HHSEARCH alignment of GI: 254780583 and SCOP domain: d1ko3a_

Alignment
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}
Probab=99.93  E-value=2.5e-25  Score=181.89  Aligned_cols=154  Identities=18%  Similarity=0.235  Sum_probs=120.7

Q ss_pred             CEEEEEEECCCCEEEEECCCC----HHHHHHHHHHC-CCCEEEEEECCCCHHHHCHHHHHHHHCCCEEEECCCCCCC---
Q ss_conf             626999988998499986999----89999999985-9964399985898433000001111000101200012343---
Q gi|254780583|r   14 NFCILIHNHKYRLTAAIDAPD----TYIISKMLREK-GWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSK---   85 (256)
Q Consensus        14 Ny~YlI~d~~t~~~viIDpgd----~~~i~~~l~~~-~~~i~~Il~TH~H~DHigg~~~l~~~~~~~v~~~~~~~~~---   85 (256)
                      | +|+|.++  +.+++||||.    ++.+++.+++. +..+++|++||.|+||+||+..|++. ++.++++......   
T Consensus        39 N-~~li~~~--~~~vLID~g~~~~~~~~~~~~i~~~~~~~i~~ii~TH~H~DH~gg~~~~~~~-~~~~~~~~~~~~~~~~  114 (230)
T d1ko3a_          39 N-GLIVRDG--DELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAA-GVATYASPSTRRLAEV  114 (230)
T ss_dssp             E-EEEEEET--TEEEEESCCSSHHHHHHHHHHHHTTTCCCEEEEECSSSSHHHHTTHHHHHHT-TCEEEECHHHHHHHHH
T ss_pred             E-EEEEEEC--CEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHC-CCCEEEECCCCCHHHC
T ss_conf             7-9999839--9889987999989999999999873197267999779986642889999645-8863761211100101


Q ss_pred             ------CCCCCEEEEEHHCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEECCCCC---CCCCCHHHHHHHHH
Q ss_conf             ------233220331010011112223310255445675226861465431377043046134---46663156776654
Q gi|254780583|r   86 ------IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGR---IFEDSYAEMFESLE  156 (256)
Q Consensus        86 ------i~~~~~~l~dgd~i~ig~~~~~vi~tPGHT~g~i~~~~~~~~~lFtGDtLF~~g~Gr---~~~G~~~~l~~Sl~  156 (256)
                            .......+.+++.+.+|+..+.+ .+||||+|++++++++.++||+||.+|..+.+.   .++++..++.+||+
T Consensus       115 ~~~~~~~~~~~~~~~~~~~l~~g~~~~~~-~~pGHt~~~~~~~~~~~~~l~~GD~~~~~~~~~~~~~~~~d~~~~~~sl~  193 (230)
T d1ko3a_         115 EGNEIPTHSLEGLSSSGDAVRFGPVELFY-PGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIE  193 (230)
T ss_dssp             HTCCCCSEECCSCCSTTCEEEETTEEEEC-CCSSSSTTCCEEEETTTTEEEEETTSCCTTCCSCCCCTTCCTTTHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCEEEECCEEEEE-ECCCCCCCCCEEECCCCCCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             35533222321234554189858888999-57998998613422667861115211156778778889999999999999


Q ss_pred             HHHCC-CCCCEEECCCC
Q ss_conf             42013-44650201665
Q gi|254780583|r  157 KIKSF-SDKTHIYFGHE  172 (256)
Q Consensus       157 kl~~L-p~~t~i~pGHe  172 (256)
                      ++++| |+.+.|+|||.
T Consensus       194 ~l~~l~~~~~~v~PgHg  210 (230)
T d1ko3a_         194 RIQQHYPEAQFVIPGHG  210 (230)
T ss_dssp             HHHHHCTTCCEEEESSS
T ss_pred             HHHHCCCCCCEEECCCC
T ss_conf             99811899859987999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Zn metallo-beta-lactamase
domain: Zn metallo-beta-lactamase
species: Pseudomonas aeruginosa, VIM-2 [TaxId: 287]