HHSEARCH alignment of GI: 254780583 and SCOP domain: d1mqoa_

Alignment
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
Probab=99.93  E-value=3.2e-26  Score=187.63  Aligned_cols=154  Identities=18%  Similarity=0.178  Sum_probs=121.6

Q ss_pred             EEEEEECCCCEEEEECCC-C---HHHHHHHHHHC-CCCEEEEEECCCCHHHHCHHHHHHHHCCCEEEECCCCCC-----C
Q ss_conf             699998899849998699-9---89999999985-996439998589843300000111100010120001234-----3
Q gi|254780583|r   16 CILIHNHKYRLTAAIDAP-D---TYIISKMLREK-GWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESS-----K   85 (256)
Q Consensus        16 ~YlI~d~~t~~~viIDpg-d---~~~i~~~l~~~-~~~i~~Il~TH~H~DHigg~~~l~~~~~~~v~~~~~~~~-----~   85 (256)
                      +|+|.++  +.+++|||| .   ++.+++.+++. +..+++|++||.|+||+||+..+++. ++++++...+..     .
T Consensus        37 ~~li~~~--~~~iLIDt~~~~~~~~~l~~~i~~~~~~pi~~vi~TH~H~DH~gg~~~~~~~-~v~~~~~~~~~~~~~~~~  113 (221)
T d1mqoa_          37 GLVLNTS--KGLVLVDSSWDDKLTKELIEMVEKKFQKRVTDVIITHAHADRIGGIKTLKER-GIKAHSTALTAELAKKNG  113 (221)
T ss_dssp             EEEEEET--TEEEEESCCSSHHHHHHHHHHHHHHHTSCEEEEECCCCSHHHHTTHHHHHHH-TCEEECBHHHHHHHHHTT
T ss_pred             EEEEEEC--CEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHC-CCCEEECHHHHHHHHHCC
T ss_conf             9999989--9999993989989999999999975299842999888984411888998637-872340144543433212


Q ss_pred             CCCCCEEEEEHHCCCCCCCCCCCCCC-CCCCCCCCEEEECCCCCCCCCCEEEECCCCC---CCCCCHHHHHHHHHHHHCC
Q ss_conf             23322033101001111222331025-5445675226861465431377043046134---4666315677665442013
Q gi|254780583|r   86 IPGIDHGLSDGDTFDFGSHPIKIIAT-PGHTIGHICYHFMNDHFLCVGDTLFSLGCGR---IFEDSYAEMFESLEKIKSF  161 (256)
Q Consensus        86 i~~~~~~l~dgd~i~ig~~~~~vi~t-PGHT~g~i~~~~~~~~~lFtGDtLF~~g~Gr---~~~G~~~~l~~Sl~kl~~L  161 (256)
                      .+.....+.++..+.+|+.+++++++ ||||+||+++|+++.++||+||.+|.++...   ..+++..++.+||+++..+
T Consensus       114 ~~~~~~~~~~~~~l~~g~~~i~~~~~~pgHt~g~~~~~~~~~~vLf~GD~~~~~~~~~~~~~~~~~~~~~~~sl~~l~~~  193 (221)
T d1mqoa_         114 YEEPLGDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTSIENVLKR  193 (221)
T ss_dssp             CCCCCCCBCSEEEEEETTEEEEEECCCCSSSSSCCEEEETTTTEEEEETTSCCTTCCSCCCCTTCCHHHHHHHHHHHHHH
T ss_pred             CCCCEEECCCCCEEEEEEEEEEEECCCCCCCCCCEEEEECCCCEEEECCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             21210221577657775213677515787789844999757761884355425785565888998999999999999833


Q ss_pred             -CCCCEEECCCC
Q ss_conf             -44650201665
Q gi|254780583|r  162 -SDKTHIYFGHE  172 (256)
Q Consensus       162 -p~~t~i~pGHe  172 (256)
                       ++...|+|||.
T Consensus       194 ~~~~~~viPgHG  205 (221)
T d1mqoa_         194 YRNINAVVPGHG  205 (221)
T ss_dssp             CCSCSEEEESSS
T ss_pred             CCCCCEEEECCC
T ss_conf             799999990999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Zn metallo-beta-lactamase
domain: Zn metallo-beta-lactamase
species: Bacillus cereus [TaxId: 1396]