HHsearch results for GI: 254780583 and protein with PDBid: 2wyl_A

>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A*
Probab=98.21  E-value=1.8e-06  Score=61.18  Aligned_cols=91  Identities=19%  Similarity=0.253  Sum_probs=53.6

Q ss_pred             CEEEEEECCCCHHHHCHHHH--HHHH--CCCEEEECCCCCCCCC------CCCEEEEEHHCCCCCCCCCCCCCC------
Q ss_conf             64399985898433000001--1110--0010120001234323------322033101001111222331025------
Q gi|254780583|r   48 FLTHIFNTHHHIDHTRANLN--LKKF--FNCTIFGPLEESSKIP------GIDHGLSDGDTFDFGSHPIKIIAT------  111 (256)
Q Consensus        48 ~i~~Il~TH~H~DHigg~~~--l~~~--~~~~v~~~~~~~~~i~------~~~~~l~dgd~i~ig~~~~~vi~t------  111 (256)
                      ++++||+||.|+||++....  +.+.  ..++++++......+.      .....+..|+.+.+++.++.++.+      
T Consensus       109 ~IDaVLiTH~H~DHld~~~l~~~~~~~~~~~~~~gP~~~~~~l~~~g~~~~~i~~~~~g~~~~v~~~~i~~~~~~~~~~~  188 (360)
T 2wyl_A          109 QIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDRTAL  188 (360)
T ss_dssp             CCSEEECSBSCTTTCCHHHHHHHHHHSCTTCCEEECHHHHHHHHHHTCCGGGEEECCTTCEEEETTEEEEEEECCCC---
T ss_pred             CCCEEEECCCCHHHCCCHHHHHHHHCCCCCCEEECCHHHHHHHHHCCCCHHHEEEECCCCEEEEECCEEEEEEEEEEEEE
T ss_conf             88899979996021780999999854767743865889999998669965515760578657740213577631455556


Q ss_pred             ---CC-C----------CCCCCEEEEC--CCCCCCCCCEEEEC
Q ss_conf             ---54-4----------5675226861--46543137704304
Q gi|254780583|r  112 ---PG-H----------TIGHICYHFM--NDHFLCVGDTLFSL  138 (256)
Q Consensus       112 ---PG-H----------T~g~i~~~~~--~~~~lFtGDtLF~~  138 (256)
                         |+ |          ....+.|.++  +..+.|+|||-+..
T Consensus       189 ~~~p~~~~~~~~~~~~~~~~~~g~~ie~~g~tIy~sGDT~~~~  231 (360)
T 2wyl_A          189 ITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYSN  231 (360)
T ss_dssp             ---------------CCTTTBEEEEEEETTEEEEECTTCCCCT
T ss_pred             EECCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEECCCCCCH
T ss_conf             6426644466655777877404899971991899926988668