensus       186 p~n~~~~~~~~~~~~~~~~~~~tvPst------l~~Ek~~NPflr~  225 (256)
                      -.-..++.-.+++....++|..  |-.      |-.+.+-.|++|-
T Consensus       360 ~~RD~~~~l~Dqtlr~~N~G~t--~~EI~e~i~LP~~l~~~~~~~~  403 (658