BLAST/PSIBLAST alignment of GI: 254780583 and GI: 218517124 at iteration 1
>gi|218517124|ref|ZP_03513964.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli 8C-3] Length = 256
 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 171/241 (70%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +  LTAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPEIGLTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DG+TF FG+H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAIAIPGLDRAMADGNTFLFGNHTVHVIETPGHTSGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDPGNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRAEGKFTIPTTLGLEKETNPFLRAGDPTIRRNLIMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254