HHSEARCH alignment of GI: 254780583 and SCOP domain: d2q0ia1

Alignment
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]}
Probab=99.96  E-value=2.5e-28  Score=201.34  Aligned_cols=166  Identities=19%  Similarity=0.193  Sum_probs=130.9

Q ss_pred             CEEEEEEECCCCEEEEECCC---CHHHHHHHHHHCCC---CEEEEEECCCCHHHHCHHHHHHHH-CCCEEEECCCCCCCC
Q ss_conf             62699998899849998699---98999999998599---643999858984330000011110-001012000123432
Q gi|254780583|r   14 NFCILIHNHKYRLTAAIDAP---DTYIISKMLREKGW---FLTHIFNTHHHIDHTRANLNLKKF-FNCTIFGPLEESSKI   86 (256)
Q Consensus        14 Ny~YlI~d~~t~~~viIDpg---d~~~i~~~l~~~~~---~i~~Il~TH~H~DHigg~~~l~~~-~~~~v~~~~~~~~~i   86 (256)
                      | +|+|.+.+ +.+++||+|   +.+.+.+.+.+.++   +|++|++||.|+||+||+..|++. ++++||++......+
T Consensus        23 ~-~yli~~~~-~~~vLID~G~~~~~~~~~~~l~~~~~~~~~I~~vi~TH~H~DH~Gg~~~l~~~~p~a~v~~~~~~~~~~  100 (298)
T d2q0ia1          23 P-VFLLRLGE-ASWALVEGGISRDAELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAW  100 (298)
T ss_dssp             C-EEEEEEET-TEEEEECCCCGGGHHHHHHHHHHHCSCGGGEEEEECCCCSHHHHTTHHHHGGGCTTCEEEEEHHHHHHT
T ss_pred             E-EEEEEECC-CCEEEECCCCCCHHHHHHHHHHHCCCCCHHCEEEEECCCCCCCCCCHHHHHHHCCCCEEEECHHHHHHH
T ss_conf             7-99999899-878998599986399999999970998166449996898844447236678647887799607888887


Q ss_pred             ------------------------------CCCCEEEEEHHCCCCCC-CCCCCCCCCCCCCCCCEEEECCCCCCCCCCEE
Q ss_conf             ------------------------------33220331010011112-22331025544567522686146543137704
Q gi|254780583|r   87 ------------------------------PGIDHGLSDGDTFDFGS-HPIKIIATPGHTIGHICYHFMNDHFLCVGDTL  135 (256)
Q Consensus        87 ------------------------------~~~~~~l~dgd~i~ig~-~~~~vi~tPGHT~g~i~~~~~~~~~lFtGDtL  135 (256)
                                                    +.....+.+|+.+++|+ ..++++++||||+||+|+|.++.++|||||++
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~lg~~~~~~~~~~PGHt~g~~~~~~~~~~~lf~GD~~  180 (298)
T d2q0ia1         101 KSESAVRVVERLNRQLLRAEQRLPEACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFYDVRRRRLFCGDAL  180 (298)
T ss_dssp             TCHHHHHHHHHHHHTTCCTTCCCCCCCCGGGSCEEEECTTCEEEEETTEEEEEEECCSSSTTCEEEEETTTTEEEEETTT
T ss_pred             HCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCEEEEECCEEEEEEECCCCCCCCCEEEECCCCEEEECCCC
T ss_conf             36202346777765320001014555555666743636898997410048987301245799744784799999976765


Q ss_pred             EE--CCCCCC---CCCCHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHH
Q ss_conf             30--461344---66631567766544201344650201665204588987
Q gi|254780583|r  136 FS--LGCGRI---FEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA  181 (256)
Q Consensus       136 F~--~g~Gr~---~~G~~~~l~~Sl~kl~~Lp~~t~i~pGHeYt~~nl~Fa  181 (256)
                      +.  ...++.   +.++.+++.+||+||.+|++++.|+|||-....+-..+
T Consensus       181 ~~~~~~~~~~~~~~~~~~~~~~~sl~~l~~l~~~~~i~PgHG~~~~~~~~~  231 (298)
T d2q0ia1         181 GEFDEAEGVWRPLVFDDMEAYLESLERLQRLPTLLQLIPGHGGLLRGRLAA  231 (298)
T ss_dssp             CEECTTTSCEECCCSSCHHHHHHHHHHHHTSSCCSEEEESSSCEEETHHHH
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCCCHHHH
T ss_conf             878899776689999769999999999977999989999999712798999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: PqsE-like
domain: Quinolone signal response protein PqsE
species: Pseudomonas aeruginosa [TaxId: 287]