HHsearch results for GI: 254780583 and protein with PDBid: 3kl7_A

>3kl7_A Putative metal-dependent hydrolase; structural genomics, joint center for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503}
Probab=98.77  E-value=3.1e-09  Score=79.12  Aligned_cols=120  Identities=14%  Similarity=0.105  Sum_probs=67.3

Q ss_pred             ECCCEEEEEEECCCCEEEEECCCCHHHHHHHHHHCCC-CEEEEEECCCCHHHHCHHH-HHHHHCCCEEEECCCCCCCCCC
Q ss_conf             0576269999889984999869998999999998599-6439998589843300000-1111000101200012343233
Q gi|254780583|r   11 YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGW-FLTHIFNTHHHIDHTRANL-NLKKFFNCTIFGPLEESSKIPG   88 (256)
Q Consensus        11 ~~DNy~YlI~d~~t~~~viIDpgd~~~i~~~l~~~~~-~i~~Il~TH~H~DHigg~~-~l~~~~~~~v~~~~~~~~~i~~   88 (256)
                      +.-+ +++|..+  +..++|||.....     .-..+ ++++||+||.|+||++... ...++.+++|+++......+..
T Consensus        35 lGha-s~lie~~--g~~ILiDP~~~~~-----~~~~~p~iD~VLiTH~H~DH~~~~~l~~~~~~~~~vi~~~~~~~~l~~  106 (235)
T 3kl7_A           35 IKHG-SLMLTYD--NHSIQVDPVSEYA-----DYTTFPKADIILITHEHGDHLDPKAIQAVEKSDTEIIANENSQKKLGK  106 (235)
T ss_dssp             EETT-EEEEEET--TEEEEESCCTTTC-----CTTSSCCCSEEEECCSSTTTCCHHHHHHHCCTTCEEEECHHHHHHHTC
T ss_pred             EECC-EEEEEEC--CEEEEECCCCCCC-----CHHCCCCCCEEEECCCCCCCCCCHHHHHHHCCCCEEEECHHHHHHHHH
T ss_conf             8315-9999989--9999988999988-----620089888999799870126722012464269669815899877510


Q ss_pred             CCEEEEEHHCCCCCCCCCCCCCC----C----CCCCC-CCEEEEC--CCCCCCCCCEEEEC
Q ss_conf             22033101001111222331025----5----44567-5226861--46543137704304
Q gi|254780583|r   89 IDHGLSDGDTFDFGSHPIKIIAT----P----GHTIG-HICYHFM--NDHFLCVGDTLFSL  138 (256)
Q Consensus        89 ~~~~l~dgd~i~ig~~~~~vi~t----P----GHT~g-~i~~~~~--~~~~lFtGDtLF~~  138 (256)
                      .......+....+++.+++++.+    +    .|..+ .++|.++  +..+.|+|||-+..
T Consensus       107 ~~~~~~~~~~~~~~~~~I~~~p~~h~~~~~~~~~~~~~~~gyvie~~g~~i~~~GDt~~~~  167 (235)
T 3kl7_A          107 GKVLKNGDTDTSISYMKIEAVPAYNTTPGRDKYHPRHRDNGYILTFDGLRVYIAGDTEDIP  167 (235)
T ss_dssp             SEECCTTCEECCSTTCEEEEEECCCCSTTGGGTSCTTTSEEEEEEETTEEEEECCSCCSCG
T ss_pred             CCCCCCCCCEEEECCCEEEEEEEECCCCCCCCCCCCCCEEEEEEEECCEEEEEECCCCCHH
T ss_conf             6420257732775572067897341578766767875337789997997999945867757