HHSEARCH alignment of GI: 254780583 and SCOP domain: d1y44a1

Alignment
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]}
Probab=98.77  E-value=7.5e-09  Score=75.12  Aligned_cols=108  Identities=17%  Similarity=0.193  Sum_probs=66.8

Q ss_pred             EEEEEE-ECCCCEEEEECCCCHHHHHHHHHHCCC---CEEEEEECCCCHHHHCHHHHHHHH-------CCCEEEECCCCC
Q ss_conf             269999-889984999869998999999998599---643999858984330000011110-------001012000123
Q gi|254780583|r   15 FCILIH-NHKYRLTAAIDAPDTYIISKMLREKGW---FLTHIFNTHHHIDHTRANLNLKKF-------FNCTIFGPLEES   83 (256)
Q Consensus        15 y~YlI~-d~~t~~~viIDpgd~~~i~~~l~~~~~---~i~~Il~TH~H~DHigg~~~l~~~-------~~~~v~~~~~~~   83 (256)
                      -+++|. -+..+..++||+|..  +...+.+.++   ++++|++||.|+||++|...|...       ....||++....
T Consensus        20 s~~~v~~~~~~~~~iLiD~G~g--~~~~l~~~~~~~~~i~~I~iTH~H~DH~~Gl~~ll~~~~~~~~~~~l~i~gP~~~~   97 (307)
T d1y44a1          20 TSVALKLLEERRSVWLFDCGEA--TQHQMLHTTIKPRKIEKIFITHMHGDHVYGLPGLLGSRSFQGGEDELTVYGPKGIK   97 (307)
T ss_dssp             CEEEEEETTTTSEEEEECCCTT--HHHHHTTSSCCGGGEEEEECSBCCGGGTTTHHHHHHHHHHTTCCSCEEEEESTTHH
T ss_pred             CEEEEEEECCCCCEEEEECCHH--HHHHHHHCCCCHHHCCEEEECCCCHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCHH
T ss_conf             8899999816997899939678--99999982999657778998156467616421221221025788764224783046


Q ss_pred             CCCCC-------------CCEEEEEHHCCCCCCCCCCCCCCCCCCCCCCEEEECC
Q ss_conf             43233-------------2203310100111122233102554456752268614
Q gi|254780583|r   84 SKIPG-------------IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN  125 (256)
Q Consensus        84 ~~i~~-------------~~~~l~dgd~i~ig~~~~~vi~tPGHT~g~i~~~~~~  125 (256)
                      ..+..             ..+.+.++..+...+..+....+. |+..++.|.+..
T Consensus        98 ~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~-~~~~~~~~~~~~  151 (307)
T d1y44a1          98 AFIETSLAVTKTHLTYPLAIQEIEEGIVFEDDQFIVTAVSVI-HGVEAFGYRVQE  151 (307)
T ss_dssp             HHHHHHHHHTTCCCSSCEEEEECCSEEEEECSSEEEEEEECB-SSSSBEEEEEEE
T ss_pred             HHHHHHHHHCCCCCCCCEEEEECCCCCEEECCCCEEEEEEEC-CCCCCCCCCCCC
T ss_conf             789987631013567623679856883574167068775303-566643432201


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: RNase Z-like
domain: Ribonuclease Z (RNase Z)
species: Bacillus subtilis [TaxId: 1423]