HHsearch results for GI: 254780583 and protein with PDBid: 2xf4_A

>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica}
Probab=100.00  E-value=1.4e-45  Score=315.50  Aligned_cols=187  Identities=29%  Similarity=0.499  Sum_probs=168.5

Q ss_pred             CCCCEEEEEEECCCEEEEEEECCCCEEEEECCC-CHHHHHHHHHHCCCCEEEEEECCCCHHHHCHHHHHHHHCCCEEEEC
Q ss_conf             986145301105762699998899849998699-9899999999859964399985898433000001111000101200
Q gi|254780583|r    1 MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAP-DTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGP   79 (256)
Q Consensus         1 m~~~~i~ip~~~DNy~YlI~d~~t~~~viIDpg-d~~~i~~~l~~~~~~i~~Il~TH~H~DHigg~~~l~~~~~~~v~~~   79 (256)
                      |..-.||++.|++| +|||.+++++++++|||| +++.+++++++.+++|++|++||.|+||+||+..|+++++++++++
T Consensus         1 m~~~~i~~~~~~~N-~yli~~~~~~~~ilID~G~~~~~i~~~l~~~~~~i~~Vi~TH~H~DH~gg~~~l~~~~~~~i~~~   79 (210)
T 2xf4_A            1 MNYRIIPVTAFSQN-CSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGP   79 (210)
T ss_dssp             CEEEEEEETTTTEE-EEEEECTTTCEEEEECCCSCHHHHHHHHHHHTCEEEEEECSCSCHHHHTTHHHHHHHHTCCEECC
T ss_pred             CCEEEEECCCHHCE-EEEEEECCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHCCCEEEE
T ss_conf             94399987844668-99999899998999979808999999999779934899978799855351899877509847850


Q ss_pred             CCCCCC------------------CCCCCEEEEEHHCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEECCCC
Q ss_conf             012343------------------23322033101001111222331025544567522686146543137704304613
Q gi|254780583|r   80 LEESSK------------------IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCG  141 (256)
Q Consensus        80 ~~~~~~------------------i~~~~~~l~dgd~i~ig~~~~~vi~tPGHT~g~i~~~~~~~~~lFtGDtLF~~g~G  141 (256)
                      ......                  ....+..+++|+.+.+|+.++++++|||||+||+|||+++.+++||||++|.+|+|
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dg~~~~~g~~~~~~i~tPGHT~g~~~~~~~~~~~l~~GD~~~~~~~~  159 (210)
T 2xf4_A           80 EKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVG  159 (210)
T ss_dssp             CGGGHHHHHTHHHHHHHTTCCCCCCCCCSBCCCTTCEEEETTEEEEEEECCSSSTTCEEEEETTTTEEEEETSEETTEEC
T ss_pred             CCHHHHHHCCCHHHHHHCCCCCCCCCCCCEEECCCCCCEECCEEEEEEEECCCCCCCEEEEECCCCCCCCCCEEECCCCC
T ss_conf             10456652042123211033345567785893168742369989999992699998689997788842148886379704


Q ss_pred             C--CCCCCHHHHHHHHH-HHHCCCCCCEEECCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHH
Q ss_conf             4--46663156776654-42013446502016652045889877502344789999999998885789866787899987
Q gi|254780583|r  142 R--IFEDSYAEMFESLE-KIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKK  218 (256)
Q Consensus       142 r--~~~G~~~~l~~Sl~-kl~~Lp~~t~i~pGHeYt~~nl~Fa~~~~p~n~~~~~~~~~~~~~~~~~~~tvPstl~~Ek~  218 (256)
                      +  +++|+.+++++||+ +|.+|+++++|||||.+                                    +||+++||+
T Consensus       160 ~~~~~~~d~~~~~~sl~~~l~~l~~~~~v~PGHG~------------------------------------~st~~~e~~  203 (210)
T 2xf4_A          160 RSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGP------------------------------------LSTLGYERL  203 (210)
T ss_dssp             CCCSTTCCHHHHHHHHHHHTGGGCTTCEEEESSSC------------------------------------CEEHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCC------------------------------------CCCHHHHHH
T ss_conf             76678899999999999999708998399899998------------------------------------654999987


Q ss_pred             HCCCCC
Q ss_conf             282246
Q gi|254780583|r  219 VNPFLR  224 (256)
Q Consensus       219 ~NPflr  224 (256)
                      +|||||
T Consensus       204 ~N~~~~  209 (210)
T 2xf4_A          204 HNPFLQ  209 (210)
T ss_dssp             HCTTC-
T ss_pred             HCHHHC
T ss_conf             584524