HHsearch results for GI: 254780583 and protein with PDBid: 2ohh_A

>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A*
Probab=99.91  E-value=1.9e-24  Score=177.65  Aligned_cols=174  Identities=16%  Similarity=0.170  Sum_probs=122.1

Q ss_pred             CEEEEEEECCCCEEEEECCCC---HHHHHHHH----HHCC-CCEEEEEECCCCHHHHCHHHHHHHH-CCCEEEECCCCCC
Q ss_conf             626999988998499986999---89999999----9859-9643999858984330000011110-0010120001234
Q gi|254780583|r   14 NFCILIHNHKYRLTAAIDAPD---TYIISKML----REKG-WFLTHIFNTHHHIDHTRANLNLKKF-FNCTIFGPLEESS   84 (256)
Q Consensus        14 Ny~YlI~d~~t~~~viIDpgd---~~~i~~~l----~~~~-~~i~~Il~TH~H~DHigg~~~l~~~-~~~~v~~~~~~~~   84 (256)
                      | +|||.+++  .+++||||.   .+.+.+.+    +..+ .+|++|++||.|+||+||+..+.+. ++++++++.....
T Consensus        36 N-sYlI~~~~--~~~LIDtG~~~~~~~~~~~l~~~~~~i~~~~I~~Ii~TH~H~DH~ggl~~~~~~~~~~~~~~~~~~~~  112 (404)
T 2ohh_A           36 N-AYLVCGDE--GVALIDNSYPGTFDELMARVEDALQQVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVK  112 (404)
T ss_dssp             C-CEEEECSS--CEEEECCCCTTCHHHHHHHHHHHHHHHTCCCCCEEECSCCSHHHHTTHHHHHHHSTTCCEEECHHHHH
T ss_pred             E-EEEEECCC--EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9-99997198--25999198984389999999999864796568699989999875411999998779988996788887


Q ss_pred             CC--------CCCCEEEEEHHCCCCCCCCCCCCCCC-CCCCCCCEEEECCCCCCCCCCEEEECCCC--CCCC--C-----
Q ss_conf             32--------33220331010011112223310255-44567522686146543137704304613--4466--6-----
Q gi|254780583|r   85 KI--------PGIDHGLSDGDTFDFGSHPIKIIATP-GHTIGHICYHFMNDHFLCVGDTLFSLGCG--RIFE--D-----  146 (256)
Q Consensus        85 ~i--------~~~~~~l~dgd~i~ig~~~~~vi~tP-GHT~g~i~~~~~~~~~lFtGDtLF~~g~G--r~~~--G-----  146 (256)
                      .+        +.....+.+|+++.+|+.+++++++| |||+||+|+|.++.++|||||++...+|+  ++..  +     
T Consensus       113 ~l~~~~~~~~~~~~~~~~~g~~l~lg~~~l~~i~~p~gH~~~~~~~~~~~~~iLfsgD~~g~~~~~~~~~~~~~~~~~~~  192 (404)
T 2ohh_A          113 GLLKHYPSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILM  192 (404)
T ss_dssp             HHHHHCGGGGGSCEEECCTTCEEECSSCEEEEEECTTSSSTTCEEEEEETTTEEECTTTTCCCCCCSCCBGGGSCHHHHH
T ss_pred             HHHHHCCCCCCHHHEECCCCCEEECCCCEEEEEECCCCCCCCCEEEEECCCCEEEECCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             77752677762331322579889737615899952688989968999889999997976666778864101445630237


Q ss_pred             -------------CHHHHHHHHHHHHCCC---CCCEEECCCCCHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             -------------3156776654420134---4650201665204588987750234478999999999
Q gi|254780583|r  147 -------------SYAEMFESLEKIKSFS---DKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVK  199 (256)
Q Consensus       147 -------------~~~~l~~Sl~kl~~Lp---~~t~i~pGHeYt~~nl~Fa~~~~p~n~~~~~~~~~~~  199 (256)
                                   ...++.++|++|..|.   +--.|+|||--...+-         .+.++.|.+|+.
T Consensus       193 ~~~~~yy~~i~~p~~~~~~~~l~~l~~L~~~~~i~~I~PgHGpv~~~~---------~~~i~~y~~~~~  252 (404)
T 2ohh_A          193 DAARKFYANLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQIWTDP---------MKIIEAYTGWAT  252 (404)
T ss_dssp             HHHHHHHHHHTGGGHHHHHHHHHHHHHTTCGGGCSEEECSSSCBBSSH---------HHHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCHHHCCH---------HHHHHHHHHHHH
T ss_conf             777543645026768999999999986646678639962770275698---------999999998610