HHsearch results for GI: 254780583 and protein with PDBid: 2p97_A

>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12
Probab=99.92  E-value=7.9e-25  Score=180.20  Aligned_cols=150  Identities=21%  Similarity=0.265  Sum_probs=126.4

Q ss_pred             EEEEEEECCCCEEEEECCC-CHHHHHHHHHHCCCCEEEEEECCCCHHHHCHHHHHHHHCCCEEEECCCCCCCCCC-CCEE
Q ss_conf             2699998899849998699-9899999999859964399985898433000001111000101200012343233-2203
Q gi|254780583|r   15 FCILIHNHKYRLTAAIDAP-DTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPG-IDHG   92 (256)
Q Consensus        15 y~YlI~d~~t~~~viIDpg-d~~~i~~~l~~~~~~i~~Il~TH~H~DHigg~~~l~~~~~~~v~~~~~~~~~i~~-~~~~   92 (256)
                      .+|+|..++  ..++|||+ ..+...+.+++.+ .+.+|++||.  ||++++..+++++++++|++..+...++. .++.
T Consensus        25 n~~lv~~~~--g~vlIDp~~~~~~~~~~l~~~g-~v~~iv~TH~--dH~g~~~~~~~~~~a~i~~~~~~~~~~~~~~d~~   99 (201)
T 2p97_A           25 NGFAWIRPE--GNILIDPVALSNHDWKHLESLG-GVVWIVLTNS--DHVRSAKEIADQTYTKIAGPVAEKENFPIYCDRW   99 (201)
T ss_dssp             EEEEECCTT--CCEEESCCCCCHHHHHHHHHTT-CCSEEECSSG--GGCTTHHHHHHHSCCEEEEEGGGTTSCSSCCSEE
T ss_pred             EEEEEEECC--EEEEEECCCCCHHHHHHHHHCC-CCEEEEECCH--HHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCEE
T ss_conf             899999899--8599949988199999998569-9649998888--8988999999987990993142133356789888


Q ss_pred             EEEHHCCCCCCCCCCCCCCCC-CCCCCCEEEECCCCCCCCCCEEEECCCCCC------CCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             310100111122233102554-456752268614654313770430461344------6663156776654420134465
Q gi|254780583|r   93 LSDGDTFDFGSHPIKIIATPG-HTIGHICYHFMNDHFLCVGDTLFSLGCGRI------FEDSYAEMFESLEKIKSFSDKT  165 (256)
Q Consensus        93 l~dgd~i~ig~~~~~vi~tPG-HT~g~i~~~~~~~~~lFtGDtLF~~g~Gr~------~~G~~~~l~~Sl~kl~~Lp~~t  165 (256)
                      +.+|+.+..|   ++++++|| ||+||++|+. .+++|||||+++..+.|++      +.++..++.+|++||.++++..
T Consensus       100 ~~dg~~~~~g---~~vi~~pG~Ht~g~v~~~~-~~~~Lf~GD~l~~~~~g~~~~~~~~~~~d~~~~~~sl~~l~~l~~~~  175 (201)
T 2p97_A          100 LSDGDELVPG---LKVMELQGSKTPGELALLL-EETTLITGDLVRAYRAGGLEILPDEKLMNKQKVVASVRRLAALEKVE  175 (201)
T ss_dssp             ECTTCBSSTT---EEEEEECSSSSTTEEEEEE-TTTEEEECSSEEBSSTTSCEECCGGGCSCHHHHHHHHHHHHTCTTCC
T ss_pred             ECCCCEEEEE---EEEEEECCCCCCCCCCEEE-CCCEEEECCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             4268886501---7999947888999843330-35639989881578999721578766779999999999996179996


Q ss_pred             EEECCCCC
Q ss_conf             02016652
Q gi|254780583|r  166 HIYFGHEY  173 (256)
Q Consensus       166 ~i~pGHeY  173 (256)
                      .|+|||.+
T Consensus       176 ~i~pgHG~  183 (201)
T 2p97_A          176 AVLVGDGW  183 (201)
T ss_dssp             EEEESBBC
T ss_pred             EEECCCCC
T ss_conf             99958997