BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus
Liberibacter asiaticus str. psy62]
         (256 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040260|gb|ACT57056.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62]
          Length = 256

 Score =  531 bits (1367), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/256 (100%), Positives = 256/256 (100%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID
Sbjct: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC
Sbjct: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF
Sbjct: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS
Sbjct: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240

Query: 241 NLAVFTELRIRKNQSK 256
           NLAVFTELRIRKNQSK
Sbjct: 241 NLAVFTELRIRKNQSK 256


>gi|315121775|ref|YP_004062264.1| glyoxalase II [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495177|gb|ADR51776.1| glyoxalase II [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 256

 Score =  417 bits (1071), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/256 (76%), Positives = 224/256 (87%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  LNIAISLY+DNFCIL+H+ +++LT AID PDT  I +MLREK WFLTHIFNTHHHID
Sbjct: 1   MNKLNIAISLYYDNFCILVHDSQHQLTVAIDTPDTNTILRMLREKNWFLTHIFNTHHHID 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HTR NL+LKK FNCT+FGP  ES +IP IDHGLSDGDT +FG H I + +TPGHT+GHIC
Sbjct: 61  HTRGNLDLKKIFNCTVFGPSIESHQIPKIDHGLSDGDTLNFGQHQINVFSTPGHTMGHIC 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF+ D+ L VGDTLFSLGCG+IFE ++AEMFESLEKI+SF DKTHIYFGHEYTENNA F
Sbjct: 121 YHFIEDYLLFVGDTLFSLGCGKIFEGNFAEMFESLEKIRSFPDKTHIYFGHEYTENNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALSCDPHNLELQ+YCSKVKS+R++NLYTNPS ISLEKKVNPFLR  +  LRKNL+ME+AS
Sbjct: 181 ALSCDPHNLELQQYCSKVKSLRTKNLYTNPSMISLEKKVNPFLRTRDPILRKNLHMEDAS 240

Query: 241 NLAVFTELRIRKNQSK 256
           NLAVFTELRIRK+Q K
Sbjct: 241 NLAVFTELRIRKDQFK 256


>gi|227823240|ref|YP_002827212.1| putative glyoxalase II [Sinorhizobium fredii NGR234]
 gi|227342241|gb|ACP26459.1| putative glyoxalase II [Sinorhizobium fredii NGR234]
          Length = 256

 Score =  268 bits (684), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 165/241 (68%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     TA+IDAP+   I + L  +GW LTHI  THHH DH  AN++LK+ F
Sbjct: 14  DNFGVLIHDPASGATASIDAPEERPILEALERRGWRLTHILTTHHHGDHVAANVSLKQRF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             TI GP  E+SKIPGID  ++ G+ FDF  HP+++I TPGHT GHI +H   D  L   
Sbjct: 74  GVTIIGPKGEASKIPGIDKQVAHGERFDFAGHPVEVIETPGHTAGHISFHLPEDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +   M++SL ++ +  D T +YFGHEYT +NA+FA++ DP N  L+
Sbjct: 134 DTLFALGCGRLFEGTAETMWQSLNRLMALPDDTSVYFGHEYTLSNAHFAVTIDPENAALK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  ++++  RS   +T P+TI LEK+ NPFLR  ++ +R +L ME AS+ AVF E+R RK
Sbjct: 194 ERAAEIEETRSDGGFTAPTTIGLEKRTNPFLRAGDSKIRAHLGMEKASDAAVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|222149971|ref|YP_002550928.1| glyoxalase II [Agrobacterium vitis S4]
 gi|221736953|gb|ACM37916.1| glyoxalase II [Agrobacterium vitis S4]
          Length = 256

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 169/254 (66%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S +I I     DN+ +L+H  +  LTA+IDAP+   I     ++GW ++HIF THHH 
Sbjct: 1   MKSPDIEIFPCRTDNYGVLVHCPETGLTASIDAPEEGPIVAAAEKRGWQISHIFTTHHHN 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK+ + C I GP+ E+  IPG+D    DG+ F FG H +++I TPGHT GH+
Sbjct: 61  DHVEANLALKQRYGCEIIGPVNEAVAIPGLDRSAYDGEEFLFGPHRVQVIETPGHTAGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF +   L   DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT  NA 
Sbjct: 121 CYHFPDAKLLFAADTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLANAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  LQ     +++MR+Q  +T P+T+SLEK+ NPFLR+ +  +R+NL ME+ 
Sbjct: 181 FALTIDPDNERLQARARDIEAMRAQGQFTIPTTMSLEKETNPFLRVADPKIRRNLVMESK 240

Query: 240 SNLAVFTELRIRKN 253
           SN  VF E+R RK+
Sbjct: 241 SNEEVFAEIRKRKD 254


>gi|15966417|ref|NP_386770.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sinorhizobium meliloti 1021]
 gi|307300546|ref|ZP_07580326.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti BL225C]
 gi|307318411|ref|ZP_07597846.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti AK83]
 gi|81634016|sp|Q92MF8|GLO2_RHIME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|15075688|emb|CAC47243.1| Putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sinorhizobium meliloti 1021]
 gi|306896093|gb|EFN26844.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti AK83]
 gi|306904712|gb|EFN35296.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti BL225C]
          Length = 256

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 159/241 (65%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +L+H+     TA+IDAP+   I   L  +GW LTHI  THHH DH  AN +LK+ F
Sbjct: 14  DNYGVLLHDRLSGATASIDAPEERPILDALERRGWQLTHILTTHHHGDHVAANASLKERF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             TI GP  E+SKIPGID  +  GD FDF  HP+ +I TPGHT GH+CYH   D  L   
Sbjct: 74  GLTIIGPKNEASKIPGIDRTVGHGDRFDFAGHPVDVIETPGHTSGHVCYHLPEDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +   M++SL ++ +  D T IYFGHEYT  NA+FA++ DP N  L+
Sbjct: 134 DTLFALGCGRLFEGTADTMWQSLSRLMALPDDTAIYFGHEYTLANAHFAITVDPENSALK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  ++++  RS   +T P+T+ LEK+ NPFLR  +  +R  L ME AS+ AVF E+R RK
Sbjct: 194 ERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRAGDPKIRALLGMEKASDAAVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|159185823|ref|NP_356997.2| glyoxalase II [Agrobacterium tumefaciens str. C58]
 gi|81591191|sp|Q8U9W1|GLO2_AGRT5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|159140957|gb|AAK89782.2| glyoxalase II [Agrobacterium tumefaciens str. C58]
          Length = 256

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/254 (46%), Positives = 169/254 (66%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAISL-YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I + L   DNF +L+H+ +   TAAIDAP+   I + L   GW LTHIF THHH 
Sbjct: 1   MKPLEIDVFLCRSDNFGVLLHDPESGATAAIDAPEEGPILRALDGHGWKLTHIFTTHHHQ 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK  F C + GP +E+  IPG+D   +DGD F+F    +++IATPGHT GHI
Sbjct: 61  DHVEANLVLKDKFRCEVHGPYDEAIAIPGLDRSQADGDEFEFAGRRVQVIATPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CY+  +D  L   DTLF++GCGR+FE   A+M+ S +K+ +  D T +YFGHEYT +NA 
Sbjct: 121 CYYLPDDGLLFAADTLFAMGCGRLFERPAADMWHSFQKLMALPDDTRVYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L++  ++V++ R  N +T P+TI LEK+ NP++R+ +  +R++L +E A
Sbjct: 181 FALTVDPDNAVLRERAARVETARQANEFTIPTTIGLEKQTNPYMRVADAGIRRHLGLEGA 240

Query: 240 SNLAVFTELRIRKN 253
           ++  VF E+R RK+
Sbjct: 241 ADADVFAEIRTRKD 254


>gi|150397750|ref|YP_001328217.1| hydroxyacylglutathione hydrolase [Sinorhizobium medicae WSM419]
 gi|150029265|gb|ABR61382.1| Hydroxyacylglutathione hydrolase [Sinorhizobium medicae WSM419]
          Length = 256

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 164/254 (64%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAISLYH-DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L + + L   DN+ +L+H+     TA+IDAP+   I   L  + W LTHI  THHH 
Sbjct: 1   MAALELDLFLCRTDNYGVLLHDRLSGATASIDAPEERPILDALERRSWQLTHILTTHHHG 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N+ LK+ F  TI GP  ES KIPGID  +  GD FDF  HP+++I TPGHT GH+
Sbjct: 61  DHVAGNIGLKERFGVTIIGPKNESPKIPGIDRSVGHGDRFDFAGHPVEVIETPGHTAGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF  D  L   DTLF+LGCGR+FE +   M++SL ++ +  D T IYFGHEYT  NA 
Sbjct: 121 CYHFPEDKLLFAADTLFALGCGRLFEGTPETMWQSLSRLMALPDDTAIYFGHEYTLANAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA++ DP N  L++  ++++  RS   +T P+T+ LEK+ NPFLR ++  +R  L M+ A
Sbjct: 181 FAVTVDPENTALKERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRADDPKIRAFLGMDKA 240

Query: 240 SNLAVFTELRIRKN 253
           S+ AVF E+R RK+
Sbjct: 241 SDAAVFAEIRKRKD 254


>gi|332716404|ref|YP_004443870.1| putative glyoxalase II [Agrobacterium sp. H13-3]
 gi|325063089|gb|ADY66779.1| putative glyoxalase II [Agrobacterium sp. H13-3]
          Length = 256

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 165/254 (64%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAISL-YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I + L   DNF +L+H+ +   TAAIDAP+   I + L   GW LTHIF THHH 
Sbjct: 1   MKPLEIDVFLCRSDNFGVLLHDPESGATAAIDAPEEGPILQALHGHGWKLTHIFTTHHHQ 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK  F C I GP +E+  IPG+D   +DGD F+F    +++IATPGHT GHI
Sbjct: 61  DHVEANLALKDKFQCEIHGPHDEAIAIPGLDRSQADGDEFEFAGRRVQVIATPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CY+  +D  L   DTLF++GCGR+FE +  +M+ S +K+ +  D T +YFGHEYT +NA 
Sbjct: 121 CYYLPDDGLLFAADTLFAMGCGRLFERTATDMWHSFQKLMALPDDTKVYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L +    V+  R  N +T P+TI LEK+ NP++R+ + S+R +L +E A
Sbjct: 181 FALTVDPDNAALIERAESVEKARQANEFTIPTTIGLEKQTNPYMRVADASIRSHLGLEGA 240

Query: 240 SNLAVFTELRIRKN 253
           ++  VF E+R RK+
Sbjct: 241 TDAEVFAEIRTRKD 254


>gi|163759934|ref|ZP_02167018.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Hoeflea phototrophica DFL-43]
 gi|162282892|gb|EDQ33179.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Hoeflea phototrophica DFL-43]
          Length = 247

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 160/243 (65%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DNF +++H+     TA IDAPD  +I+  LR   W LTH+  THHH DH      L + 
Sbjct: 4   QDNFGVILHDSLTGETATIDAPDGSVIASHLRPGSWKLTHLLITHHHPDHVEGIPALSET 63

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
           ++  + GP  E++KI G+   L DGDTF+F    +++I+TPGHT GHIC+H  ++  L  
Sbjct: 64  YSPRVIGPAAEAAKIRGLTDTLRDGDTFEFAGRKVEVISTPGHTAGHICFHIPDEQLLFA 123

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF+LGCGR+FE S  +MF SL ++ +  D+T +Y GHEYT +NA FA++ DP N EL
Sbjct: 124 GDTLFALGCGRLFEGSPGDMFASLTRLAALPDETRVYCGHEYTRSNAAFAVTVDPDNSEL 183

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
            K  ++++ +  + L T P+TI  EK+ NPF+R  + ++R+ L MENAS L VFTELR R
Sbjct: 184 AKRRAEIEGLVEKGLATLPTTIGFEKRTNPFMRAGDPAIRRTLGMENASELEVFTELRAR 243

Query: 252 KNQ 254
           K++
Sbjct: 244 KDR 246


>gi|86359395|ref|YP_471287.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli CFN 42]
 gi|123510615|sp|Q2K3M6|GLO2_RHIEC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86283497|gb|ABC92560.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli CFN 42]
          Length = 256

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 170/241 (70%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DGD+F FG H +K+I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAIAIPGLDRTMADGDSFLFGDHTVKVIETPGHTAGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDPDNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R++L ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRAEGKFTVPTTLGLEKETNPFLRAADPAIRRHLIMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|218517124|ref|ZP_03513964.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli 8C-3]
          Length = 256

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 171/241 (70%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +  LTAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPEIGLTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DG+TF FG+H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAIAIPGLDRAMADGNTFLFGNHTVHVIETPGHTSGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDPGNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRAEGKFTIPTTLGLEKETNPFLRAGDPTIRRNLIMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|209551158|ref|YP_002283075.1| hydroxyacylglutathione hydrolase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536914|gb|ACI56849.1| hydroxyacylglutathione hydrolase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 256

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/241 (50%), Positives = 168/241 (69%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DGD+F FG H I +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAIAIPGLDRTMADGDSFLFGDHTINVIETPGHTAGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLSNARFALTVDPGNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R+   +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N  VF E+R RK
Sbjct: 194 GRAAEIEALRADGKFTIPTTLGLEKETNPFLRAADPAIRRNLLMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|327193569|gb|EGE60459.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli CNPAF512]
          Length = 256

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 168/241 (69%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DGD F FG H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAVAIPGLDRTMADGDRFVFGQHTVHVIETPGHTAGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTIDPDNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRAEGKFTIPTTLGLEKETNPFLRAGDPTIRRNLIMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|190893649|ref|YP_001980191.1| hydroxyacylgluthatione hydrolase [Rhizobium etli CIAT 652]
 gi|190698928|gb|ACE93013.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli CIAT 652]
          Length = 256

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 171/241 (70%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +  LTAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGLTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DG+TF FG+H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAIAIPGLDRAMADGNTFLFGNHTVHVIETPGHTSGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDPGNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R++L ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRAEGKFTIPTTLGLEKETNPFLRAGDPTIRRSLIMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|116254075|ref|YP_769913.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|160395518|sp|Q1MB56|GLO2_RHIL3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|115258723|emb|CAK09828.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii)
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 256

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 168/241 (69%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVTANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DGD+F FG H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAVAIPGLDRAMADGDSFLFGDHTVNVIETPGHTAGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFALTVDPDNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++++++R+   +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N  VF E+R RK
Sbjct: 194 SRAAEIEALRADGKFTIPTTLGLEKETNPFLRAADPAIRRNLVMEGKTNEEVFAEIRKRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|148560629|ref|YP_001259758.1| hydroxyacylglutathione hydrolase [Brucella ovis ATCC 25840]
 gi|161619854|ref|YP_001593741.1| hydroxyacylglutathione hydrolase [Brucella canis ATCC 23365]
 gi|163843959|ref|YP_001628363.1| hydroxyacylglutathione hydrolase [Brucella suis ATCC 23445]
 gi|189025004|ref|YP_001935772.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|225853374|ref|YP_002733607.1| hydroxyacylglutathione hydrolase [Brucella melitensis ATCC 23457]
 gi|237816297|ref|ZP_04595290.1| hydroxyacylglutathione hydrolase [Brucella abortus str. 2308 A]
 gi|260546054|ref|ZP_05821794.1| hydroxyacylglutathione hydrolase [Brucella abortus NCTC 8038]
 gi|260562850|ref|ZP_05833336.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260567577|ref|ZP_05838047.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 4 str. 40]
 gi|260755615|ref|ZP_05867963.1| glyoxalase II [Brucella abortus bv. 6 str. 870]
 gi|260758840|ref|ZP_05871188.1| glyoxalase II [Brucella abortus bv. 4 str. 292]
 gi|260760564|ref|ZP_05872907.1| glyoxalase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884641|ref|ZP_05896255.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 9 str. C68]
 gi|261214889|ref|ZP_05929170.1| glyoxalase II [Brucella abortus bv. 3 str. Tulya]
 gi|261217765|ref|ZP_05932046.1| hydroxyacylglutathione hydrolase [Brucella ceti M13/05/1]
 gi|261220992|ref|ZP_05935273.1| hydroxyacylglutathione hydrolase [Brucella ceti B1/94]
 gi|261315020|ref|ZP_05954217.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis
           M163/99/10]
 gi|261316423|ref|ZP_05955620.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis B2/94]
 gi|261321387|ref|ZP_05960584.1| hydroxyacylglutathione hydrolase [Brucella ceti M644/93/1]
 gi|261323882|ref|ZP_05963079.1| hydroxyacylglutathione hydrolase [Brucella neotomae 5K33]
 gi|261751085|ref|ZP_05994794.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 5 str. 513]
 gi|261755647|ref|ZP_05999356.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 3 str. 686]
 gi|261758878|ref|ZP_06002587.1| hydroxyacylglutathione hydrolase [Brucella sp. F5/99]
 gi|265987494|ref|ZP_06100051.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis M292/94/1]
 gi|265991966|ref|ZP_06104523.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993699|ref|ZP_06106256.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996951|ref|ZP_06109508.1| hydroxyacylglutathione hydrolase [Brucella ceti M490/95/1]
 gi|265999286|ref|ZP_05465676.2| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 2 str.
           63/9]
 gi|297247177|ref|ZP_06930895.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|189041218|sp|A9M8S2|GLO2_BRUC2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|189041219|sp|B0CIU0|GLO2_BRUSI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723984|sp|B2S889|GLO2_BRUA1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798840|sp|C0RFI1|GLO2_BRUMB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|148371886|gb|ABQ61865.1| hydroxyacylglutathione hydrolase [Brucella ovis ATCC 25840]
 gi|161336665|gb|ABX62970.1| Probable hydroxyacylglutathione hydrolase [Brucella canis ATCC
           23365]
 gi|163674682|gb|ABY38793.1| Probable hydroxyacylglutathione hydrolase [Brucella suis ATCC
           23445]
 gi|189020576|gb|ACD73298.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|225641739|gb|ACO01653.1| hydroxyacylglutathione hydrolase [Brucella melitensis ATCC 23457]
 gi|237788364|gb|EEP62579.1| hydroxyacylglutathione hydrolase [Brucella abortus str. 2308 A]
 gi|260096161|gb|EEW80037.1| hydroxyacylglutathione hydrolase [Brucella abortus NCTC 8038]
 gi|260152866|gb|EEW87958.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260157095|gb|EEW92175.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 4 str. 40]
 gi|260669158|gb|EEX56098.1| glyoxalase II [Brucella abortus bv. 4 str. 292]
 gi|260670996|gb|EEX57817.1| glyoxalase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675723|gb|EEX62544.1| glyoxalase II [Brucella abortus bv. 6 str. 870]
 gi|260874169|gb|EEX81238.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 9 str. C68]
 gi|260916496|gb|EEX83357.1| glyoxalase II [Brucella abortus bv. 3 str. Tulya]
 gi|260919576|gb|EEX86229.1| hydroxyacylglutathione hydrolase [Brucella ceti B1/94]
 gi|260922854|gb|EEX89422.1| hydroxyacylglutathione hydrolase [Brucella ceti M13/05/1]
 gi|261294077|gb|EEX97573.1| hydroxyacylglutathione hydrolase [Brucella ceti M644/93/1]
 gi|261295646|gb|EEX99142.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis B2/94]
 gi|261299862|gb|EEY03359.1| hydroxyacylglutathione hydrolase [Brucella neotomae 5K33]
 gi|261304046|gb|EEY07543.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis
           M163/99/10]
 gi|261738862|gb|EEY26858.1| hydroxyacylglutathione hydrolase [Brucella sp. F5/99]
 gi|261740838|gb|EEY28764.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 5 str. 513]
 gi|261745400|gb|EEY33326.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 3 str. 686]
 gi|262551419|gb|EEZ07409.1| hydroxyacylglutathione hydrolase [Brucella ceti M490/95/1]
 gi|262764680|gb|EEZ10601.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003032|gb|EEZ15325.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093047|gb|EEZ17197.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659691|gb|EEZ29952.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis M292/94/1]
 gi|297174346|gb|EFH33693.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|326409937|gb|ADZ67002.1| Beta-lactamase-like protein [Brucella melitensis M28]
          Length = 260

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 155/241 (64%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK+ F
Sbjct: 18  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKEKF 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 78  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 198 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|17986413|ref|NP_539047.1| hydroxyacylglutathione hydrolase, mitochondrial [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502786|ref|NP_698913.1| hydroxyacylglutathione hydrolase [Brucella suis 1330]
 gi|62290790|ref|YP_222583.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700701|ref|YP_415275.1| beta-lactamase-like protein [Brucella melitensis biovar Abortus
           2308]
 gi|225628134|ref|ZP_03786169.1| hydroxyacylglutathione hydrolase [Brucella ceti str. Cudo]
 gi|254690077|ref|ZP_05153331.1| Beta-lactamase-like protein [Brucella abortus bv. 6 str. 870]
 gi|254694565|ref|ZP_05156393.1| Beta-lactamase-like protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696190|ref|ZP_05158018.1| Beta-lactamase-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700577|ref|ZP_05162405.1| Beta-lactamase-like protein [Brucella suis bv. 5 str. 513]
 gi|254704947|ref|ZP_05166775.1| Beta-lactamase-like protein [Brucella suis bv. 3 str. 686]
 gi|254707539|ref|ZP_05169367.1| Beta-lactamase-like protein [Brucella pinnipedialis M163/99/10]
 gi|254708924|ref|ZP_05170735.1| Beta-lactamase-like protein [Brucella pinnipedialis B2/94]
 gi|254713649|ref|ZP_05175460.1| Beta-lactamase-like protein [Brucella ceti M644/93/1]
 gi|254715997|ref|ZP_05177808.1| Beta-lactamase-like protein [Brucella ceti M13/05/1]
 gi|254731108|ref|ZP_05189686.1| Beta-lactamase-like protein [Brucella abortus bv. 4 str. 292]
 gi|256030450|ref|ZP_05444064.1| Beta-lactamase-like protein [Brucella pinnipedialis M292/94/1]
 gi|256045540|ref|ZP_05448423.1| Beta-lactamase-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059910|ref|ZP_05450096.1| Beta-lactamase-like protein [Brucella neotomae 5K33]
 gi|256112268|ref|ZP_05453189.1| Beta-lactamase-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158434|ref|ZP_05456332.1| Beta-lactamase-like protein [Brucella ceti M490/95/1]
 gi|256253854|ref|ZP_05459390.1| Beta-lactamase-like protein [Brucella ceti B1/94]
 gi|256258330|ref|ZP_05463866.1| Beta-lactamase-like protein [Brucella abortus bv. 9 str. C68]
 gi|256370338|ref|YP_003107849.1| hydroxyacylglutathione hydrolase, putative [Brucella microti CCM
           4915]
 gi|260169359|ref|ZP_05756170.1| hydroxyacylglutathione hydrolase, putative [Brucella sp. F5/99]
 gi|75496179|sp|Q57AW2|GLO2_BRUAB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81751975|sp|Q8FYE7|GLO2_BRUSU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81852553|sp|Q8YJF4|GLO2_BRUME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123546237|sp|Q2YLU8|GLO2_BRUA2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160386917|sp|A5VSR1|GLO2_BRUO2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|17982007|gb|AAL51311.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|23348807|gb|AAN30828.1| hydroxyacylglutathione hydrolase, putative [Brucella suis 1330]
 gi|62196922|gb|AAX75222.1| hydroxyacylglutathione hydrolase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616802|emb|CAJ11892.1| Beta-lactamase-like [Brucella melitensis biovar Abortus 2308]
 gi|225616959|gb|EEH14006.1| hydroxyacylglutathione hydrolase [Brucella ceti str. Cudo]
 gi|256000501|gb|ACU48900.1| hydroxyacylglutathione hydrolase, putative [Brucella microti CCM
           4915]
 gi|326539650|gb|ADZ87865.1| hydroxyacylglutathione hydrolase [Brucella melitensis M5-90]
          Length = 257

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 155/241 (64%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK+ F
Sbjct: 15  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKEKF 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 75  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N  L+
Sbjct: 135 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNSALK 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 195 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 254

Query: 253 N 253
           +
Sbjct: 255 D 255


>gi|241206561|ref|YP_002977657.1| hydroxyacylglutathione hydrolase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860451|gb|ACS58118.1| hydroxyacylglutathione hydrolase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 256

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 173/254 (68%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAISLYH-DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I + L   DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH 
Sbjct: 1   MKPLEIDVFLCRTDNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHT 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK+ F C I GP+ E+  IPG+D  ++DGD+F FG H + +I TPGHT GHI
Sbjct: 61  DHVTANLALKEQFGCEIIGPINEAVAIPGLDRTMADGDSFLFGDHTVNVIETPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF++D  L   DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT +NA 
Sbjct: 121 CYHFVDDKLLFAADTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L+   ++++++R+   +T P+T+ LEK+ NPFLR  + ++R+NL ME  
Sbjct: 181 FALTVDPDNERLKSRAAEIEALRADGKFTIPTTLGLEKETNPFLRAADPAIRRNLLMEGK 240

Query: 240 SNLAVFTELRIRKN 253
           +N  VF E+R RK+
Sbjct: 241 TNEEVFAEIRKRKD 254


>gi|254717995|ref|ZP_05179806.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
          Length = 257

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 154/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK  F
Sbjct: 15  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKAKF 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 75  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N  L+
Sbjct: 135 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNSALK 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 195 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 254

Query: 253 N 253
           +
Sbjct: 255 D 255


>gi|265982941|ref|ZP_06095676.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
 gi|306839774|ref|ZP_07472575.1| hydroxyacylglutathione hydrolase [Brucella sp. NF 2653]
 gi|264661533|gb|EEZ31794.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
 gi|306405129|gb|EFM61407.1| hydroxyacylglutathione hydrolase [Brucella sp. NF 2653]
          Length = 260

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 154/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK  F
Sbjct: 18  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKAKF 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 78  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 198 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|222087365|ref|YP_002545902.1| hydroxyacylgluthatione hydrolase protein [Agrobacterium radiobacter
           K84]
 gi|221724813|gb|ACM27969.1| hydroxyacylgluthatione hydrolase protein [Agrobacterium radiobacter
           K84]
          Length = 256

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 173/254 (68%), Gaps = 1/254 (0%)

Query: 1   MTSLNIAISL-YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L + + L   DNF +L+H+ +   TA+IDAP+   I    + +GW +THI  THHH 
Sbjct: 1   MKPLELEVFLCRSDNFGVLVHDPETGYTASIDAPEAGPILAAAKRRGWTITHILTTHHHT 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK+ F C I GP+ E+  IPG+D    DGD+F+FG+H + +I TPGHT GHI
Sbjct: 61  DHVDANLALKEQFGCEIIGPIGEAVAIPGLDRAYGDGDSFEFGNHTVDVIETPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF++D  L   DTLF+LGCGR+FE    +M+ SL+K+    D+T IYFGHEYT +NA 
Sbjct: 121 CYHFVDDKLLFAADTLFALGCGRLFERPAMDMWASLQKLAVLPDETAIYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L+   + ++++R+   +T P+T++LEK+ NPFLR  + S+R++L ME+ 
Sbjct: 181 FALTIDPDNERLKSRAADIEALRAAGKFTIPTTLALEKETNPFLRAADPSIRRHLLMESR 240

Query: 240 SNLAVFTELRIRKN 253
           SN  VFTE+R RK+
Sbjct: 241 SNEEVFTEIRKRKD 254


>gi|154252030|ref|YP_001412854.1| hydroxyacylglutathione hydrolase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155980|gb|ABS63197.1| Hydroxyacylglutathione hydrolase [Parvibaculum lavamentivorans
           DS-1]
          Length = 256

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 154/254 (60%), Gaps = 1/254 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           MT L I       DN+  L+H     +TAAID P+   I   L EKGW LTHI NTHHH 
Sbjct: 1   MTKLQIHQFPCLSDNYGYLVHEPSSGMTAAIDTPEVKPILDALAEKGWKLTHILNTHHHF 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  LK+   CTI GP  E   IPGID  + +GD  + G+   +++  PGHT GHI
Sbjct: 61  DHAGGNAELKEKTGCTIIGPKGEEGAIPGIDRAVQEGDIVELGAARARVLDVPGHTRGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F +DH   VGDTLF+LGCGR+FE +  +M+ SL K+ +  D T +Y  HEYT++NA 
Sbjct: 121 AYSFDDDHIAFVGDTLFALGCGRLFEGTAQQMWTSLGKLMALPDDTVVYCAHEYTQSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P N  L     ++ + R++  +T P+TI LEK  NPFLR  +  LR+ + +E A
Sbjct: 181 FALSVEPQNEALIARAKEIDAKRARGEWTVPTTIGLEKATNPFLRAASADLRRTIGLETA 240

Query: 240 SNLAVFTELRIRKN 253
           +++ VF E R RK+
Sbjct: 241 ADVDVFAETRKRKD 254


>gi|294851178|ref|ZP_06791851.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|294819767|gb|EFG36766.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
          Length = 260

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 155/241 (64%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH++H   N  LK+ F
Sbjct: 18  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLNHVEGNEPLKEKF 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 78  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 198 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|306843386|ref|ZP_07475987.1| hydroxyacylglutathione hydrolase [Brucella sp. BO1]
 gi|306276077|gb|EFM57777.1| hydroxyacylglutathione hydrolase [Brucella sp. BO1]
          Length = 260

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 154/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK  F
Sbjct: 18  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKAKF 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 78  GVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEY++NNA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYSQNNARFALTIDPDNSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI++E   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 198 ERAREIARLRAHERMTLPSTIAIEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|319404907|emb|CBI78508.1| hydroxyacylglutathione hydrolase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 253

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 158/242 (65%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DNF ILIH+ K   TAAIDAP+   I  ML+++ W L  IF THHH DH  A   LK+ 
Sbjct: 10  EDNFGILIHDEKSGCTAAIDAPEGKAIYNMLKKRNWTLQFIFVTHHHYDHVEALAELKQA 69

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
           +N  I GP  ES KI  +DH L   +TF FG+  +  ++TPGHT+G + Y+F     L  
Sbjct: 70  YNAMIIGPAAESKKITPLDHTLQPDETFCFGTQTLMALSTPGHTLGALSYYFPQAKLLFA 129

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYTE NA FAL+ DP N +L
Sbjct: 130 GDTLFSLGCGRLFEGTPLKMLTSLKKLRQLPDETILYCGHEYTEKNALFALTIDPQNRKL 189

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
            +   +V S+R+QN  T P+T+  EK+ NPFLR ++  LRKNL ME A++  VF E+R R
Sbjct: 190 HQRAEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDDPILRKNLAMEKATDEEVFAEIRKR 249

Query: 252 KN 253
           K+
Sbjct: 250 KD 251


>gi|306842915|ref|ZP_07475551.1| hydroxyacylglutathione hydrolase [Brucella sp. BO2]
 gi|306286938|gb|EFM58458.1| hydroxyacylglutathione hydrolase [Brucella sp. BO2]
          Length = 257

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 154/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK  F
Sbjct: 15  DNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLKAKF 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP +E +KIPGID  +   D F FG   +K+I+TPGHT G I Y+  +   +  G
Sbjct: 75  GVSIIGPEDEKAKIPGIDRTVKGDDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVVFTG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEY++NNA FAL+ DP N  L+
Sbjct: 135 DTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYSQNNARFALTIDPDNSALK 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R RK
Sbjct: 195 ERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIRKRK 254

Query: 253 N 253
           +
Sbjct: 255 D 255


>gi|319407867|emb|CBI81520.1| hydroxyacylglutathione hydrolase [Bartonella sp. 1-1C]
          Length = 253

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/241 (48%), Positives = 158/241 (65%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF ILIH+ K   TAAIDAP+   I  ML+++ W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGILIHDEKSGCTAAIDAPEGKAIHNMLKKRNWTLQFIFVTHHHYDHVEALAELKQAY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  I GP  ES KI  +DH L   +TF FG+  +  ++TPGHT+G + Y+F     L  G
Sbjct: 71  NAMIIGPAAESKKITPLDHTLQPDETFCFGTQTLMALSTPGHTLGGLSYYFPQAKLLFAG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYTE NA FAL+ DP N +L 
Sbjct: 131 DTLFSLGCGRLFEGTPLKMLTSLKKLRQLPDETILYCGHEYTEKNALFALTIDPQNRKLH 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V S+R+QN  T P+T+  EK+ NPFLR ++  LRKN+ ME A++  VF E+R RK
Sbjct: 191 QRAEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDDPILRKNIAMEKATDEEVFAEIRKRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|319899513|ref|YP_004159610.1| hydroxyacylglutathione hydrolase [Bartonella clarridgeiae 73]
 gi|319403481|emb|CBI77061.1| hydroxyacylglutathione hydrolase [Bartonella clarridgeiae 73]
          Length = 253

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 159/241 (65%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  LIH+ K   TAAIDAP+   I  ML++  W L  IF THHH DH  A   LKK +
Sbjct: 11  DNFGTLIHDKKSGYTAAIDAPEGKSIHNMLKQHNWTLQFIFVTHHHHDHVEALAELKKVY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N TI GP  ES KI  +D+ L   + F FG+H +  ++TPGHT+G + Y+F   + L  G
Sbjct: 71  NATIIGPEAESKKIALLDYTLQPDENFCFGTHTLAALSTPGHTLGALSYYFPQANLLFAG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYT+ NA FAL+ DP N +L 
Sbjct: 131 DTLFSLGCGRLFEGTPLQMLTSLKKLRQLPDETILYCGHEYTKTNALFALTIDPQNRKLH 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V  +R+QN  T P+T+  EK +NPFLR ++T LRKNL MENA++  VF E+R RK
Sbjct: 191 QRVEEVFLLRAQNAMTLPTTLGQEKDINPFLRWDDTILRKNLAMENATDEEVFAEIRKRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|319406393|emb|CBI80034.1| hydroxyacylglutathione hydrolase [Bartonella sp. AR 15-3]
          Length = 253

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 160/241 (66%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF ILIH+ K   TAAIDAP++  I  ML+++ W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGILIHDEKSGYTAAIDAPESNAIHDMLKQRNWTLQFIFVTHHHHDHIEALAELKQVY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  I GP  E  KI  +D+ L   + F FG++ +  ++TPGHT+G + Y+F   + L  G
Sbjct: 71  NAMIIGPEAERKKITPLDYALQPDENFCFGTYTLTALSTPGHTLGALSYYFSQANLLFTG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE + ++M  SL+K++   D+T +Y GHEYT+ NA FAL+ DP N +L 
Sbjct: 131 DTLFSLGCGRLFEGTPSQMLTSLKKLRQLPDETILYCGHEYTQINALFALTIDPQNRKLH 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V S+R+QN  T P+T+  EK+ NPFLR + + LRKNL ME A++  VF E+R RK
Sbjct: 191 QRVEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDASILRKNLAMEKATDEEVFAEIRRRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|163869372|ref|YP_001610628.1| hydroxyacylglutathione hydrolase [Bartonella tribocorum CIP 105476]
 gi|189041217|sp|A9IZW8|GLO2_BART1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|161019075|emb|CAK02633.1| hydroxyacylglutathione hydrolase [Bartonella tribocorum CIP 105476]
          Length = 253

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 158/241 (65%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+ K  +TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGVLIHDEKSGMTAAIDAPESKAIHNALKRRNWTLHTIFVTHHHHDHVEALAELKQVY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  +FGP  E +KI  +D  L   +   FGS  +  ++TPGHT+G + Y+F     L  G
Sbjct: 71  NAIVFGPAAEKNKIYHLDQTLQSDEKLLFGSQSLLALSTPGHTLGALSYYFPEKKLLFAG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE +  +M  SL+K+    D+T +Y GHEYT+NNA FAL+ DPHN +LQ
Sbjct: 131 DTLFSLGCGRLFEGTAVQMLNSLKKLCKLPDETLLYCGHEYTKNNALFALTLDPHNQKLQ 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V S+R++N  T P T+  EK  NPFLR  + ++RKNL+M+++++  VF E+R RK
Sbjct: 191 QRAEEVLSLRAKNAMTLPVTLGQEKATNPFLRWNDPAIRKNLSMKDSTDEEVFAEIRKRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|49476313|ref|YP_034354.1| hydroxyacylglutathione hydrolase [Bartonella henselae str.
           Houston-1]
 gi|81647469|sp|Q6G1L3|GLO2_BARHE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49239121|emb|CAF28425.1| Hydroxyacylglutathione hydrolase [Bartonella henselae str.
           Houston-1]
          Length = 253

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 156/241 (64%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGVLIHDETSGYTAAIDAPESNAIQNALKRRNWTLQTIFLTHHHHDHVEALAELKQIY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + GP  E  KI  ID  L   ++F FG+H I  ++TPGHT+G + Y+F  ++ L  G
Sbjct: 71  KAIVIGPEAEKEKISHIDQTLKPDESFLFGTHTILALSTPGHTLGALSYYFPQENLLFAG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE + A+M  SL+K++   D+T +Y GHEYT++NA FAL+ DP+N +LQ
Sbjct: 131 DTLFSLGCGRLFEGTPAQMLNSLKKLRQLPDETLLYCGHEYTKSNALFALTLDPYNQKLQ 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +    V  +R++N  T P T+  EKK NPFLR +N +LRK L ME  ++  VF E+R RK
Sbjct: 191 QRAEDVFLLRAKNAMTLPVTLGQEKKNNPFLRWDNRTLRKTLRMEKETDEEVFAEIRKRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|153008258|ref|YP_001369473.1| hydroxyacylglutathione hydrolase [Ochrobactrum anthropi ATCC 49188]
 gi|160395511|sp|A6WXE0|GLO2_OCHA4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|151560146|gb|ABS13644.1| Hydroxyacylglutathione hydrolase [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 157/241 (65%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA+IDAPD   I   L+ +GW L  IF THHH+DH   N  LK  +
Sbjct: 18  DNYGVLIHDPQSALTASIDAPDAAAIEAALKRRGWTLDFIFTTHHHLDHVEGNEALKAKY 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             +I GP  E +KIPGID  + DGD F FG   +K+IATPGHT G + Y+  +   +  G
Sbjct: 78  GVSIIGPKAEETKIPGIDRTVKDGDEFTFGLFRVKVIATPGHTAGEVSYYLPDAKAVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +   MF+SL+K+ +    T +Y GHEYTE+NA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPLTMFQSLQKLVALPGDTAVYCGHEYTESNARFALTIDPANSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  +++  +R+ +  T PS+I+LE   NPFLR  +  +R  L +++A + AVF E+R RK
Sbjct: 198 ERAAEIARLRAADRMTLPSSIALEMATNPFLRWHDAGIRSRLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|114570931|ref|YP_757611.1| hydroxyacylglutathione hydrolase [Maricaulis maris MCS10]
 gi|122315366|sp|Q0AM20|GLO2_MARMM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114341393|gb|ABI66673.1| Hydroxyacylglutathione hydrolase [Maricaulis maris MCS10]
          Length = 256

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/241 (44%), Positives = 146/241 (60%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  LIH+     TA ID PD  +I     + GW +T I+NTHHH DH   N  ++   
Sbjct: 14  DNYGFLIHDPDSGETATIDTPDADVILNEADQAGWSITQIWNTHHHFDHAGGNETIQALT 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P  +  +IPGI   + DGD    G H  K+  TPGHT+GH+CYH   D    VG
Sbjct: 74  GAKVVAPRYDRHRIPGISMEVEDGDVISLGDHKAKVFYTPGHTMGHVCYHMPMDGIAFVG 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE + AEM+ SL ++ +  D+T IY  HEYTE NA FALS DP N +LQ
Sbjct: 134 DTLFALGCGRLFEGTPAEMWHSLSRLAALPDETRIYCAHEYTEANARFALSIDPDNHDLQ 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
            Y + V+  R++   T P+TI+ EK  NPFLR ++ ++R  L ME+  +  VF E+R RK
Sbjct: 194 VYAAMVEGERARGEPTVPTTIAAEKAANPFLRPDDPAIRARLGMEHDDDEEVFAEIRRRK 253

Query: 253 N 253
           +
Sbjct: 254 D 254


>gi|319781260|ref|YP_004140736.1| hydroxyacylglutathione hydrolase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167148|gb|ADV10686.1| hydroxyacylglutathione hydrolase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 255

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 151/241 (62%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ K   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK+ F
Sbjct: 13  DNFGVLVHDPKSGQTAIIDAPEEAPILAAIKRTGWTPTMILTTHHHMDHVEANLALKERF 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E +KIPGID  + DG     G   I++IATPGHT GH+ Y+          
Sbjct: 73  KLRIVGPEAEKAKIPGIDETVEDGSVLHLGDERIEVIATPGHTAGHVSYYLPASSVAFTA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE     M++SL+K+ +   +T IY GHEYT +NA FAL+ DP N  L+
Sbjct: 133 DTLFALGCGRLFECKPPVMYDSLKKLAALPAETAIYCGHEYTLSNARFALTVDPSNSALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  ++++ +R++N  T P+TI  E   NPFLR  + ++RK+L +E AS+  VF E+R RK
Sbjct: 193 ERAARIEKLRAENKPTLPTTIGEELSTNPFLRWHDPAIRKHLGLEKASDAEVFAEIRKRK 252

Query: 253 N 253
           +
Sbjct: 253 D 253


>gi|13473061|ref|NP_104628.1| putative glyoxalase II [Mesorhizobium loti MAFF303099]
 gi|81779472|sp|Q98G02|GLO2_RHILO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|14023809|dbj|BAB50414.1| putative glyoxalase II [Mesorhizobium loti MAFF303099]
          Length = 255

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 146/241 (60%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ K   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK+ F
Sbjct: 13  DNFGVLVHDPKSGQTAIIDAPEEAPILAAIKRTGWTPTMILTTHHHMDHVEANLALKERF 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E +KIPGID  + +G     G   I++IATPGHT GH+ YH          
Sbjct: 73  KLRIVGPEAEKAKIPGIDETVEEGSVLHLGDERIEVIATPGHTAGHVSYHLPASKVAFTA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE     M+ESL K+ +    T IY GHEYT  NA FAL+ DP N  L+
Sbjct: 133 DTLFALGCGRLFECKPPVMYESLRKLAALPAATTIYCGHEYTLANARFALTVDPTNSALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  ++++++R  N  T P+TI  E   NPFLR  + ++RK+L ME A +  VF E+R RK
Sbjct: 193 ERATRIEALRVDNKPTLPTTIGEELSTNPFLRWHDPAIRKHLGMEKAGDAEVFAEIRKRK 252

Query: 253 N 253
           +
Sbjct: 253 D 253


>gi|110635409|ref|YP_675617.1| beta-lactamase-like [Mesorhizobium sp. BNC1]
 gi|123057520|sp|Q11DS3|GLO2_MESSB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110286393|gb|ABG64452.1| beta-lactamase-like protein [Chelativorans sp. BNC1]
          Length = 255

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 153/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF IL  + +  +TA +DAP+   I + ++  GW  + +  THHH DH  ANL LK+ F
Sbjct: 13  DNFGILARDSETGITALVDAPEEQAILEAIKRTGWTPSLLLITHHHADHVEANLALKERF 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             TI GP +E+SKIPGID  +++GD    G+   ++I TPGHT GHI ++F         
Sbjct: 73  GLTIIGPAKEASKIPGIDRQVNEGDVVRVGNQEARVIETPGHTAGHITFYFAKAGIAFTA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE     M+ESL+K+     +T IY GHEYTE+NA FALS DP N  L+
Sbjct: 133 DTLFALGCGRLFECKPPVMYESLKKLVELPLETVIYCGHEYTESNARFALSVDPTNSALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   K++++R +   T P+T+  E   NPFLR  +  LR NL M+NA+++ VF E+R RK
Sbjct: 193 ERAKKIEALRREGRPTLPTTLGEEMATNPFLRCHDPVLRNNLGMKNAADVEVFAEIRKRK 252

Query: 253 N 253
           +
Sbjct: 253 D 253


>gi|239833061|ref|ZP_04681390.1| hydroxyacylglutathione hydrolase [Ochrobactrum intermedium LMG
           3301]
 gi|239825328|gb|EEQ96896.1| hydroxyacylglutathione hydrolase [Ochrobactrum intermedium LMG
           3301]
          Length = 260

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 154/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH+ +  LTA+IDAPD   +   L+ +GW L  IF THHH+DH   N  LK  +
Sbjct: 18  DNYGVLIHDPQSALTASIDAPDAAAVEAALKRRGWTLDFIFTTHHHLDHVEGNEALKAKY 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E +KIPGID  + DGD F FG   +K IATPGHT G I Y+  +   +  G
Sbjct: 78  GVGIIGPKAEETKIPGIDRTVKDGDEFTFGLFRVKAIATPGHTAGEISYYIPDAKAVFTG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +   MF+SL K+ +    T +Y GHEYTE+NA FAL+ DP N  L+
Sbjct: 138 DTLFALGCGRLFEGTPLTMFQSLLKLIALPGDTAVYCGHEYTESNARFALTIDPANSALK 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  +++  +R+ +  T PS+I+LE   NPFLR  +  +R  L +++A + AVF E+R RK
Sbjct: 198 ERAAEIARLRAADRMTLPSSIALEMATNPFLRWHDAGIRSRLGLQDAPDEAVFAEIRKRK 257

Query: 253 N 253
           +
Sbjct: 258 D 258


>gi|218661950|ref|ZP_03517880.1| hydroxyacylgluthatione hydrolase protein [Rhizobium etli IE4771]
          Length = 232

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 154/219 (70%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TAAIDAP+   I +    +GW +THIF THHH DH  ANL LK+ F
Sbjct: 14  DNFGVLVHDPETGFTAAIDAPEEAPILEAATRRGWKITHIFTTHHHTDHVAANLALKEQF 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP+ E+  IPG+D  ++DGD F FG+H + +I TPGHT GHICYHF++D  L   
Sbjct: 74  GCEIIGPINEAVAIPGLDRTMADGDRFLFGNHTVNVIETPGHTAGHICYHFVDDKLLFAA 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT +NA FAL+ DP N  L+
Sbjct: 134 DTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLSNARFALTVDPDNERLK 193

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
              ++++++R++  +T P+T+ LEK+ NPFLR  + ++R
Sbjct: 194 SRAAEIEALRAEGKFTIPTTLGLEKETNPFLRAGDPAIR 232


>gi|240851396|ref|YP_002972799.1| hydroxyacylglutathione hydrolase [Bartonella grahamii as4aup]
 gi|240268519|gb|ACS52107.1| hydroxyacylglutathione hydrolase [Bartonella grahamii as4aup]
          Length = 253

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 154/242 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+ K   TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGVLIHDEKSGYTAAIDAPESEAIHNALKRRNWTLQTIFVTHHHHDHVEALEELKQVY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  + GP  E  KI  +D  L   +   FGSH +  ++TPGHT G + Y+F     L  G
Sbjct: 71  NAMVIGPEAEKEKIHHLDQTLQPDEKLLFGSHSLLALSTPGHTSGALSYYFPEKGLLFAG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYT+NNA+FAL+ DPHN +L 
Sbjct: 131 DTLFSLGCGRLFEGTPVQMLNSLKKLRQLPDETLLYCGHEYTKNNAFFALTIDPHNKKLH 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V  + + N  T P T+  EK  NPFLR +N ++RKNL+M NA++  VF E+R RK
Sbjct: 191 QRIEEVFLLSAGNAMTLPVTLGQEKTTNPFLRWDNPAIRKNLSMTNATDEEVFAEIRKRK 250

Query: 253 NQ 254
           ++
Sbjct: 251 DK 252


>gi|90420227|ref|ZP_01228135.1| hydroxyacylglutathione hydrolase (Glyoxalase II) [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335561|gb|EAS49311.1| hydroxyacylglutathione hydrolase (Glyoxalase II) [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 324

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 143/241 (59%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+     T AIDAP+   I   L   GW LTHI  THHH DH  AN  LK  F
Sbjct: 82  DNFGVLVHDKDTGTTIAIDAPEEQPILDALEATGWTLTHILTTHHHGDHVEANEALKARF 141

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP +E  +IPGID   S GDT D G   ++ I TPGHT+G + Y+  +   L   
Sbjct: 142 QVEIIGPAKERDRIPGIDRTASGGDTLDVGGIRVEAIDTPGHTLGEVSYYMPDAKALFAA 201

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D LFSLGCGR+FE   A M++SL+++++  D T +Y GHEYT  NA  A+  DP NL LQ
Sbjct: 202 DALFSLGCGRLFEGDAAMMWDSLQRLRALPDDTMLYCGHEYTATNARCAIDIDPQNLALQ 261

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V+ +R +   T P ++  EKK NPFLR ++  L+  + ME+A    VF  +R ++
Sbjct: 262 ERVKEVEHLRVEGKPTLPVSLGREKKTNPFLRADDPELKAAMGMEDAQPAEVFAAIRKKR 321

Query: 253 N 253
           +
Sbjct: 322 D 322


>gi|255078470|ref|XP_002502815.1| hydroxyacylglutathione hydrolase [Micromonas sp. RCC299]
 gi|226518081|gb|ACO64073.1| hydroxyacylglutathione hydrolase [Micromonas sp. RCC299]
          Length = 254

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 149/243 (61%), Gaps = 1/243 (0%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  L+H+     TA +D P+   I   L+EKGW LTHI NTHHH DHT  N  LK  
Sbjct: 10  QDNYSFLLHDPSTGATAVVDTPEVAPIEAALKEKGWKLTHILNTHHHWDHTGGNAELKAR 69

Query: 72  FNCTIFGPL-EESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLC 130
             C + GP  E   +IPG D  + +GD    G+   +++ TPGHT GH+ YHF  +  + 
Sbjct: 70  HGCVVIGPSGERKGEIPGADRAVREGDEVAVGNVVARVLDTPGHTAGHVVYHFPTEKKVF 129

Query: 131 VGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLE 190
           VGDT+F++GCGR+FE +  +M+ S++KI +    T ++  HEYT +NA FA+S +P N  
Sbjct: 130 VGDTMFAMGCGRLFEGTADQMWSSIQKITAMPPDTEVFCAHEYTLSNAKFAVSVEPDNEA 189

Query: 191 LQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRI 250
           LQ    +V+  R++ + T P+T++LE   NPF R ++  LR+ L +E A ++AVF E R 
Sbjct: 190 LQARLREVEVKRAKGVPTVPTTVALELATNPFCRPDSVLLRRTLGLEGADDVAVFAETRR 249

Query: 251 RKN 253
           RK+
Sbjct: 250 RKD 252


>gi|307822371|ref|ZP_07652603.1| hydroxyacylglutathione hydrolase [Methylobacter tundripaludum SV96]
 gi|307736937|gb|EFO07782.1| hydroxyacylglutathione hydrolase [Methylobacter tundripaludum SV96]
          Length = 254

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 150/248 (60%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + + + +DN+  L+H+     TA +D      +  +L +KGW LT I NTHHH DH   N
Sbjct: 5   LTLPVLNDNYIYLVHDPVSGETAVVDPAVAQPVLNVLDQKGWQLTTILNTHHHSDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           L LK+   CT+  PL +  +IPGID G+ DG+    G H  ++I+TPGHT GH+ YHF +
Sbjct: 65  LELKQKTGCTVIAPLSDQHRIPGIDRGVVDGNEITLGKHTARVISTPGHTSGHVVYHFAD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D+ L  GDTLF +GCGR+FE +  +M+ SL+K+K+    T IY  HEYT+ N  FAL+ +
Sbjct: 125 DNTLFCGDTLFVMGCGRLFEGTAEQMWHSLQKLKALPTSTRIYCAHEYTQANGRFALTVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +LQ+    +  +R+  L T PSTI  E   NPF R ++ +L++ + M N     VF
Sbjct: 185 PDNRQLQQRMDVINQLRANRLPTVPSTIEQELATNPFFREDSLALQETIKMANKKPAEVF 244

Query: 246 TELRIRKN 253
            E+R  K+
Sbjct: 245 AEVRRLKD 252


>gi|49474824|ref|YP_032866.1| hydroxyacylglutathione hydrolase [Bartonella quintana str.
           Toulouse]
 gi|81646713|sp|Q6FYC3|GLO2_BARQU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49240328|emb|CAF26810.1| Hydroxyacylglutathione hydrolase [Bartonella quintana str.
           Toulouse]
          Length = 253

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 152/241 (63%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+ +   TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK+ +
Sbjct: 11  DNFGVLIHDERSGYTAAIDAPESKAICSALKRRNWTLQTIFVTHHHHDHIEALAELKQIY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + GP  E  KI  +D  L   ++  FG+H +  ++TPGHT+G + Y+F  ++ L  G
Sbjct: 71  KAVVIGPEAEKEKIGHLDQALQPDESLFFGTHTLLALSTPGHTLGSLSYYFPQENLLFSG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE + A+M  S +K++   D+T +Y GHEYT+ NA FAL+ D HN +L 
Sbjct: 131 DTLFSLGCGRLFEGTPAQMLNSFKKLRQLPDETLLYCGHEYTKTNALFALTLDSHNQKLH 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +    V  +R++N  T P T+  EK  NPFLR ++ +LRKNL ME  ++  VF E+R RK
Sbjct: 191 QRVEDVFLLRAKNAMTLPVTLGQEKATNPFLRWDDRTLRKNLAMEKETDEEVFAEIRKRK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|300024273|ref|YP_003756884.1| hydroxyacylglutathione hydrolase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526094|gb|ADJ24563.1| hydroxyacylglutathione hydrolase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 266

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 145/243 (59%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+C+L+H+     TAAIDAP    I   L  + W L H+F THHH DHT     LK  +
Sbjct: 24  DNYCVLLHDPVSGETAAIDAPQAATIKAALDARNWRLNHLFITHHHTDHTAGIAELKGHY 83

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             ++ GP  E+ +IPG+  G+++    +F  HPI+++ TPGHT+GH+ +H  +D  +  G
Sbjct: 84  GASVTGPEAEAERIPGLTRGVTEATQLEFAGHPIRVLETPGHTLGHVTFHLPDDGLVFTG 143

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGRIFE     M+ S+ KI +    T IY GHEYT  NA FA++ +  N  L+
Sbjct: 144 DTLFSLGCGRIFEGDPQMMWNSVSKIAALPGDTRIYCGHEYTLGNARFAMNVELENAALK 203

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              + V++ R+    T P+TI LEK  NPFLR  +  +R  L ++ A +  VF  LR  K
Sbjct: 204 ARVADVEAARTAGEATIPTTIDLEKATNPFLRPGSRMIRARLGLDGAPDWEVFARLRQLK 263

Query: 253 NQS 255
           N++
Sbjct: 264 NKA 266


>gi|260466656|ref|ZP_05812843.1| hydroxyacylglutathione hydrolase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029519|gb|EEW30808.1| hydroxyacylglutathione hydrolase [Mesorhizobium opportunistum
           WSM2075]
          Length = 255

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 146/241 (60%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ +   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK+ F
Sbjct: 13  DNFGVLVHDPESGQTAIIDAPEEAPILAAVKRTGWTPTMILTTHHHMDHVEANLALKERF 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E +KIPGID  + +      G   I++IATPGHT GH+ YH          
Sbjct: 73  KLRIVGPEAEKAKIPGIDETVEESSVLHLGEERIEVIATPGHTAGHVSYHLPASKVAFTA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE     M+ SL+K+ +    T IY GHEYT  NA FAL+ DP N  L+
Sbjct: 133 DTLFALGCGRLFECKPPVMYGSLKKLAALPAATVIYCGHEYTLANARFALTVDPTNSALR 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  ++++++R+ N  T P+TI  E   NPFLR  + ++RK+L ME A +  VF E+R RK
Sbjct: 193 ERAARIEALRADNKPTLPTTIGEELSTNPFLRWHDPAIRKHLGMEKAGDAEVFAEIRKRK 252

Query: 253 N 253
           +
Sbjct: 253 D 253


>gi|159045231|ref|YP_001534025.1| putative hydroxyacylglutathione hydrolase [Dinoroseobacter shibae
           DFL 12]
 gi|157912991|gb|ABV94424.1| putative hydroxyacylglutathione hydrolase [Dinoroseobacter shibae
           DFL 12]
          Length = 256

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 150/242 (61%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+ +L+H+     TA++DA D   +   L++ GW L+ I+ THHH DHT     +K    
Sbjct: 15  NYGVLLHDPSSGATASVDAGDAAALRTALKKTGWTLSEIWITHHHADHTDGVAEIKAETG 74

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
           CT+ GP  +S+ I G+D    DGD FDF  H +++I TPGHTI  I ++   +  +  GD
Sbjct: 75  CTVIGPKPQSAPIAGVDTRYGDGDRFDFSGHEVRVIHTPGHTIDMINFYLPAEGVVFTGD 134

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF +GCGR+FE     M  SL+K+ +    T IY  HEYTE NA FAL+ DP N +L+ 
Sbjct: 135 TLFVMGCGRLFEGDGPMMHASLQKLAALPADTVIYCSHEYTEANADFALTVDPENPDLKD 194

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKN 253
             ++VK++R+Q+  T P+T++ E   NPFLR  +T +R +L +E AS+  VFTE+R RK+
Sbjct: 195 KAARVKALRAQDKPTVPTTLAEELATNPFLRAHDTRIRAHLGLETASDAEVFTEIRRRKD 254

Query: 254 QS 255
            S
Sbjct: 255 NS 256


>gi|217978058|ref|YP_002362205.1| hydroxyacylglutathione hydrolase [Methylocella silvestris BL2]
 gi|217503434|gb|ACK50843.1| hydroxyacylglutathione hydrolase [Methylocella silvestris BL2]
          Length = 256

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 145/244 (59%), Gaps = 1/244 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+ + R T A+DAPD   I   L  + W LT I  THHH DH +    LK  F
Sbjct: 13  DNFGVLVHDPETRATCAVDAPDGAPILAALAAREWELTDILLTHHHADHVQGVGALKAAF 72

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
               + GPL+E+ KI G+D  + +GD    GS   ++IA PGHT GH+ Y F  +    V
Sbjct: 73  PKARVVGPLKEAEKIGGLDLKVGEGDLVMVGSLAARVIAVPGHTSGHVAYWFEEEDLAFV 132

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF++GCGR FE+    +F SL K+ +  D+T +Y GHEYT  NA FALS +P N  L
Sbjct: 133 GDTLFAMGCGRAFEEPPDVLFHSLSKLAALPDETQVYCGHEYTLANAKFALSVEPGNTLL 192

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           ++   +V ++R+   +T P+TIS+E   NPFLR E   L+  + M  A   AVF  LR R
Sbjct: 193 KERAGEVAALRAAGKFTLPTTISIELATNPFLRAEEPELQAAVGMPGADPAAVFAVLRER 252

Query: 252 KNQS 255
           KN +
Sbjct: 253 KNHA 256


>gi|307943545|ref|ZP_07658889.1| hydroxyacylglutathione hydrolase [Roseibium sp. TrichSKD4]
 gi|307773175|gb|EFO32392.1| hydroxyacylglutathione hydrolase [Roseibium sp. TrichSKD4]
          Length = 260

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 147/245 (60%), Gaps = 1/245 (0%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
           +DNF +LIH  + + T AID PD     K L+++GW LTHI  THHH DH +   +LK  
Sbjct: 16  NDNFGLLIHEPQSKTTIAIDVPDAMPYKKELQDRGWTLTHILVTHHHWDHVQGIGDLKTG 75

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
            N  + GP     KI G+  G+ DGD    G   ++ I TPGHT+  I ++F   +    
Sbjct: 76  TNAVVIGPELSRDKIEGMSKGVEDGDKVLCGPLEVQAIGTPGHTLDQISWYFPQLNMAHT 135

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKS-FSDKTHIYFGHEYTENNAYFALSCDPHNLE 190
           GDTLF+LGCGR+FE     M+ SL K+K    D+T IY GHEYT  NA FAL  +P N +
Sbjct: 136 GDTLFALGCGRVFEGDKEMMWSSLSKLKRMLPDQTTIYCGHEYTLANALFALRVEPENQD 195

Query: 191 LQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRI 250
           L+   + ++++RS  L T P+T+ LEK  NPFLR +  SL+  L M   S+ AVFTE+R 
Sbjct: 196 LRARAAVIEALRSDQLPTLPTTMKLEKATNPFLRADQPSLKAALGMTGKSDAAVFTEIRT 255

Query: 251 RKNQS 255
           RK+ +
Sbjct: 256 RKDNA 260


>gi|294085709|ref|YP_003552469.1| hydroxyacylglutathione hydrolase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665284|gb|ADE40385.1| Hydroxyacylglutathione hydrolase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 274

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 150/241 (62%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +LIH +    TA IDA D       L + GW LTHIF THHH DHT     LK   
Sbjct: 32  DNYGVLIHCNDSGATACIDAGDAAATEAALAQTGWSLTHIFITHHHADHTAGLAALKATH 91

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  + GP   S+ I GID  L DGD+FDF +  + ++ATPGHT   I ++   +  +  G
Sbjct: 92  NAHVIGPPPRSAAISGIDSALWDGDSFDFANRQVHVMATPGHTTDMINFYLPEEKIVFTG 151

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE S+  M+ESLEK+ S  D T IY  HEYT+ NA FA++ DP N  L 
Sbjct: 152 DTLFALGCGRVFEGSFDMMWESLEKLLSLPDDTVIYCSHEYTKANADFAVTIDPENDALN 211

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           K  +++   R+ N+ T P+ +S+EK  NPFLR ++ S+R +L ME+A N  VF E+R RK
Sbjct: 212 KRHAQIIKQRANNIATVPTIMSVEKATNPFLRPDDASIRAHLGMEDARNADVFAEIRRRK 271

Query: 253 N 253
           +
Sbjct: 272 D 272


>gi|53802509|ref|YP_112875.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
 gi|81682989|sp|Q60BX0|GLO2_METCA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|53756270|gb|AAU90561.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
          Length = 256

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 146/248 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  L+H      TAA+D      + + L  +GW L H+ NTHHH DH   N
Sbjct: 5   LQIPVLEDNYVYLLHEPGSGATAAVDPAVAGPVLEALDARGWRLGHVLNTHHHGDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           L LK    CT+ G   +  +IPGID  L DG+ F  GS   +++  PGHT GH+ + F +
Sbjct: 65  LELKAATGCTVVGAAGDRHRIPGIDVALKDGEEFRLGSASARMLDVPGHTSGHVAFWFED 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLF+LGCGR+FE S  +M+ SLE++++   +T ++  HEYT+ NA FA++ +
Sbjct: 125 DAALFCGDTLFALGCGRLFEGSAEQMWRSLERLRALPAETKVFCAHEYTQANARFAVTIE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L++   +V+++R +   T PS +S E   NPFLR E+  +R  L +     + VF
Sbjct: 185 PGNAALRERVERVEALRREGAATVPSILSEELATNPFLRPESPEIRARLGLPGVPEVEVF 244

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 245 AEIRRRKD 252


>gi|68164579|gb|AAY87308.1| predicted hydroxyacylglutathione hydrolase [uncultured bacterium
           BAC17H8]
          Length = 251

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 152/253 (60%), Gaps = 7/253 (2%)

Query: 4   LNIAISLY---HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +++AI  +    DN+ +L+H+ +   TA IDA D       L   GW LT I+ THHH D
Sbjct: 1   MSLAIDQFTYNQDNYGVLLHDGETGETALIDAGDATAALSALESNGWELTQIWITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L    N  IFGP    + + GI+  ++DG +FDF    +++IATPGHT+  + 
Sbjct: 61  HTAGLQELVAETNAEIFGP----AGVAGIEQVMADGGSFDFARLKVEVIATPGHTLDMLN 116

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH   +  +  GDTLF++GCGR+FE   A M+ESL+++ +  D T IY GHEYT  NA F
Sbjct: 117 YHLPQEKLVFTGDTLFAMGCGRLFEGDAAMMWESLKRLMALDDDTIIYCGHEYTAANAAF 176

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP N+ LQ+    V  +R+    T P+ ++LEK+ NPFLR  +T++R NL + +  
Sbjct: 177 ALSVDPDNVALQRRAEAVAELRAAGAPTVPTIMALEKETNPFLRASDTAIRDNLGLPSVP 236

Query: 241 NLAVFTELRIRKN 253
           +  VF E+R RK+
Sbjct: 237 DEDVFAEIRRRKD 249


>gi|168025266|ref|XP_001765155.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683474|gb|EDQ69883.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 254

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 155/252 (61%), Gaps = 2/252 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+H+     T  +D      + K L+EKG  L +I NTHHH DHT  N
Sbjct: 3   IQVKCLVDNYAYLLHDTASGTTGIVDPSAAGPVVKALKEKGLSLDYILNTHHHWDHTGGN 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT-IGHICYHFM 124
            +LKK +N  + GP  +  +IPGID  L DG+T+ FG   ++++ TPGHT  GH+ ++F 
Sbjct: 63  ADLKKQYNAKVVGPRADQERIPGIDIALRDGETWMFGEQLMRVLDTPGHTRAGHVSFYFE 122

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFS+GCGR+FE S  +M+ SL K+ +  D T +Y GHEYT +NA FAL+ 
Sbjct: 123 RSKSLFTGDTLFSIGCGRLFEGSPEQMWISLSKLTALPDDTLVYCGHEYTMSNAKFALTV 182

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLA 243
           +P N+ LQ    +VK +R ++  T P+T+  EK+ NPFLR  +  LRK+LN+   AS++ 
Sbjct: 183 EPQNIALQSRAQQVKELRDKDQPTIPTTLREEKEFNPFLRPFSAELRKSLNVAAAASDID 242

Query: 244 VFTELRIRKNQS 255
            F  +R  K+++
Sbjct: 243 AFAAVRAAKDRA 254


>gi|209966686|ref|YP_002299601.1| glyoxalase II, putative [Rhodospirillum centenum SW]
 gi|209960152|gb|ACJ00789.1| glyoxalase II, putative [Rhodospirillum centenum SW]
          Length = 257

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 154/254 (60%), Gaps = 1/254 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L+I  I    DN+  L+ + +    A +D  D + +   L   GW LTHI NTHHH 
Sbjct: 1   MAPLDIRLIPALADNYVYLLRDPETGAVAVVDPADPFPVEAELNRLGWRLTHILNTHHHA 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  LK+ F   + GP  + ++IP ID    +GD F  G+ P+++I  PGHT GHI
Sbjct: 61  DHTAGNGELKRLFRARVIGPAADRARIPEIDEAYGEGDRFLLGARPVEVIDVPGHTRGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + F +   L  GD+LF+LGCGR+FE + A+M++SL K++   ++T +Y GHEYT +NA 
Sbjct: 121 AFWFSDAGALFSGDSLFALGCGRLFEGTPAQMWQSLLKLRRLPEETAVYCGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA++ DP N  L+   ++V+ +R+Q   T PS+I LE+  NPFLR ++ ++   + +  A
Sbjct: 181 FAVTVDPGNDALRARAAEVERLRTQGQPTLPSSIGLERATNPFLRADDPAVAAAVGLAGA 240

Query: 240 SNLAVFTELRIRKN 253
             + VF E+R RK+
Sbjct: 241 DPVTVFAEIRRRKD 254


>gi|303283280|ref|XP_003060931.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457282|gb|EEH54581.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 256

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 147/244 (60%), Gaps = 3/244 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+     TA +D P+   I   LREKGW LTHI NTH H DHT  N+ LK+  
Sbjct: 11  DNYAFLLHDPSTGCTAVVDTPEVAPIEAALREKGWKLTHILNTHWHGDHTGGNVELKREH 70

Query: 73  NCTIFGPLEE---SSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
            C I GP  E   +  IPG+D  +S+ D    G+   ++I  PGHT+GH+ Y+F  +  +
Sbjct: 71  ACEIVGPARERKGADAIPGMDRAVSEDDVVKIGNIEARVIDVPGHTLGHVAYYFPAERKV 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
            VGD LF+LGCGR+FE    +M+ S+ K+ +   +T +Y  HEYT  NA FA+S +P N 
Sbjct: 131 FVGDALFALGCGRMFEGKATQMWNSVSKLMALPRETEVYCAHEYTLANAKFAMSVEPGND 190

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L     +V+  R++  +T P+TI LE + NPF R  +  +R+N+ + +A ++AVF E R
Sbjct: 191 ALSARAKEVEEKRARGEWTVPTTIGLELETNPFCRPHSDEIRRNVGLVDADDVAVFKETR 250

Query: 250 IRKN 253
            RK+
Sbjct: 251 KRKD 254


>gi|302802971|ref|XP_002983239.1| hypothetical protein SELMODRAFT_268709 [Selaginella moellendorffii]
 gi|300148924|gb|EFJ15581.1| hypothetical protein SELMODRAFT_268709 [Selaginella moellendorffii]
          Length = 298

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 152/249 (61%), Gaps = 3/249 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ +        +D      + + L  +G  LTHI NTHHH DHT  N +
Sbjct: 52  IPCLKDNYAYLLRDASSGAIGVVDPSTAQPVIEALERRGLKLTHIINTHHHWDHTGGNAD 111

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LKK +   I  P  +   IPGID  L DGDT+  G H +K+I TPGHT GH+ Y+F +  
Sbjct: 112 LKKRYGAQIVAPPGDG--IPGIDVPLKDGDTWMLGEHAMKVIGTPGHTRGHVSYYFADSR 169

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFS+GCGR+FE S  +M+ SL K+ +  D+T ++ GHEYT +NA FA++ +P+
Sbjct: 170 AVFTGDTLFSIGCGRLFEGSAQQMWSSLSKLAALPDETRVFCGHEYTLSNAKFAMTIEPN 229

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFT 246
           N  L  +  KVK +R   L T PS++  EKK NPFLR  +  +R++LN+ ++AS+  VFT
Sbjct: 230 NPALNSHFEKVKQLRDSGLATIPSSVGEEKKFNPFLRPASREIRRSLNLSDDASDSDVFT 289

Query: 247 ELRIRKNQS 255
            +R  K+++
Sbjct: 290 AVRKAKDRA 298


>gi|288962843|ref|YP_003453137.1| hydroxyacylglutathione hydrolase [Azospirillum sp. B510]
 gi|288915109|dbj|BAI76593.1| hydroxyacylglutathione hydrolase [Azospirillum sp. B510]
          Length = 255

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 144/248 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++ +        +D  D   +   L  +GW LTHIF THHH DH    
Sbjct: 4   ILVPAFADNYIYVLRDAASGKVGVVDPGDAAPVQAELERRGWSLTHIFLTHHHDDHIGGA 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK      + G   ++ +IPG+D  L DGD   FG    +++A PGHT GHI + F  
Sbjct: 64  AALKARHGAIMVGARADAHRIPGLDVALGDGDRTVFGEQTARVMAVPGHTSGHIAFWFEA 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFSLGCGR+FE + A+M++SL  +++ +D+T +Y GHEYT++N  FAL+ D
Sbjct: 124 AETLFSGDTLFSLGCGRLFEGTPAQMWDSLRSLRALTDQTLVYCGHEYTQSNGRFALTVD 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L +   +V ++R +   T P+TI +E++ NPFLR ++  ++  + M  A  + VF
Sbjct: 184 PRNGALHQRMEEVAALRERGRPTLPTTIGMERRTNPFLRADDPGVQSAIGMAGAPAVEVF 243

Query: 246 TELRIRKN 253
            ELR RK+
Sbjct: 244 AELRRRKD 251


>gi|114706740|ref|ZP_01439640.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Fulvimarina pelagi HTCC2506]
 gi|114537688|gb|EAU40812.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Fulvimarina pelagi HTCC2506]
          Length = 254

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 138/241 (57%), Gaps = 2/241 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H  +   T AIDAP+   I   L   GW LTHI  THHH DH  AN  LK  F
Sbjct: 14  DNFGVLVH--RGDTTIAIDAPEERPILDALSASGWTLTHILTTHHHADHVAANEALKDRF 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E+S IPGID     GDT D G   +++IATPGHT+G I Y+      L   
Sbjct: 72  GVKIIGPKGEASNIPGIDETAEGGDTLDVGGIEVRVIATPGHTLGEISYYLPEAKALFAA 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D LFSLGCGR+FE   A M+ SL++++   D T +Y GHEYT  NA  AL  DP+NL +Q
Sbjct: 132 DALFSLGCGRLFEGDPAMMWTSLKRLRDLPDDTMLYCGHEYTATNARCALDLDPNNLLVQ 191

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  S+V+ +R+    T P  +  EKK NPFLR ++   +  + M  A  + VF   R  +
Sbjct: 192 ERASEVEHLRAAGKPTIPVELGREKKTNPFLRADDPEFQTAVGMAGADPVEVFAHARKTR 251

Query: 253 N 253
           +
Sbjct: 252 D 252


>gi|46200874|ref|ZP_00056264.2| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 257

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 145/247 (58%), Gaps = 1/247 (0%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I +  DN+  L H     +TAAID   +  + + L  +GW LTHI NTHHH DHT ANL+
Sbjct: 9   IPVLSDNYVYLAHEPLGGVTAAIDPAVSEPVLERLAARGWTLTHILNTHHHGDHTGANLD 68

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L +   C + G   +S +IPGI   +SDG+TF  G   + ++  PGHT GH+ Y F + H
Sbjct: 69  LARRTGCAVVGAARDSGRIPGITLEVSDGETFMLGHAAVTVLDVPGHTSGHVAYWFADSH 128

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE S  EM+ SL+K++     T  Y  HEYT  N  FA   +  
Sbjct: 129 VLFCGDTLFSLGCGRLFEGSAEEMWASLKKLRDLPSDTMAYPAHEYTAANGRFAKLVERD 188

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-VFT 246
           N  L+    +V+ +R+ N  T P  ++ E+ VNPFLR +  S+ + + ME  ++ A VF 
Sbjct: 189 NQALKARLDEVERLRAGNRPTVPVRLAEERAVNPFLRADTASVARAVGMEPGADPAQVFA 248

Query: 247 ELRIRKN 253
           ELR RK+
Sbjct: 249 ELRRRKD 255


>gi|328541842|ref|YP_004301951.1| Hydroxyacylglutathione hydrolase (Glyoxalase II) [polymorphum
           gilvum SL003B-26A1]
 gi|326411593|gb|ADZ68656.1| Hydroxyacylglutathione hydrolase (Glyoxalase II) [Polymorphum
           gilvum SL003B-26A1]
          Length = 257

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 141/248 (56%), Gaps = 1/248 (0%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
           S   DNF +L+H+     T AID PD      +L E GW L HI  THHH DH +    L
Sbjct: 10  SCLSDNFGVLVHDPDSGATVAIDVPDAEPYLAVLSETGWTLGHILITHHHWDHVQGLAAL 69

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K+     + GP     KI G+D  + DGDT   G   +K IATPGHT+  I + F ++  
Sbjct: 70  KEATGARVVGPALSRDKIAGLDDTVEDGDTVHVGPWEVKAIATPGHTLDQISWWFPSEGI 129

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYFALSCDPH 187
              GDTLF+LGCGR+FE     M+ SL+K+ +    +T IY GHEYT  NA FAL+ DPH
Sbjct: 130 AHTGDTLFALGCGRVFEGDMEMMWASLDKLARLLPPETVIYCGHEYTAANARFALAVDPH 189

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L+    +V ++R+    T P+T++ E   NPFLR  +  L++ L  E A   AVF E
Sbjct: 190 NAALRARADEVAALRAAGRPTLPTTMARELATNPFLRARDPGLQRALGFEGADPAAVFAE 249

Query: 248 LRIRKNQS 255
           +R RK+++
Sbjct: 250 VRRRKDKA 257


>gi|148554902|ref|YP_001262484.1| hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
 gi|148500092|gb|ABQ68346.1| Hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
          Length = 278

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 139/244 (56%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H     +TAAID PD   I   L ++GW LTHI NTH H DH   N  LK+ +
Sbjct: 34  DNYAYLVHVEGSDVTAAIDTPDADAIIAELDKRGWTLTHILNTHWHPDHAGGNAALKQRY 93

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +   +I  ID  + D D  D G   +K++  PGHT  H+ + F       VG
Sbjct: 94  GALVIAPADPEGRIADIDRTVRDSDRLDLGGAEVKVLGVPGHTTDHVAFWFPETGAAFVG 153

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +  +M+ESL K+ +    T +Y  HEYT +NA FA++ +P N EL 
Sbjct: 154 DTLFALGCGRLFEGTPEQMWESLGKLTALPADTMVYCAHEYTASNARFAVTIEPGNAELV 213

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +    ++ +R  +  T P+TI LE + NPFLR  +  +R  L M    ++AVF E+R RK
Sbjct: 214 ERVDHIRRLREADTPTVPTTIGLELRTNPFLRTRSAEIRDRLEMPEDEDVAVFAEVRARK 273

Query: 253 NQSK 256
           +  K
Sbjct: 274 DSFK 277


>gi|312115065|ref|YP_004012661.1| hydroxyacylglutathione hydrolase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220194|gb|ADP71562.1| hydroxyacylglutathione hydrolase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 267

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 157/254 (61%), Gaps = 13/254 (5%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+    +TA+IDAPD   + + L   GW LTHI  THHH DH +    LK+  
Sbjct: 14  DNFGVLIHDPVTGVTASIDAPDGEAVRRELESAGWTLTHILVTHHHWDHIQGLQALKRDS 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLC-- 130
           NCTI+GP  E++++P +D  + + D   FG   +++I TPGHT GH+ Y F+ D      
Sbjct: 74  NCTIYGPAREAAELPVVDVEVHEDDRIPFGPFEVEVIETPGHTPGHVAY-FIPDAVQAEI 132

Query: 131 ---------VGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    VGDTLFS+GCGR+ +  Y++M+ SLEK+    ++T +Y GHEYT++N  FA
Sbjct: 133 TGQKSGLAFVGDTLFSVGCGRVNDGRYSDMWHSLEKLMRLPERTLLYVGHEYTQSNIKFA 192

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENAS 240
           L+ +P N+ L K   +V  +R+    T P T++ E + NPFLR  +  +RK+L++  + S
Sbjct: 193 LAVEPENIALHKRKEEVDRLRADGKPTLPVTLAKELETNPFLRPFSPEIRKSLDIGPDVS 252

Query: 241 NLAVFTELRIRKNQ 254
           + AVF ELR RK++
Sbjct: 253 DEAVFEELRRRKDR 266


>gi|27375333|ref|NP_766862.1| glyoxalase II [Bradyrhizobium japonicum USDA 110]
 gi|81740494|sp|Q89XT5|GLO2_BRAJA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|27348469|dbj|BAC45487.1| glyoxalase II [Bradyrhizobium japonicum USDA 110]
          Length = 255

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 151/247 (61%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
           S  +DNF  LIH+ + + TA+IDAP+   I K L  +GW LT I  THHH DH      L
Sbjct: 9   SCLNDNFGYLIHDVETKATASIDAPEAGPILKALEREGWQLTDILITHHHGDHVGGVAEL 68

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K  +NC +  P ++++ I  +D  +++ D    G+   +++ TPGHT+ HI Y F  +  
Sbjct: 69  KHKYNCRVVAPHDKTTAIANVDLRVANADVVKVGNLLARVVETPGHTLDHISYVFDTEKT 128

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
           +   DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ DP N
Sbjct: 129 VFAADTLFSIGCGRVFEGTYPMMWDSLLKLRALPDDFKLYCGHEYTASNVKFALTVDPDN 188

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             LQ   ++V  +R++N  T PS +  EK+ N FLR ++ S+   L+M+ A   AVF EL
Sbjct: 189 AALQARAAEVAKLRAENKPTIPSLLGDEKRANVFLRADDPSVAARLHMKGADAAAVFGEL 248

Query: 249 RIRKNQS 255
           R RKN+S
Sbjct: 249 RERKNKS 255


>gi|304320137|ref|YP_003853780.1| hydroxyacylglutathione hydrolase, hypothetical [Parvularcula
           bermudensis HTCC2503]
 gi|303299040|gb|ADM08639.1| hydroxyacylglutathione hydrolase, hypothetical [Parvularcula
           bermudensis HTCC2503]
          Length = 260

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 145/242 (59%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ +  LTA +D P    I++ L E+GW L  I NTH H DHT  NL LKK F
Sbjct: 18  DNYGFLLHDTRTGLTATVDTPQHTAITERLTERGWSLDIILNTHWHFDHTGGNLALKKHF 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP  E  +IPG D  + DGD   FG  P+++I TPGHT GH+ ++F  +    VG
Sbjct: 78  GCEIIGPEAEGDRIPGRDRAIKDGDRLTFGESPVEVIGTPGHTKGHVIFYFPEEGIAFVG 137

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSLGCGR+FE   A+M++SL ++++  + T ++  HEY+  NA FALS    N  L 
Sbjct: 138 DTLFSLGCGRLFEGDPAQMWQSLSRLRALPEDTVLFCAHEYSAANARFALSLGLDNSALT 197

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              + + + R ++  T P  +  EK  NPFLR ++ +L   +   NA+   VF E+R RK
Sbjct: 198 ARAAAIFAARDRDEPTVPIKLGDEKAANPFLRADDPALAAAIGCPNAAPAEVFGEVRARK 257

Query: 253 NQ 254
           ++
Sbjct: 258 DR 259


>gi|118591320|ref|ZP_01548718.1| Beta-lactamase-like protein [Stappia aggregata IAM 12614]
 gi|118435992|gb|EAV42635.1| Beta-lactamase-like protein [Stappia aggregata IAM 12614]
          Length = 260

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 138/244 (56%), Gaps = 1/244 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     T A+D PD     K L + GW LTHI  THHH DH +    LK+  
Sbjct: 17  DNFGVLIHDTDSGTTIAVDVPDAAAYEKALEQTGWSLTHILITHHHWDHVQGLGTLKQKT 76

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             T+ GP     KI   D  + DGD    G + IK I+TPGHT+  I ++         G
Sbjct: 77  GATVIGPERSRLKIAEFDRTVEDGDEVRCGPYAIKAISTPGHTLDQISWYIPAIKVAHTG 136

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           DTLF+LGCGR+FE     M+ SL K+ +   D T IY GHEYT  NA FAL+ DP N +L
Sbjct: 137 DTLFALGCGRVFEGDKEMMWSSLAKLMRQLPDDTTIYCGHEYTLANARFALTIDPDNADL 196

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           +    +V+++R +   T P+T++ EK  NPFLR    S+ + L ME  S   VFTE+R R
Sbjct: 197 KARAEEVETLRQEGAPTLPTTMAKEKATNPFLRAGEASVARALGMEGKSAAEVFTEIRTR 256

Query: 252 KNQS 255
           K+ +
Sbjct: 257 KDNA 260


>gi|90422032|ref|YP_530402.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisB18]
 gi|122477487|sp|Q21C03|GLO2_RHOPB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|90104046|gb|ABD86083.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisB18]
          Length = 255

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 141/243 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  L+H+     TA+IDAP+   I   L  +GW LT I  THHH DH      LK+  
Sbjct: 13  DNFGYLVHDSDSGATASIDAPEAAPILAALAREGWTLTDILVTHHHADHIGGIAELKQAT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           NC +  P +  + IP +D  +  GD    G    +++ TPGHT+ H+ Y F +D  L   
Sbjct: 73  NCRVVAPHDNGAAIPLVDLRVRQGDVVKIGGLLARVLETPGHTLDHVAYVFDDDKALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K++   D   +Y GHEYT  N  FAL+ +P+N  LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRVLPDDMRLYCGHEYTAANVKFALTVEPNNPALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++V  +R+  L T P+ +  EK+ N FLR +  ++   + ++ A  + VFTELR RK
Sbjct: 193 ARAAEVAHLRTAGLPTIPTLLGDEKRANVFLRADEPTVAAGVRLKGAGAVEVFTELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|298292701|ref|YP_003694640.1| hydroxyacylglutathione hydrolase [Starkeya novella DSM 506]
 gi|296929212|gb|ADH90021.1| hydroxyacylglutathione hydrolase [Starkeya novella DSM 506]
          Length = 257

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 135/247 (54%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+ +L+ +     TA IDAP+   I   L  + W LTHI  THHH DH    L 
Sbjct: 8   IPCLADNYAVLLRDPVTEATAVIDAPEVAPILAALEREDWTLTHILVTHHHTDHIAGVLA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+ F  T+ GP  E   IPG+D  + DGD    G    +++ TPGHT GHI + F ++ 
Sbjct: 68  LKERFGATVIGPKAERDTIPGLDFAVVDGDPVAVGGLVGRVMETPGHTKGHIVFLFEDER 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF LGCGR FE     ++ESL +++   D   +Y GHEYT +N  FA+S DP 
Sbjct: 128 LLFSGDTLFVLGCGRPFECDPPVLWESLVRLRGLPDDISVYCGHEYTVSNGRFAVSVDPD 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L     + ++ R+    T P+TI  EK  NPFLR ++  L   + +  A   AVFTE
Sbjct: 188 NAALAARLKEAEAQRAAGEPTLPTTIGAEKVTNPFLRADDPELAARIGLAGAEPGAVFTE 247

Query: 248 LRIRKNQ 254
           LR  KN 
Sbjct: 248 LRSLKNS 254


>gi|182677426|ref|YP_001831572.1| hydroxyacylglutathione hydrolase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633309|gb|ACB94083.1| hydroxyacylglutathione hydrolase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 256

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 146/244 (59%), Gaps = 1/244 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK-KF 71
           DNF +L+H+ + R TAAIDAP+   I + L  + W LT I  THHH DH      LK +F
Sbjct: 13  DNFGVLVHDPESRHTAAIDAPEAGPILEALAAREWTLTEILITHHHQDHIGGIPGLKAEF 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
               I GP  E+ KI  +D  + +GD    G     ++  PGHT GH+ Y F  D  L  
Sbjct: 73  PEARIIGPAREADKIGHLDQAVREGDQVKVGQLEAMVLEVPGHTSGHVVYWFEQDDILFT 132

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF++GCGR FE+    ++ SL K+ +   +  +Y GHEYT +NA FAL+ +P N+ L
Sbjct: 133 GDTLFAMGCGRGFEEPANILYNSLMKLAALPGELQVYCGHEYTLSNAEFALTIEPDNVLL 192

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           +   ++V+ +R++N +T P+TI++E   NPFLR++  S++  + M      AVF ELR R
Sbjct: 193 RDRVAEVRQLRAENRFTLPTTITIELGTNPFLRVDEPSVQAAVGMPGGDPAAVFAELRER 252

Query: 252 KNQS 255
           KN++
Sbjct: 253 KNRA 256


>gi|56698000|ref|YP_168371.1| hydroxyacylglutathione hydrolase, putative [Ruegeria pomeroyi
           DSS-3]
 gi|81349102|sp|Q5LNN5|GLO2_SILPO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|56679737|gb|AAV96403.1| hydroxyacylglutathione hydrolase, putative [Ruegeria pomeroyi
           DSS-3]
          Length = 255

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 142/248 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LIH+     TA +DAP+   I   L  +GW L  ++ THHH DH    
Sbjct: 6   VTVPCLSDNYAYLIHDADAGKTALVDAPEAAPIQSELDRRGWSLDQVWLTHHHWDHVDGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+  +  T+ G   ++ ++P +D  +S+GD FD G  P++++   GHT+GHI +H   
Sbjct: 66  AALRDRYKPTVIGAEADAHRLPPLDLAVSEGDRFDLGGAPVEVLDVSGHTVGHIAFHLPT 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M+ SL K+ +  D T +  GHEYT++NA FALS D
Sbjct: 126 GKAVFTADSLMALGCGRLFEGTPDQMWASLSKLAALPDDTLVCSGHEYTQSNARFALSVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+   +++   R++   T PS +SLEK  NPFLR  +  ++  L M+ A    VF
Sbjct: 186 PDNAALKTRAAEIDQARAEGRPTVPSLLSLEKSTNPFLRAADPGIQSLLGMQGADPARVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRARKD 253


>gi|219130110|ref|XP_002185216.1| glyoxalase [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403395|gb|EEC43348.1| glyoxalase [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 262

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 152/246 (61%), Gaps = 7/246 (2%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  LIH      TAAID P+       L+ +GW LTHIFNTHHH+DHT  NL LK   
Sbjct: 19  DNYGFLIHCESTGQTAAIDTPEASAYKNELKRRGWKLTHIFNTHHHLDHTGGNLELKSD- 77

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              ++GP   S KIPG+D GL  GD  +FG     II   GHT+GH+ YHF  ++   VG
Sbjct: 78  GVLVYGP--SSEKIPGMDVGLKGGDEIEFGGTKAHIIDVGGHTLGHLSYHFPKENIAFVG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D+LF+LGCG++FE S ++ +ESL++++   D T IY  HEYT +NA FAL+ +P N  L 
Sbjct: 136 DSLFALGCGKMFEGSPSQFWESLKRLRELPDDTTIYCAHEYTSSNAKFALAIEPGNSALV 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE-NTSLRKNLNME-NASNLAVFTELRI 250
               ++K+ R +   T PS + +EK+ NPFLR + +  +R+N+ ++ + S+  VF   RI
Sbjct: 196 SRAEEIKATRERGEPTVPSNLGVEKQTNPFLRCDMSAEIRQNIGVKISDSDADVFG--RI 253

Query: 251 RKNQSK 256
           RK + K
Sbjct: 254 RKAKDK 259


>gi|154245962|ref|YP_001416920.1| hydroxyacylglutathione hydrolase [Xanthobacter autotrophicus Py2]
 gi|154160047|gb|ABS67263.1| Hydroxyacylglutathione hydrolase [Xanthobacter autotrophicus Py2]
          Length = 282

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 137/249 (55%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+ +LIH+     TA +D P+   +   L ++GW LTHI  THHH DHT+    
Sbjct: 33  VPCLSDNYAVLIHDPVTEATAVVDVPEATPVIAALEKEGWNLTHILVTHHHADHTQGIPA 92

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           +K  F  T+ GP  E+ KIPG+D  + DGD    GS   +++ TPGHT G   Y F  + 
Sbjct: 93  VKARFGATVVGPKSEADKIPGLDVTVVDGDPVAVGSLVGRVLETPGHTAGPATYLFEGEK 152

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF+LGCGR  E     +++SL+++++  +   +Y GHEYT  NA FA + DP 
Sbjct: 153 LLFAGDTLFTLGCGRPLECEPPVLWDSLQRLRALPEDLQVYSGHEYTLANARFAATVDPD 212

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L +     +  R     T PS +  E   NPFLR ++  + + L M  A    VFTE
Sbjct: 213 NPALIRLYGDAQRKRDAGSPTIPSRLGDEVAANPFLRADDPGMAERLGMAGAEPALVFTE 272

Query: 248 LRIRKNQSK 256
           LR+RKN  K
Sbjct: 273 LRLRKNAFK 281


>gi|75674571|ref|YP_316992.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
 gi|123614205|sp|Q3SVQ1|GLO2_NITWN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|74419441|gb|ABA03640.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 255

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 149/243 (61%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     TAAIDAP+   + + L  +GW LT I  THHH DH      LK+ +
Sbjct: 13  DNFGVLIHDPATGATAAIDAPEAEPVIQALDREGWVLTDILITHHHSDHVGGVAELKRKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P + S++I  +D  +  GD    G+   +++ TPGHT+ H+ Y F ++  +   
Sbjct: 73  ACRVVAPHDRSAEIANVDLRVGQGDIIKVGTLLGRVLETPGHTLDHVSYVFDDEKVVFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT++N  FAL+ +P+N  L+
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWDSLLKLRALPDSFRLYCGHEYTDSNIKFALTIEPNNPVLK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V  +R++   T P+ +  EKK N FLR ++ ++   ++M+ AS + VF ELR RK
Sbjct: 193 ARAEEVTRLRAEGRPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGVEVFAELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|30684920|ref|NP_850166.1| GLX2-5 (GLYOXALASE 2-5); hydroxyacylglutathione hydrolase/ iron ion
           binding / zinc ion binding [Arabidopsis thaliana]
 gi|330253437|gb|AEC08531.1| Hydroxyacylglutathione hydrolase 2 [Arabidopsis thaliana]
          Length = 323

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 143/244 (58%), Gaps = 1/244 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++SL I  +    DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH 
Sbjct: 67  VSSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHY 126

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI
Sbjct: 127 DHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHI 186

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
             +F     +  GDT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ 
Sbjct: 187 SLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSK 246

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L +  A
Sbjct: 247 FALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEA 306

Query: 240 SNLA 243
           ++ A
Sbjct: 307 ADEA 310


>gi|15224661|ref|NP_180693.1| GLX2-5 (GLYOXALASE 2-5); hydroxyacylglutathione hydrolase/ iron ion
           binding / zinc ion binding [Arabidopsis thaliana]
 gi|73621009|sp|Q9SID3|GLO2N_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 2, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|4589965|gb|AAD26483.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|18176314|gb|AAL60021.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|20465675|gb|AAM20306.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|330253438|gb|AEC08532.1| Hydroxyacylglutathione hydrolase 2 [Arabidopsis thaliana]
          Length = 324

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 143/244 (58%), Gaps = 1/244 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++SL I  +    DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH 
Sbjct: 68  VSSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHY 127

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI
Sbjct: 128 DHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHI 187

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
             +F     +  GDT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ 
Sbjct: 188 SLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSK 247

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L +  A
Sbjct: 248 FALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEA 307

Query: 240 SNLA 243
           ++ A
Sbjct: 308 ADEA 311


>gi|307105103|gb|EFN53354.1| hypothetical protein CHLNCDRAFT_56279 [Chlorella variabilis]
          Length = 272

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 145/250 (58%), Gaps = 5/250 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H  +  +TA +D  +   +   LR KGW LTHI NTHHH DH   N  
Sbjct: 21  VPCLSDNYSWLLHEPQQGVTA-VDPAEAAPVLAALRSKGWNLTHIINTHHHYDHVGGNAE 79

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L++ F CT+ GP  + ++IPGI   L DGD F FG+  +    TPGHT GH+ YHF    
Sbjct: 80  LQREFGCTVVGPAADHARIPGIQVQLKDGDRFQFGAAEMVCYDTPGHTRGHVTYHFPAAK 139

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE + A+M+ SL K+      T +Y  HEYT +NA FA   D  
Sbjct: 140 ALFPGDTLFSLGCGRLFEGTPAQMWASLSKLTPLPGDTLVYCAHEYTASNAKFAAHVDEG 199

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR---IENTSLRKNLNM-ENASNLA 243
           N +LQ+  + +++ R++   T PS +  E K NPFLR   +++ ++R  L + E ASN  
Sbjct: 200 NEDLQRMKADIEAKRARGEPTVPSQLGDELKCNPFLRPGTLDSPAIRSKLGVPEGASNDV 259

Query: 244 VFTELRIRKN 253
            F  +R  K+
Sbjct: 260 AFGAIRAAKD 269


>gi|195624204|gb|ACG33932.1| hydroxyacylglutathione hydrolase 2 [Zea mays]
          Length = 337

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 145/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +S   DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 82  SSLQIELVSCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 141

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 142 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 201

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 202 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 261

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +
Sbjct: 262 ALSVEPGNKALQEYTANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPD 319


>gi|110680699|ref|YP_683706.1| hydroxyacylglutathione hydrolase, putative [Roseobacter
           denitrificans OCh 114]
 gi|123172160|sp|Q162S3|GLO2_ROSDO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|109456815|gb|ABG33020.1| hydroxyacylglutathione hydrolase, putative [Roseobacter
           denitrificans OCh 114]
          Length = 255

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 148/248 (59%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I   +DN+  L+H+     TA ID P+   I K+L E+ W L+ ++ THHH DH +  
Sbjct: 6   LTIPCLNDNYAFLVHDTATGQTALIDVPEAAPILKVLAERTWQLSEVWITHHHADHVQGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            ++       + G   ++ ++P +D  L DG++FDF  H + ++   GHT+GHI Y+  +
Sbjct: 66  GDILSAHPAQVRGAARDAHRLPALDVELRDGESFDFAGHKVDVMDVSGHTVGHIAYYCAD 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M++SL K+ +   +T +Y GHEYT  NA FAL+ D
Sbjct: 126 AKAVFTADSLMALGCGRLFEGTADQMWDSLSKLAALPSETQVYSGHEYTAANARFALTID 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           PHN +L      + + R+    T PST++ E   NPFLR  + ++R +LNM++AS+  VF
Sbjct: 186 PHNPDLISRSEGITAARAAAKPTVPSTLATEAATNPFLRAADPAIRAHLNMQHASDSEVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRARKD 253


>gi|302835830|ref|XP_002949476.1| hypothetical protein VOLCADRAFT_74188 [Volvox carteri f.
           nagariensis]
 gi|300265303|gb|EFJ49495.1| hypothetical protein VOLCADRAFT_74188 [Volvox carteri f.
           nagariensis]
          Length = 336

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 145/251 (57%), Gaps = 2/251 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+       TA +D  + + +   L  +GW L  I NTHHH DH  AN
Sbjct: 85  VRVPCLSDNYVWLLREPTSGRTAVVDPAELHPVVSELERRGWVLDAILNTHHHWDHVGAN 144

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
           L+LK+ F +C I GP  +  +IPGI+  + +GD++  GS  +++  TPGHT GHI Y   
Sbjct: 145 LDLKRRFPSCDIVGPRADKDRIPGIEVQVGEGDSWHLGSLEVRVFDTPGHTRGHITYWVP 204

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+LGCGR+FE S  +M+ SL K+ +  D T +Y  HEYT  NA FA++ 
Sbjct: 205 QAGALFPGDTLFALGCGRLFEGSPRQMWSSLSKLLALPDHTRVYCAHEYTAANARFAMTV 264

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS-NLA 243
           DP N +L     +V + R++   T PST+  EK  NPFLR    S+RKN+ +  A+ +  
Sbjct: 265 DPDNPQLADRKMRVDAARAKGEATVPSTLGEEKATNPFLRPGAPSVRKNMGLGPAAEDWE 324

Query: 244 VFTELRIRKNQ 254
           VF  +R  K++
Sbjct: 325 VFAAVRAAKDR 335


>gi|254466347|ref|ZP_05079758.1| hydroxyacylglutathione hydrolase [Rhodobacterales bacterium Y4I]
 gi|206687255|gb|EDZ47737.1| hydroxyacylglutathione hydrolase [Rhodobacterales bacterium Y4I]
          Length = 257

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 141/248 (56%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LIHN     TA +DAP+   +   L E+GW L  I  THHH DH    
Sbjct: 8   ITLPCLSDNYAFLIHNPASGETALVDAPEAGAVKAALAERGWGLDWILLTHHHWDHVDGV 67

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +   + G   ++ ++P +D  + DG TF      ++++   GHT+GHI YH   
Sbjct: 68  AELREAYGAKVIGAEADAHRLPPLDKAVEDGGTFSLMGEEVQVMDVSGHTVGHIAYHIPG 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M+ SL ++ +   +T +Y GHEYT+ NA FA++ D
Sbjct: 128 AAAVFTADSLMALGCGRLFEGTPQQMWASLSRLAALPAQTVVYSGHEYTQANAGFAVTVD 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  LQ+    +   R + + T PS++ LE   NPFLR  ++++R +L ME+A +  VF
Sbjct: 188 PGNPALQERARDIARAREKGIPTVPSSLQLELDTNPFLRAADSAIRAHLGMEDAEDAEVF 247

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 248 AEIRKRKD 255


>gi|194696414|gb|ACF82291.1| unknown [Zea mays]
          Length = 337

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 82  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 141

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 142 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 201

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE S  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 202 YYFAGSGAIFTGDTLFNLSCGKLFEGSPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 261

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +
Sbjct: 262 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPD 319


>gi|223995371|ref|XP_002287369.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
 gi|220976485|gb|EED94812.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
          Length = 269

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 148/243 (60%), Gaps = 4/243 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  LIH+ K + TAAID P        L  +GW LTHIFNTHHH DH   N+ LK   
Sbjct: 25  DNYGYLIHDPKTKQTAAIDTPSGQAYKDELERRGWKLTHIFNTHHHHDHVGGNMELKTD- 83

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             T++GP  +  +IPG+D  L + DTF FG    ++I   GHT GHI ++F N+    VG
Sbjct: 84  GVTVYGPAADG-RIPGMDVALKENDTFSFGGTEARVIDVGGHTSGHIAFYFPNEKTAFVG 142

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D+LF+LGCGR+FE +  + + SL++++   D T IY  HEYTE NA FA+S +P N +L 
Sbjct: 143 DSLFALGCGRMFEGTPTQFWASLQRLRGLPDDTTIYCAHEYTEGNAKFAMSVEPGNADLV 202

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE-NTSLRKNLNMENASNLA-VFTELRI 250
           K   ++K+ R++   T PS +  EK  NPFLR + +  +RKN+   +  + A VF ++R 
Sbjct: 203 KRVEEIKAKRARGEPTVPSLMKEEKLTNPFLRGDVSREIRKNVGASDEESGADVFAKIRR 262

Query: 251 RKN 253
            K+
Sbjct: 263 GKD 265


>gi|158421848|ref|YP_001523140.1| glyoxalase II [Azorhizobium caulinodans ORS 571]
 gi|158328737|dbj|BAF86222.1| glyoxalase II [Azorhizobium caulinodans ORS 571]
          Length = 257

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 137/246 (55%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+ +L+H+     TA +DAP+   I   L  +GW LTHI  THHH DH    L 
Sbjct: 8   IPCLSDNYAVLLHDPLTEATAVVDAPEPGPIMDALELEGWDLTHILITHHHADHVDGVLA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +  T+ GP  E++ IP +D  + D D    GS   ++I TPGHT GHI + F  + 
Sbjct: 68  LKAQYGATVVGPKAEAATIPALDVEVVDADPVGLGSAIGRVIETPGHTAGHISFVFPEEK 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF +GCGR  E     ++ SL+++++  D   +Y GHEYT  N  FALS DP 
Sbjct: 128 LLFAGDTLFVMGCGRALECDPPVLWHSLQRLRTLPDDFSLYCGHEYTVANGRFALSVDPD 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L+   +  ++ R +   T P+ +  E+  NPFLR ++  + + L +  A   AVFTE
Sbjct: 188 NGALRARVADAEAARREGKPTIPALLGDERLTNPFLRADDPDMAERLGLAGADPAAVFTE 247

Query: 248 LRIRKN 253
           LR RKN
Sbjct: 248 LRARKN 253


>gi|56554604|pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana
           Gene At2g31350
 gi|56554605|pdb|1XM8|B Chain B, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana
           Gene At2g31350
 gi|150261470|pdb|2Q42|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of
           Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350
 gi|150261471|pdb|2Q42|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of
           Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350
          Length = 254

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 137/231 (59%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH DHT  NL LK  +
Sbjct: 11  DNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRY 70

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI  +F     +  G
Sbjct: 71  GAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ FALS +P+N  LQ
Sbjct: 131 DTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQ 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L +  A++ A
Sbjct: 191 SYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEA 241


>gi|163732300|ref|ZP_02139746.1| hydroxyacylglutathione hydrolase, putative [Roseobacter litoralis
           Och 149]
 gi|161394598|gb|EDQ18921.1| hydroxyacylglutathione hydrolase, putative [Roseobacter litoralis
           Och 149]
          Length = 257

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 146/248 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+H+     TA ID P+   I K L ++ W L+ ++ THHH DH +  
Sbjct: 8   LTIPCLSDNYAYLVHDDATGQTALIDVPEADAILKALADRQWHLSEVWITHHHADHVQGL 67

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            ++       + G  ++S ++P +D  L DG++FDF  H ++++   GHTIGHI Y+  +
Sbjct: 68  ADVLTAHPAKVRGAADDSHRLPALDFALGDGESFDFAGHEVEVMDVSGHTIGHIAYYCAD 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M++SL K+      T IY GHEYT  NA FAL+ D
Sbjct: 128 AKAVFTADSLMALGCGRLFEGTADQMWKSLSKLAVLPPDTQIYSGHEYTAANARFALTID 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           PHN +L      + + R+    T PS+++ E   NPFLR  + ++R +LNM++AS+  VF
Sbjct: 188 PHNSDLISRSQGIAASRTAGKPTVPSSLATEAATNPFLRAADPTIRAHLNMQHASDSEVF 247

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 248 AEIRARKD 255


>gi|209883261|ref|YP_002287118.1| hydroxyacylglutathione hydrolase [Oligotropha carboxidovorans OM5]
 gi|209871457|gb|ACI91253.1| hydroxyacylglutathione hydrolase [Oligotropha carboxidovorans OM5]
          Length = 255

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 142/243 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN   LIH+   + TAAIDAPD   I   L  +GW LT +  THHH DHT     LK  +
Sbjct: 13  DNIGYLIHDPVTKATAAIDAPDAKPIIAALEREGWRLTDLLITHHHADHTDGIAELKAKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C + GP E+  +I G+D  + +GDT   G+   ++  TPGHT+ HI Y F + H L   
Sbjct: 73  KCRVVGPYEKGVRIDGLDVHVKEGDTVKVGNLVARVFETPGHTLDHISYMFDDAHALFCA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D +FS+GCGR+ E +Y  M+ESL K+++  + T +Y GHEYT +N  FAL  +P+N  L+
Sbjct: 133 DVIFSIGCGRVIEGTYPMMWESLLKLRALPNDTRVYCGHEYTASNVKFALGIEPNNPALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           K   +V  +R++   T PS +  EK+ N FLR +  ++   L M   +   VF E+R RK
Sbjct: 193 KRAEEVTKLRAEGKLTIPSLMRDEKEANVFLRADVPAVAAALGMNGKTPAEVFGEIRERK 252

Query: 253 NQS 255
           N++
Sbjct: 253 NRA 255


>gi|28143946|gb|AAO26580.1| glyoxalase II [Brassica juncea]
          Length = 335

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 80  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 139

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 140 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 199

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 200 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 259

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +
Sbjct: 260 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPD 317


>gi|21070362|gb|AAM34273.1|AF508863_1 glyoxalase II [Pennisetum glaucum]
          Length = 336

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 201 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +
Sbjct: 261 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPD 318


>gi|115480159|ref|NP_001063673.1| Os09g0516600 [Oryza sativa Japonica Group]
 gi|16209608|gb|AAL14249.1| glyoxalase II [Oryza sativa]
 gi|50726249|dbj|BAD33825.1| glyoxalase II [Oryza sativa Japonica Group]
 gi|113631906|dbj|BAF25587.1| Os09g0516600 [Oryza sativa Japonica Group]
 gi|215697948|dbj|BAG92136.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215737215|dbj|BAG96144.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218202459|gb|EEC84886.1| hypothetical protein OsI_32046 [Oryza sativa Indica Group]
          Length = 336

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 201 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +
Sbjct: 261 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPD 318


>gi|126739847|ref|ZP_01755538.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           SK209-2-6]
 gi|126719079|gb|EBA15790.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           SK209-2-6]
          Length = 255

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 147/248 (59%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+HN     TA +DAP++  I   L+E+GW L  I  THHH DH    
Sbjct: 6   ITLPCLSDNYAFLLHNAAEGKTALVDAPESAAIKTALQERGWGLDAILLTHHHWDHVDGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  +   ++G + ++ ++P +D  L DG++FD     + ++   GHT+GHI +H   
Sbjct: 66  ADLRATYGSKVYGAMVDAHRLPELDVALKDGESFDLFGEAVTVLDVSGHTLGHIAFHMPQ 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M+ SL ++ +   +T +Y GHEYT++NA FAL+ +
Sbjct: 126 SKAVFTADSLMALGCGRLFEGTPEQMWHSLSRLAALPAETMVYSGHEYTQSNAAFALTIE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  LQ   ++V + R++   T PS + LE + NPFLR  + +L++ + ++   N +VF
Sbjct: 186 PGNAALQARVAEVNAKRAKGEATVPSLLKLEIETNPFLRAADPALKEAIGLQGVENASVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEVRKRKD 253


>gi|219363327|ref|NP_001136491.1| hypothetical protein LOC100216606 [Zea mays]
 gi|194695910|gb|ACF82039.1| unknown [Zea mays]
          Length = 311

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 144/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 56  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 115

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 116 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 175

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 176 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 235

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +
Sbjct: 236 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPD 293


>gi|114797885|ref|YP_762079.1| putative hydroxyacylglutathione hydrolase [Hyphomonas neptunium
           ATCC 15444]
 gi|122942021|sp|Q0BWR4|GLO2_HYPNA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114738059|gb|ABI76184.1| putative hydroxyacylglutathione hydrolase [Hyphomonas neptunium
           ATCC 15444]
          Length = 256

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 143/243 (58%), Gaps = 3/243 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H      T AID PD  +      +  W ++ I+NTH H DH   NL +K+  
Sbjct: 15  DNYGYLVHEPGSGRTIAIDTPDAAVYLAEAEKMSWTISEIWNTHWHPDHAGGNLKIKEAT 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I GP  E+ KIPGID  +  GDT + G     +I  PGHT+GHI +HF +     VG
Sbjct: 75  GCKIIGPAGEADKIPGIDRRVKGGDTVELGGATATVIDVPGHTLGHIAFHFPDQEAAFVG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D +F+LGCGR+FE +   M+ESL++IK    KT +Y  HEYT +NA FA++ +P N  L+
Sbjct: 135 DAVFALGCGRVFEGTMEMMWESLKRIKKLPKKTQLYCAHEYTASNAKFAVTIEPENKALK 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV-FTELRIR 251
           +Y + ++  R+++  T P+ +  E + NPFLR +   ++  L M +A N A  F E+R R
Sbjct: 195 EYVAWIEKRRAEDKPTVPALLERELETNPFLRADLPEMQ--LAMGHAGNAAATFGEIRGR 252

Query: 252 KNQ 254
           K++
Sbjct: 253 KDR 255


>gi|146337699|ref|YP_001202747.1| putative hydroxyacylglutathione hydrolase (glyoxalase II)
           [Bradyrhizobium sp. ORS278]
 gi|160386199|sp|A4YKS8|GLO2_BRASO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|146190505|emb|CAL74504.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II)
           [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 141/243 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  LIH+     TA++DAP+   I + L   GW LT I  THHH DH      LK+ +
Sbjct: 13  DNFGYLIHDPATGATASVDAPEAGPIVRQLEANGWTLTDILITHHHYDHVGGVAELKQRY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C + GP +  + I  +D  ++ GD    G    +++ TPGHT+ H+ Y F  D  +   
Sbjct: 73  GCRVIGPHDRKAAIADVDLRVAHGDVVKVGELLARVLETPGHTLDHVSYVFDADKAVFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ DP N  L+
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWDSLLKLRTLPDDFRLYCGHEYTASNVKFALTVDPDNEALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++V  +R+ N  T P  +  EK+ N FLR ++ ++   L M+ AS   VF ELR RK
Sbjct: 193 ARAAEVTRLRAANQPTIPVLLGEEKQANVFLRADDPAIAVRLRMKGASAEEVFGELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|304394183|ref|ZP_07376106.1| hydroxyacylglutathione hydrolase [Ahrensia sp. R2A130]
 gi|303293623|gb|EFL88000.1| hydroxyacylglutathione hydrolase [Ahrensia sp. R2A130]
          Length = 258

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 147/242 (60%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ I++     +    IDAP+   I  +L +KG  L  +  THHH DH   N +LK   
Sbjct: 16  DNYGIIMRERGAKEAICIDAPEVEPIEDVLEDKGLHLHTLLTTHHHQDHVEGNKSLKASQ 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            CTI GP EE  +IPGID  ++ GD  +     +++I TPGHT+G + Y+F +D  +   
Sbjct: 76  KCTIIGPAEEEDRIPGIDQSVNHGDEIEVLGRRVQVIGTPGHTLGQVAYYFPDDGVVFAA 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D LF++GCGRIFE     M  +L+++    D+T +Y GHEYT +NA FA+S D  N  L 
Sbjct: 136 DALFAMGCGRIFEGDAEMMHTALQRLARLPDETKVYAGHEYTLSNAKFAVSVDGTNKRLL 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +   +V+ +R +   T P+TI+ EK  NPFLR+++ ++R  L ME+A ++ VF ELR+RK
Sbjct: 196 ERAREVELLRDEGAPTLPTTIAEEKATNPFLRVKDPAIRAYLGMEDADDVDVFAELRVRK 255

Query: 253 NQ 254
           ++
Sbjct: 256 DR 257


>gi|91974575|ref|YP_567234.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris BisB5]
 gi|123735877|sp|Q13F06|GLO2_RHOPS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91681031|gb|ABE37333.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris BisB5]
          Length = 255

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 138/243 (56%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  LIH+     TA+IDAP+   +   L ++GW LT I  THHH DH      LKK +
Sbjct: 13  DNFGYLIHDPSSGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGVAELKKKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P + ++KI  ID  + +GD    G    +++ TPGHT+ HI Y F +D  L   
Sbjct: 73  QCRVVAPHDANAKIADIDLRVEEGDVVRVGGLSARVLETPGHTLDHISYVFDDDRALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K++   D   +Y GHEYT +N  FAL+ +P N  LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRELPDDFKLYCGHEYTASNVKFALTIEPDNAALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V+  R+    T P T+  EK+ N FLR +  S+   + +   S   VF ELR RK
Sbjct: 193 ARAKQVEQQRAAGQPTIPVTLGEEKQANLFLRADVPSVAAAVGLPGESAADVFGELRERK 252

Query: 253 NQS 255
           N S
Sbjct: 253 NNS 255


>gi|83313291|ref|YP_423555.1| Zn-dependent hydrolase, including glyoxylase [Magnetospirillum
           magneticum AMB-1]
 gi|82948132|dbj|BAE52996.1| Zn-dependent hydrolase, including glyoxylase [Magnetospirillum
           magneticum AMB-1]
          Length = 270

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 142/247 (57%), Gaps = 1/247 (0%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I +  DN+  L H      TAAID   +  + + L  +GW LTHI NTHHH DHT ANL+
Sbjct: 22  IPVLSDNYVYLAHEPLGGATAAIDPAVSEPVLERLAARGWTLTHILNTHHHGDHTGANLD 81

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L +   C + G   +S +IPGI   +S+G+TF  G   + ++  PGHT GH+ Y   + H
Sbjct: 82  LARRTGCAVVGAARDSERIPGITLEVSEGETFMLGHAAVTVLEVPGHTSGHVAYWLADSH 141

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE +  EM+ SL+K++     T  Y  HEYT  N  FA   +  
Sbjct: 142 VLFCGDTLFSLGCGRLFEGTAEEMWASLKKLRDLPPDTLAYPAHEYTAGNGRFARLVERD 201

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-VFT 246
           N  L+    +V+ +R+ N  T P  ++ E+  NPFLR +  ++ + + +E  ++ A VF 
Sbjct: 202 NGALKARLDEVERLRAHNRPTVPVRLADERAANPFLRADTAAIARAVGLEPGTDPALVFA 261

Query: 247 ELRIRKN 253
           ELR RK+
Sbjct: 262 ELRRRKD 268


>gi|299132857|ref|ZP_07026052.1| hydroxyacylglutathione hydrolase [Afipia sp. 1NLS2]
 gi|298592994|gb|EFI53194.1| hydroxyacylglutathione hydrolase [Afipia sp. 1NLS2]
          Length = 255

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 143/243 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN   LIH+   + TAAIDAP+   I   L  +GW LT +  THHH DHT     LK  +
Sbjct: 13  DNIGYLIHDPSTKATAAIDAPEAKPIIAALEREGWRLTDLLITHHHADHTDGIAELKAKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C + GP E+ + I G+D  + +GDT   G+   ++  TPGHT+ H+ Y F   H L   
Sbjct: 73  KCRVVGPYEKRAHIDGLDIHVKEGDTVKVGNLTARVFETPGHTLDHVSYMFDEAHALFCA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DT+FS+GCGR+ E +Y  M++SL K+++  + T +Y GHEYT +N  FAL  +P+N  L+
Sbjct: 133 DTIFSIGCGRVIEGTYPMMWDSLLKLRALPNDTRVYCGHEYTASNVKFALGIEPNNPALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           K   +V  +R++   T PS +  EK+ N FLR +  ++  +L M   +   VF E+R RK
Sbjct: 193 KRADEVTRLRAEGKLTIPSLMRDEKEANVFLRADVPAVAASLGMSGKTPAEVFGEIRERK 252

Query: 253 NQS 255
           N++
Sbjct: 253 NRA 255


>gi|297822879|ref|XP_002879322.1| glyoxalase 2-5 [Arabidopsis lyrata subsp. lyrata]
 gi|297325161|gb|EFH55581.1| glyoxalase 2-5 [Arabidopsis lyrata subsp. lyrata]
          Length = 324

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 142/244 (58%), Gaps = 1/244 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++SL I  +    DN+  ++H+        +D  +   +   L+  G  LT+I NTHHH 
Sbjct: 68  VSSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPVIDSLKRSGRNLTYILNTHHHY 127

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI
Sbjct: 128 DHTGGNLELKDRYGAKVIGSAMDKDRIPGIDIALKDGDKWMFAGHEVHVMDTPGHTKGHI 187

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
             +F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ 
Sbjct: 188 SLYFPGSRAIFTGDTLFSLSCGKLFEGTPKQMLASLQKIISLPDDTSIYCGHEYTLSNSK 247

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L +   
Sbjct: 248 FALSLEPNNEILQSYAAHVAELRSKKLPTIPTTLKMEKACNPFLRSSNTDIRRALRIPET 307

Query: 240 SNLA 243
           ++ A
Sbjct: 308 ADEA 311


>gi|39933687|ref|NP_945963.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           CGA009]
 gi|81564127|sp|Q6NC62|GLO2_RHOPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|39647533|emb|CAE26054.1| putative glyoxalase II [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 139/241 (57%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH      LKK +
Sbjct: 13  DNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWKLTDILVTHHHGDHVGGIAELKKKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P + ++KI   D  L +GD    G    +++ TPGHT+ H+ Y F +D  L   
Sbjct: 73  QCRVHAPHDANAKIADADVRLQEGDVVRVGDLTARVLETPGHTLDHLSYVFDDDRALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P N  LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFKLYCGHEYTASNVKFALGIEPDNAALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V+S+R++   T P T+  EK+ N FLR +  S+   + M  A    VF E+R RK
Sbjct: 193 ARAKQVESLRAEGKPTIPVTLGEEKQANVFLRADVPSVAAAVGMPGAPAAEVFGEIRERK 252

Query: 253 N 253
           N
Sbjct: 253 N 253


>gi|302755800|ref|XP_002961324.1| hypothetical protein SELMODRAFT_164521 [Selaginella moellendorffii]
 gi|300172263|gb|EFJ38863.1| hypothetical protein SELMODRAFT_164521 [Selaginella moellendorffii]
          Length = 321

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 151/271 (55%), Gaps = 25/271 (9%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ +        +D      + + L  +G  LTHI NTHHH DHT  N +
Sbjct: 53  IPCLKDNYAYLLRDASSGAIGVVDPSTAQPVIEALERRGLKLTHIINTHHHWDHTGGNAD 112

Query: 68  LKKFFNCT----------------------IFGPLEESSKIPGIDHGLSDGDTFDFGSHP 105
           LKK +                         I  P  +   IPGID  L DGDT+  G H 
Sbjct: 113 LKKRYGAQAREFFFFFLLSSFLLRRTKLYLIVAPPGDG--IPGIDVPLKDGDTWMLGEHA 170

Query: 106 IKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
           +K+I TPGHT GH+ Y+F +   +  GDTLFS+GCGR+FE S  +M+ SL K+ +  D+T
Sbjct: 171 MKVIGTPGHTRGHVSYYFADSRAVFTGDTLFSIGCGRLFEGSAQQMWSSLSKLAALPDET 230

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            ++ GHEYT +NA FA++ +P+N  L  +  KVK +R   L T PS++  EKK NPFLR 
Sbjct: 231 RVFCGHEYTLSNAKFAMTIEPNNPALNSHFEKVKQLRDSGLATIPSSVGEEKKFNPFLRP 290

Query: 226 ENTSLRKNLNM-ENASNLAVFTELRIRKNQS 255
            +  +R++LN+ ++AS+  VF  +R  K+++
Sbjct: 291 ASREIRRSLNLSDDASDSDVFAAVRKAKDRA 321


>gi|296448080|ref|ZP_06889982.1| hydroxyacylglutathione hydrolase [Methylosinus trichosporium OB3b]
 gi|296254394|gb|EFH01519.1| hydroxyacylglutathione hydrolase [Methylosinus trichosporium OB3b]
          Length = 257

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 106/242 (43%), Positives = 140/242 (57%), Gaps = 1/242 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK-KF 71
           DNF +L+ +      A+IDAPD   I+  L   GW LT I  THHH DH +    LK ++
Sbjct: 13  DNFGLLLRDAATCAVASIDAPDAAAIAAELDRLGWTLTDILLTHHHADHIQGVAGLKARY 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
            N  + GP ++  +I G+D  + +GD    G+   ++I  PGHT GHI YHF +D  L V
Sbjct: 73  PNARVVGPRKDLGRIGGVDLPVGEGDVVTVGAARARVIEAPGHTTGHILYHFADDDILFV 132

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GD LFSLGCGR+FE     M  SL KI +   +T +Y GHEYTE NA FAL+ DP N  L
Sbjct: 133 GDVLFSLGCGRVFETPMQVMHASLAKIAALPPRTRVYCGHEYTEANARFALTVDPANPRL 192

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
            +   +V+++R     T P+TI+ E   NPFLR ++  LR+   ME A    VF  LR R
Sbjct: 193 AERVREVETLRRAGAATLPTTIAQELATNPFLRADDPGLRRATGMEQAPPERVFAALRER 252

Query: 252 KN 253
           KN
Sbjct: 253 KN 254


>gi|330813476|ref|YP_004357715.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486571|gb|AEA80976.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 253

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 154/247 (62%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I    DN+   I + + +  A +D  +   +   L +    L  I NTHHH DH   N 
Sbjct: 5   VIPCLTDNYSYCIVDPETKKVAIVDPAEFNAVDSFLEKNNLSLDFILNTHHHGDHVDGNR 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           +L+K +NC I G   + ++IPGID  L DG  + F +  +++   PGHT GHI Y+F  +
Sbjct: 65  SLQKKYNCKIVGFAPDHNRIPGIDILLDDGQVWKFANTEVEVHHVPGHTSGHIFYYFKKN 124

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
           +   VGD +FSLGCGRIFE +Y EM  S+++I+    +T ++ GHEYTE+N  F +S DP
Sbjct: 125 NLAFVGDVVFSLGCGRIFEGTYEEMLASVDQIRKLPPETKVFCGHEYTESNLAFCMSVDP 184

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
           +N +L+K  ++++S+R QN  T P+TI +E K N F R+++ ++RK+L++ NA++L VFT
Sbjct: 185 YNDDLKKRATEIESLRRQNKPTIPTTIGMELKTNIFFRLDDLTVRKSLSLNNATDLEVFT 244

Query: 247 ELRIRKN 253
           +LR  K+
Sbjct: 245 KLRELKD 251


>gi|242049842|ref|XP_002462665.1| hypothetical protein SORBIDRAFT_02g029900 [Sorghum bicolor]
 gi|241926042|gb|EER99186.1| hypothetical protein SORBIDRAFT_02g029900 [Sorghum bicolor]
          Length = 336

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 143/238 (60%), Gaps = 1/238 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +N+ F
Sbjct: 201 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYSSLQKITALPDDTKVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  ++  L++ +
Sbjct: 261 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKSTLSIPD 318


>gi|115522194|ref|YP_779105.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisA53]
 gi|122298092|sp|Q07VA9|GLO2_RHOP5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|115516141|gb|ABJ04125.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisA53]
          Length = 255

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 144/244 (59%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
           +DNF  LIH+     TA++DAP+   I   L  +GW LT I  THHH DH      LK+ 
Sbjct: 12  NDNFGYLIHDPATGATASVDAPEAAPIIAALAREGWTLTDILVTHHHGDHVGGVAELKQK 71

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
           + C +  P + + +IP +D  ++ GD    G    +++ TPGHT+ H+ Y F +D  +  
Sbjct: 72  YRCRVVAPHDRNGRIPEVDLRVAQGDVVKVGGLLARVLETPGHTLDHLAYVFDDDKAVFA 131

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLFS+GCGR+FE +Y  M++SL K++   D   +Y GHEYT  N  FAL  +P N  L
Sbjct: 132 GDTLFSIGCGRVFEGTYPMMWDSLLKLRVLPDDMRLYCGHEYTAANVKFALGVEPDNPAL 191

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           Q   ++V ++R+    T P+ +  EK  N FLR +  S+  ++ ++ A  +AVFTELR R
Sbjct: 192 QARAAQVTALRAAGQPTIPTLLGEEKAANVFLRADEPSVAASVRLKGADPVAVFTELRER 251

Query: 252 KNQS 255
           KN+S
Sbjct: 252 KNKS 255


>gi|323136806|ref|ZP_08071887.1| hydroxyacylglutathione hydrolase [Methylocystis sp. ATCC 49242]
 gi|322398123|gb|EFY00644.1| hydroxyacylglutathione hydrolase [Methylocystis sp. ATCC 49242]
          Length = 258

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 154/243 (63%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+     TA++DAPD   I+     +GW LTH+  THHH+DH      LKK F
Sbjct: 13  DNFGLLVHDVATGATASVDAPDGAAIAAEAERRGWPLTHLLLTHHHLDHIEGAEALKKRF 72

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
               I G  +++ ++P +D  + DGD    G+   ++I TPGHT+GH+ YHF +D  + V
Sbjct: 73  PQMKIVGAKKDAHRLPPLDIAVGDGDGVMLGASRARVIETPGHTLGHVAYHFADDDAVFV 132

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLFSLGCGR+FE +  +M  SLE + +   +T IY GHEYT+ NA FAL+ DP N  L
Sbjct: 133 GDTLFSLGCGRVFEGTMEQMRLSLETLANLPGETRIYCGHEYTQTNAKFALTVDPENPVL 192

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
               + V  +R+   +T PSTI+LE   NPFLR+E+  ++K + M++A+  AVF E+R R
Sbjct: 193 LDRANSVNELRAAGKFTLPSTIALENATNPFLRVEDPLVKKAMGMDDANPFAVFAEMRER 252

Query: 252 KNQ 254
           KN+
Sbjct: 253 KNR 255


>gi|254512519|ref|ZP_05124586.1| hydroxyacylglutathione hydrolase [Rhodobacteraceae bacterium KLH11]
 gi|221536230|gb|EEE39218.1| hydroxyacylglutathione hydrolase [Rhodobacteraceae bacterium KLH11]
          Length = 261

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 141/249 (56%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L H+     TA IDAP+   I   L  +GW L+H   THHH DH    
Sbjct: 12  VTIPCLSDNYAFLAHDPVSGETALIDAPEAAPILAALESRGWQLSHALLTHHHPDHVDGL 71

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            ++       + G   +  ++P +D  +++GDTF  G   ++++   GHTIGHI +H   
Sbjct: 72  FDILAKHPARVIGAKADEHRLPELDQAVAEGDTFYIGGDLVEVLDVSGHTIGHIAFHMPE 131

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L +LGCGR+FE   A+M+ SL K+ +  D+T +  GHEYT++NA FAL+ D
Sbjct: 132 TGAAFTGDSLMALGCGRLFEGKPAQMWASLGKLAALPDETIVCSGHEYTQSNAKFALTID 191

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  LQ   + +   R+    T PS ++LEK  NPFLR  + +++ +L MENA   +VF
Sbjct: 192 PDNAALQDRVADINRARAAGEPTVPSVLALEKATNPFLRAADPAIQAHLGMENADPTSVF 251

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 252 AEIRARKDR 260


>gi|192289044|ref|YP_001989649.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris TIE-1]
 gi|192282793|gb|ACE99173.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris TIE-1]
          Length = 255

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 138/241 (57%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH      LKK +
Sbjct: 13  DNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWKLTDILVTHHHGDHVGGIAELKKKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P + ++KI   D  L +GD    G    +++ TPGHT+ H+ Y F  D  L   
Sbjct: 73  QCRVHAPHDANAKIADADVRLQEGDVVRVGDLTARVLETPGHTLDHLSYVFDADRALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P N  LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFKLYCGHEYTASNVKFALGIEPDNAALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V+++R++   T P T+  EK+ N FLR +  S+   + M  A    VF E+R RK
Sbjct: 193 ARAKQVEALRAEGKPTIPVTLGEEKQANVFLRADVPSVAAAVGMPGAPAAEVFGEIRERK 252

Query: 253 N 253
           N
Sbjct: 253 N 253


>gi|260752758|ref|YP_003225651.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552121|gb|ACV75067.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 241

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/236 (39%), Positives = 140/236 (59%), Gaps = 4/236 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   +A+  +  N+  L+H+     T  +D      +   +++KGW +T I+NTH H D
Sbjct: 1   MTIEIVAVPAFETNYIWLLHDRVSDKTVVVDPGQAEPVLDFIQKKGWEVTQIWNTHWHND 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  +K    C + GP  ES  IP ID  + +GD    GS   K++A P HT+GH+ 
Sbjct: 61  HTGGNEVIKAETGCDVIGPSHESHPIPAIDIKVDEGDEIRLGSLVAKVMAIPAHTLGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  + H L  GDTLF++GCGRIFE +  +M+++L++  +   +T +Y GHEYT++N +F
Sbjct: 121 YYIPDHHVLFCGDTLFAMGCGRIFEGTAEQMWQALQRFAALPPETKVYCGHEYTQDNGHF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRK 232
           AL+ DP N  LQK   +V  +R+Q   T P+TI+LEK  NPF+R +N      LRK
Sbjct: 181 ALTVDPDNQALQKRVKEVDLLRAQGKITLPTTIALEKATNPFMRAKNPEELAKLRK 236


>gi|56551655|ref|YP_162494.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761219|ref|ZP_04759307.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543229|gb|AAV89383.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374126|gb|EER63623.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 241

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/236 (39%), Positives = 140/236 (59%), Gaps = 4/236 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   +A+  +  N+  L+H+     T  +D      +   +++KGW +T I+NTH H D
Sbjct: 1   MTIEIVAVPAFETNYIWLLHDKVSDKTVVVDPGQAEPVLDFIQKKGWEVTQIWNTHWHND 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  +K    C + GP  ES  IP ID  + +GD    GS   K++A P HT+GH+ 
Sbjct: 61  HTGGNEVIKAETGCDVIGPSHESHPIPAIDIKVDEGDEIGLGSLVAKVMAIPAHTLGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  + H L  GDTLF++GCGRIFE +  +M+++L++  +   +T +Y GHEYT++N +F
Sbjct: 121 YYIPDHHVLFCGDTLFAMGCGRIFEGTAEQMWQALQRFAALPPETKVYCGHEYTQDNGHF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRK 232
           AL+ DP N  LQK   +V  +R+Q   T P+TI+LEK  NPF+R +N      LRK
Sbjct: 181 ALTVDPDNQALQKRVKEVDLLRAQGKITLPTTIALEKATNPFMRAKNPEELAKLRK 236


>gi|224133230|ref|XP_002327992.1| predicted protein [Populus trichocarpa]
 gi|222837401|gb|EEE75780.1| predicted protein [Populus trichocarpa]
          Length = 328

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 142/241 (58%), Gaps = 1/241 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        ID  +   +   L  K   LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDVDTGTVGVIDPSEAAPVIDALSRKNRNLTYILNTHHHYD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + FG H + ++ TPGHT GH+ 
Sbjct: 133 HTGGNEELKARYGAKVIGSGVDRDRIPGIDIVLNDGDNWMFGGHEVLVMETPGHTRGHVS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D T+IY GHEYT +N+ F
Sbjct: 193 FYFPGSGAIFAGDTLFSLSCGKLFEGTPEQMLSSLRKIMSLPDDTNIYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP+N  LQ Y + V  +RS++L T P+ + +EK  NPFLR  +T++R  LN+   +
Sbjct: 253 ALSVDPNNEALQSYAAHVAHLRSKSLPTIPTKLKVEKACNPFLRTSSTAIRHTLNIPATA 312

Query: 241 N 241
           N
Sbjct: 313 N 313


>gi|86747196|ref|YP_483692.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris HaA2]
 gi|123004823|sp|Q2J429|GLO2_RHOP2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86570224|gb|ABD04781.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris HaA2]
          Length = 255

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 136/243 (55%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  LIH+     TA+IDAP+   +   L ++GW LT I  THHH DH      LK  +
Sbjct: 13  DNFGYLIHDPSSGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGIAELKAKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           +C +  P + ++KI   D  + +GD    G    +++ TPGHT+ HI Y F +D  L   
Sbjct: 73  HCRVVAPHDANAKIADADLRVEEGDVVKVGGLEARVLETPGHTLDHISYVFADDRALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL+ +P N  LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRALPDDYKLYCGHEYTASNVKFALTIEPENAALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V+  R     T P T+  EK+ N FLR +  S+   +     S   VF ELR RK
Sbjct: 193 ARAKQVEQQRGAGRPTIPVTLGEEKQANVFLRADVPSVAAAIGFAGESAADVFGELRERK 252

Query: 253 NQS 255
           N S
Sbjct: 253 NNS 255


>gi|316932079|ref|YP_004107061.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris DX-1]
 gi|315599793|gb|ADU42328.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris DX-1]
          Length = 255

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 140/241 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH      LK  +
Sbjct: 13  DNFGYLVHDPSTGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGIAELKNKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           +C +  P + ++KI   D  + +GD    GS   +++ TPGHT+ H+ Y F +D  L   
Sbjct: 73  HCRVHAPHDANAKIADADVRVEEGDVVRIGSLTARVLETPGHTLDHVSYVFDDDRALFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P N +LQ
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFRLYCGHEYTASNVKFALGIEPGNADLQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V+++R+    T P T+  EKK N FLR +  S+   + +  A    VF E+R RK
Sbjct: 193 ARAKQVEALRADGKPTIPVTLGEEKKANVFLRADVPSVADAVGLSGAPAAEVFGEIRERK 252

Query: 253 N 253
           N
Sbjct: 253 N 253


>gi|260576489|ref|ZP_05844479.1| hydroxyacylglutathione hydrolase [Rhodobacter sp. SW2]
 gi|259021372|gb|EEW24678.1| hydroxyacylglutathione hydrolase [Rhodobacter sp. SW2]
          Length = 253

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 2/254 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   + I    DN+  LIH+     TA +D PD   I   L  +GW L+ I  THHH D
Sbjct: 1   MTLQLVTIPCRKDNYAFLIHDAASGETAVVDVPDATPILAELARRGWQLSDILITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      + G   ++ ++P +D  LSDG TF  G+   ++I  PGHTIGH+ 
Sbjct: 61  HIEGVQALRAATGAMVIGNAADAHRLPPLDLALSDGLTFTIGAEVGQMIEVPGHTIGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF        GDTL ++GCGR+FE S  +M++SL+++ +   +T I  GHEY E+NA F
Sbjct: 121 YHFAASGLAFTGDTLMAMGCGRLFEGSAQQMWQSLKRLAALPPETLICSGHEYAESNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P    L     ++ + R+QNL T PST++ E   NPFLR     L   L M +A+
Sbjct: 181 ALTLEPATPALTLRLGQIAAARAQNLPTVPSTLADELATNPFLRAP--LLGAALGMADAT 238

Query: 241 NLAVFTELRIRKNQ 254
           +  +F  +R RK++
Sbjct: 239 DAEIFAAIRARKDK 252


>gi|30679573|ref|NP_849599.1| GLX2-4 (glyoxalase 2-4); hydrolase/ hydroxyacylglutathione
           hydrolase/ zinc ion binding [Arabidopsis thaliana]
 gi|20466237|gb|AAM20436.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|22136310|gb|AAM91233.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|332189822|gb|AEE27943.1| putative hydroxyacylglutathione hydrolase 2, chloroplast
           [Arabidopsis thaliana]
          Length = 330

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 135/231 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  ++H+        +D  +   +   L++    LT+I NTHHH DHT  NL LK  +
Sbjct: 85  DNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYDHTGGNLELKDRY 144

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI ++F     +  G
Sbjct: 145 GAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHISFYFPGARAIFTG 204

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ FALS +P N  LQ
Sbjct: 205 DTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQ 264

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L +   ++ A
Sbjct: 265 SYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETADEA 315


>gi|18390616|ref|NP_563760.1| GLX2-4 (glyoxalase 2-4); hydrolase/ hydroxyacylglutathione
           hydrolase/ zinc ion binding [Arabidopsis thaliana]
 gi|75246000|sp|Q8LDW8|GLO2D_ARATH RecName: Full=Probable hydroxyacylglutathione hydrolase 2,
           chloroplast; AltName: Full=Glyoxalase 2-4; AltName:
           Full=Glyoxalase II; Short=Glx II; Flags: Precursor
 gi|21553879|gb|AAM62972.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|110742461|dbj|BAE99149.1| glyoxalase II isozyme like protein [Arabidopsis thaliana]
 gi|332189821|gb|AEE27942.1| putative hydroxyacylglutathione hydrolase 2, chloroplast
           [Arabidopsis thaliana]
          Length = 331

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 135/231 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  ++H+        +D  +   +   L++    LT+I NTHHH DHT  NL LK  +
Sbjct: 86  DNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYDHTGGNLELKDRY 145

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI ++F     +  G
Sbjct: 146 GAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHISFYFPGARAIFTG 205

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ FALS +P N  LQ
Sbjct: 206 DTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQ 265

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L +   ++ A
Sbjct: 266 SYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETADEA 316


>gi|118485019|gb|ABK94374.1| unknown [Populus trichocarpa]
          Length = 328

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 141/241 (58%), Gaps = 1/241 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        ID  +   +   L  K   LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDVDTGTVGVIDPSEAAPVIDALSRKNRNLTYILNTHHHYD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + FG H + ++ TPGHT GH+ 
Sbjct: 133 HTGGNEELKARYGAKVIGSGVDRDRIPGIDIVLNDGDNWMFGGHEVLVMETPGHTRGHVS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D T+IY GHEY  +N+ F
Sbjct: 193 FYFPGSGAIFAGDTLFSLSCGKLFEGTPEQMLSSLRKIMSLPDDTNIYCGHEYMLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP+N  LQ Y + V  +RS++L T P+ + +EK  NPFLR  +T++R  LN+   +
Sbjct: 253 ALSVDPNNEALQSYAAHVAHLRSKSLPTIPTKLKVEKACNPFLRTSSTAIRHTLNIPATA 312

Query: 241 N 241
           N
Sbjct: 313 N 313


>gi|148258776|ref|YP_001243361.1| putative hydroxyacylglutathione hydrolase (glyoxalase II)
           [Bradyrhizobium sp. BTAi1]
 gi|160386192|sp|A5ETG1|GLO2_BRASB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|146410949|gb|ABQ39455.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II)
           [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 142/243 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF  LIH+     TA++DAP+   I + L   GW LT I  THHH DH  A   LK+ +
Sbjct: 13  DNFGYLIHDPATGATASVDAPEAGPIIRQLEAAGWTLTDILITHHHHDHVGAVAELKQKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P ++++ I  +D  +  GD    G    +++ TPGHT+ H+ Y F  D  +   
Sbjct: 73  GCRVVAPHDKTTAIADVDLRVGHGDVIKVGELLARVLETPGHTLDHVSYVFDADKAVFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ D  N  L+
Sbjct: 133 DTLFSVGCGRVFEGTYPMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVDGDNEALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              ++V  +R+ N  T PS +  EK+ N FLR ++ ++   L M+ A+   VF ELR RK
Sbjct: 193 ARAAEVTRLRAANESTIPSLLGDEKQTNVFLRADDPAVAIKLRMKGATAEQVFGELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|8810475|gb|AAF80136.1|AC024174_18 Contains similarity to glyoxalase II isozyme from Arabidopsis
           thaliana gb|U90927 and is a member of the
           Metallo-beta-lactamase seperfamily PF|00753. ESTs
           gb|AV519053, gb|AV535897, gb|AV535667, gb|AV556046,
           gb|BE039169, gb|AV525509 come from this gene
          Length = 512

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 140/243 (57%), Gaps = 1/243 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++    LT+I NTHHH D
Sbjct: 255 SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYD 314

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI 
Sbjct: 315 HTGGNLELKDRYGAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHIS 374

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 375 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 434

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L +   +
Sbjct: 435 ALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETA 494

Query: 241 NLA 243
           + A
Sbjct: 495 DEA 497


>gi|297848880|ref|XP_002892321.1| hypothetical protein ARALYDRAFT_311691 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338163|gb|EFH68580.1| hypothetical protein ARALYDRAFT_311691 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 485

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 140/243 (57%), Gaps = 1/243 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++   +LT+I NTHHH D
Sbjct: 228 SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRYLTYILNTHHHYD 287

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI 
Sbjct: 288 HTGGNLELKDRYGAKVIGSAVDRDRIPGIDVALKDGDKWMFAGHEVHVMETPGHTRGHIS 347

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 348 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 407

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR  NT +R+ L +    
Sbjct: 408 ALSIEPTNEVLQSYAAYVAELREKKLPTIPTTMKMEKACNPFLRAGNTDIRRALGIPETE 467

Query: 241 NLA 243
           + A
Sbjct: 468 DEA 470


>gi|10334501|emb|CAC10212.1| putative mitochondrial glyoxalase II [Cicer arietinum]
          Length = 271

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 144/240 (60%), Gaps = 4/240 (1%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  ++++        +D  +   I + L +K   LT+I NTHHH DHT  N  LK+ 
Sbjct: 27  RDNYAYILYDVDTGTVGVVDPSEAAPIIEALTKKNLNLTYILNTHHHNDHTDGNAELKER 86

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
           +   + G   +  +IPGID  LSDGD + F  H + I+ATPG T GHI ++F     +  
Sbjct: 87  YGAKVIGSDLDKERIPGIDIYLSDGDKWMFAGHEVHIMATPGVTRGHISFYFPGSGAIFT 146

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLFSL CG+++E +  +M  SL+KI S +D T IY GHEYT NN+ FALS +P N EL
Sbjct: 147 GDTLFSLSCGKLYEGTPEQMLSSLKKIMSLADDTSIYCGHEYTLNNSKFALSIEPENKEL 206

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASNLAVFTE 247
           Q Y S V  +R++ L T P+T+ +EK  NPFLR  +T +R+ L +    E+A  L+V  +
Sbjct: 207 QSYASHVAHLRNKGLPTVPTTLKMEKACNPFLRTWSTEIRQKLKVAATAEDAEALSVIRQ 266


>gi|83941360|ref|ZP_00953822.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           EE-36]
 gi|83847180|gb|EAP85055.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           EE-36]
          Length = 255

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 139/249 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +      A ID P+   I+  L E GW LT I+ THHH DH +  
Sbjct: 6   VTIPCLSDNYAFLLRDQTSGKVALIDVPEAAPIAAKLDELGWTLTEIWLTHHHPDHIQGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +   + G   ++ ++P +D    DG +F FG+H + +I   GHT+GHI +H   
Sbjct: 66  PALIADYPARVIGAKADAERLPPLDAAYDDGQSFTFGAHTVDVIDVSGHTVGHIAFHVPV 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M++SL+K+      T +  GHEYT++NA FAL+ D
Sbjct: 126 AKCVFTADSLMALGCGRLFEGTPAQMWDSLQKLMRLPADTTVCSGHEYTQSNAKFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++   R+    T PST+S E + NPFLR  +  +R  L M NA++  VF
Sbjct: 186 PENAALISRAREIDQARADGEPTVPSTLSTELETNPFLRPSDPGIRAQLGMVNATDTDVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRARKDR 254


>gi|163737810|ref|ZP_02145227.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis BS107]
 gi|161389336|gb|EDQ13688.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis BS107]
          Length = 257

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 143/249 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+HN +   TA +DAP+   I   L  +GW L  I  THHH DH    
Sbjct: 8   VTLPCLSDNYAFLLHNAETGRTALVDAPEAAAIRSELERRGWGLDQILLTHHHWDHIDGV 67

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  ++  + G   ++ ++P +D  +++GD+F      + ++   GHTIGHI +H  +
Sbjct: 68  ADLRTAYDPQVIGASADAHRLPDLDLAVAEGDSFTCLDEEVSVLDVSGHTIGHIAFHIPS 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +  +M++SL+K+ +   +T +Y GHEYT++NA FAL+ +
Sbjct: 128 AAAVFTADSLMALGCGRLFEGTPDQMWQSLQKLSALPGETTVYSGHEYTQSNARFALTIE 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  LQ  C  + + R++   T PS +  E   NPFLR    SL++ + M  AS   VF
Sbjct: 188 PDNAALQHRCKAIDAARAKGEATVPSQLQEELDTNPFLRAHLDSLKQAVGMTGASAAEVF 247

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 248 AEIRARKDK 256


>gi|260432834|ref|ZP_05786805.1| hydroxyacylglutathione hydrolase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416662|gb|EEX09921.1| hydroxyacylglutathione hydrolase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 255

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 146/249 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L H+     TA IDAP+T  I   L  +GW LTH+  THHH DH    
Sbjct: 6   VTIPCLSDNYAFLAHDPASGETALIDAPETDPILSELDARGWRLTHVLLTHHHWDHVDGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +       + G   ++ ++P +D  +++GD F+ G  P+++    GHT+GH+ Y+   
Sbjct: 66  AGIVARHPAKVIGAAADAHRLPHLDMQVAEGDRFEIGGEPVEVFDVSGHTVGHVAYYMPQ 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            H +   D+L +LGCGR+FE + A+M+ SL K+ +  D T +  GHEYT++NA FAL+ D
Sbjct: 126 SHAVFTADSLMALGCGRLFEGNAAQMWASLCKLAALPDDTLVCSGHEYTQSNARFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L+   +++ + R+    T PS++ LEK  NPFLR +N +++ +L M  A    VF
Sbjct: 186 PDNPDLRGRAAEIDAARAAGRPTVPSSLGLEKATNPFLRADNPAIQAHLGMAGADPAQVF 245

Query: 246 TELRIRKNQ 254
           +E+R RK++
Sbjct: 246 SEIRGRKDR 254


>gi|254485820|ref|ZP_05099025.1| hydroxyacylglutathione hydrolase [Roseobacter sp. GAI101]
 gi|214042689|gb|EEB83327.1| hydroxyacylglutathione hydrolase [Roseobacter sp. GAI101]
          Length = 255

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 91/249 (36%), Positives = 142/249 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +      A ID P+   IS  L + GW LT I+ THHH DH +  
Sbjct: 6   VTIPCLSDNYAFLLRDQASGAVALIDVPEAAPISAKLDDLGWTLTEIWLTHHHPDHIQGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L       I G   ++ ++P +DH +SDG+TF F  H ++++   GHT+GHI ++   
Sbjct: 66  PDLITEHPARIIGAKADAHRLPDLDHAVSDGETFQFAGHEVQVMDVSGHTVGHIAFYVPA 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M+ S++K+    + T +  GHEYT++NA FAL+ D
Sbjct: 126 AKCVFTADSLMALGCGRLFEGTAAQMWSSMQKLMKLPEDTTVCSGHEYTQSNAKFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++   R   + T PST+  E + NPFLR  +  +R  L M+NA++  VF
Sbjct: 186 PKNDALISRSREIDLARKNGVPTVPSTLVTELQTNPFLRPGDPGIRTQLGMKNATDTDVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRARKDR 254


>gi|83854837|ref|ZP_00948367.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           NAS-14.1]
 gi|83842680|gb|EAP81847.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           NAS-14.1]
          Length = 255

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 138/249 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +      A ID P+   I+  L E GW LT I+ THHH DH +  
Sbjct: 6   VTIPCLSDNYAFLLRDQTSGKVALIDVPEAAPIAAKLDELGWTLTEIWITHHHPDHIQGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       + G   ++ ++P +D    DG +F FG+H + +I   GHT+GHI +H   
Sbjct: 66  PALIADHPARVIGAKADAERLPPLDAAYDDGQSFTFGAHTVDVIDVSGHTVGHIAFHVPA 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M++SL+K+      T +  GHEYT++NA FAL+ D
Sbjct: 126 AKCVFTADSLMALGCGRLFEGTPAQMWDSLQKLMRLPADTTVCSGHEYTQSNAKFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++   R+    T PST+S E + NPFLR  +  +R  L M NA++  VF
Sbjct: 186 PENAALISRAREIDQARADGEPTVPSTLSTELETNPFLRPSDPGIRAQLGMVNATDTDVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRARKDR 254


>gi|84514771|ref|ZP_01002134.1| hydroxyacylglutathione hydrolase, putative [Loktanella
           vestfoldensis SKA53]
 gi|84510930|gb|EAQ07384.1| hydroxyacylglutathione hydrolase, putative [Loktanella
           vestfoldensis SKA53]
          Length = 258

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 146/249 (58%), Gaps = 2/249 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  ++HN     T  IDAP+   I  +L ++GW LT I  THHH DH    
Sbjct: 11  VTVPCLRDNYAFVLHNAVTEQTVLIDAPEASPIKAVLAQRGWQLTDILLTHHHDDHVGGL 70

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+   +  + G   ++ ++P +D  +++GD          +I  PGHTIGHI +H  +
Sbjct: 71  QSLRG--DARVIGARADAHRLPPLDLAVAEGDLLHICGQATHVIDVPGHTIGHIAFHMPD 128

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +  GD+L +LGCGR+FE + A+M+ESL K+++   +T +  GHEYTE+NA FA+S D
Sbjct: 129 AGLVFTGDSLMALGCGRLFEGTPAQMWESLLKLRALPQQTMVCSGHEYTESNARFAVSLD 188

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L+     +++ R+    T PS +  E++ NPFLR ++  L+ +L M+N  ++ VF
Sbjct: 189 PDNADLRLRIKTIETARAAGRPTVPSGLDEERRTNPFLRADDAGLKAHLGMQNQPDVDVF 248

Query: 246 TELRIRKNQ 254
            ++R  K++
Sbjct: 249 AQIRASKDR 257


>gi|163742884|ref|ZP_02150268.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis 2.10]
 gi|161383848|gb|EDQ08233.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis 2.10]
          Length = 257

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 140/242 (57%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+HN +   TA +DAP+   I   L  +GW L  I  THHH DH     +L+  +
Sbjct: 15  DNYAFLLHNAETGRTALVDAPEAAAIRSELERRGWGLDQILLTHHHWDHIDGVADLRTAY 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           +  + G   +  ++P +D  +++GD+F      + ++   GHTIGHI +H  +   +   
Sbjct: 75  DPQVIGASADVHRLPDLDLAVAEGDSFTCLGEEVSVLDVSGHTIGHIAFHISSAAAVFTA 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D+L +LGCGR+FE +  +M++SL+K+ +   +T +Y GHEYT++NA FAL+ +P N  LQ
Sbjct: 135 DSLMALGCGRLFEGTPDQMWQSLQKLAALPGETTVYSGHEYTQSNARFALTIEPDNAALQ 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
             C  + + R++   T PS +  E   NPFLR    SL++ + M  AS   VF E+R RK
Sbjct: 195 HRCKAIDAARAKGEATVPSQLQEELDTNPFLRAHLDSLKQAVGMTGASAAEVFAEIRARK 254

Query: 253 NQ 254
           ++
Sbjct: 255 DK 256


>gi|149202406|ref|ZP_01879379.1| Hydroxyacylglutathione hydrolase [Roseovarius sp. TM1035]
 gi|149144504|gb|EDM32535.1| Hydroxyacylglutathione hydrolase [Roseovarius sp. TM1035]
          Length = 278

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 144/249 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L H+    +TA ID P+   I + L +KGW  + +  THHH DH +  
Sbjct: 29  LTVPCLADNYAYLAHDPATGVTAVIDVPEAEPILQALDKKGWSASLVLLTHHHADHVQGL 88

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+   + ++ G   ++ ++P +DH +++GD    GS   +++   GHT+GHI +HF  
Sbjct: 89  DALRARHSVSVIGAAADAHRLPPLDHRVTEGDLIKIGSEEGRVLDVSGHTLGHIAFHFPT 148

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L ++GCGR+FE +  +MFESL K+ +   +T +  GHEYT++NA FAL+ D
Sbjct: 149 SAVVFTADSLMAMGCGRVFEGTMPQMFESLGKLANLPPETLVCSGHEYTQSNAKFALTVD 208

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++ + R+    T PST++ E   NPFLR EN S++ +L M   + + VF
Sbjct: 209 PDNPALISRVKEISAARAAGRPTVPSTLAEELATNPFLRAENASVQAHLGMSGRAPVDVF 268

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 269 AEIRARKDR 277


>gi|83594600|ref|YP_428352.1| hydroxyacylglutathione hydrolase [Rhodospirillum rubrum ATCC 11170]
 gi|123525672|sp|Q2RP80|GLO2_RHORT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|83577514|gb|ABC24065.1| Hydroxyacylglutathione hydrolase [Rhodospirillum rubrum ATCC 11170]
          Length = 256

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 1/254 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M++L+I  I++  DN+  L+        A ID      +       GW +THI NTHHH 
Sbjct: 1   MSTLDIHQIAVLSDNYIYLVRCRATGACAVIDPSLAEPVLAAAESLGWTITHILNTHHHY 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  +K    C I G   ++ ++PGID  + +GD    G    ++I TPGHT+GHI
Sbjct: 61  DHTGGNEEIKAATGCEIIGFAGDAHRLPGIDRTVVEGDRVAIGQAEARVIETPGHTLGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F     L  GDTLFS GCGR+FE S  +M++SL K+++   +T ++ GHEYT+ N  
Sbjct: 121 AYWFAESSALFCGDTLFSAGCGRLFEGSAGQMWDSLRKLRALPAQTLVFCGHEYTQPNIT 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L+    +V ++R+    T P+ +  E + NPFLR ++   ++   M  A
Sbjct: 181 FALTIDPRNEALRARALEVDALRAAGRPTVPAFLGDEARSNPFLRADSADFQEAFGMTGA 240

Query: 240 SNLAVFTELRIRKN 253
             + VF   R++K+
Sbjct: 241 DPVEVFARTRLKKD 254


>gi|84683662|ref|ZP_01011565.1| hydroxyacylglutathione hydrolase, putative [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668405|gb|EAQ14872.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2654]
          Length = 255

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/253 (36%), Positives = 139/253 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   I I    DN+  L+H+     TA  DAP+T  I   L  +GW LT +F THHH D
Sbjct: 1   MTLELITIPCRSDNYAFLVHDAATGETALFDAPETAPIKAELDARGWTLTDLFITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L+  + C + G   ++ ++P +D  +  GD   F  H +++ A  GHTIGHI 
Sbjct: 61  HIEGVDDLRAAYGCRVVGGKHDAGRLPALDKAVEPGDVLSFAGHEVQVFAADGHTIGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++  +      GD+L +LGCGR+FE +  +M+ +L ++ +  D T I  GHEYT  NA F
Sbjct: 121 FYMPDAKAAFTGDSLMALGCGRLFEGTPEQMWGTLSRLMALPDDTLICSGHEYTAANARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N +L     +   +R    +T PS +SLEK  NPFLR     ++K ++ME+  
Sbjct: 181 ALSVEPQNADLIHRAEQTTKLRENGEFTVPSLLSLEKATNPFLRAGLPEMKKAVDMEHDG 240

Query: 241 NLAVFTELRIRKN 253
           +  VF  +R  K+
Sbjct: 241 DAEVFAAIRRAKD 253


>gi|254502834|ref|ZP_05114985.1| metallo-beta-lactamase superfamily protein [Labrenzia alexandrii
           DFL-11]
 gi|222438905|gb|EEE45584.1| metallo-beta-lactamase superfamily protein [Labrenzia alexandrii
           DFL-11]
          Length = 260

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 132/244 (54%), Gaps = 1/244 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+ +   T A+D PD      +L E GW L+HI  THHH DH +    LK   
Sbjct: 17  DNFGVLIHDRESGTTVAVDVPDAAAYEAVLAETGWKLSHILITHHHWDHVQGLGELKTKT 76

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + GP     KI  +D  + DGD    G + +K IATPGHT+  I ++  +      G
Sbjct: 77  GAVVIGPERSRQKISELDRTVEDGDDVLCGPYEVKAIATPGHTLDQISWYIPSIKVAHTG 136

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIK-SFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           DTLF+LGCGR+FE     M+ SL  +     D T IY GHEYTE NA FA++ +P N  L
Sbjct: 137 DTLFALGCGRVFEGDKEMMWASLSHLMHRLPDDTTIYCGHEYTEANAKFAVTIEPGNEAL 196

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           Q    ++  +R+    T P+T++ EK  NPFLR    S+   L M      AVF E+R R
Sbjct: 197 QARAKEIADIRALGKPTLPTTMAAEKATNPFLRAGEASVADALGMAGQPAEAVFAEIRTR 256

Query: 252 KNQS 255
           K+ +
Sbjct: 257 KDNA 260


>gi|310815410|ref|YP_003963374.1| hydroxyacylglutathione hydrolase [Ketogulonicigenium vulgare Y25]
 gi|308754145|gb|ADO42074.1| hydroxyacylglutathione hydrolase [Ketogulonicigenium vulgare Y25]
          Length = 264

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 138/248 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  LIH+     TA IDAP+   I  +LR +GW L  I  THHH DH  A 
Sbjct: 15  VTIPCLRDNYAFLIHDSTTNRTALIDAPEADPIETVLRARGWKLDAILLTHHHDDHIAAV 74

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L +     ++G   +  ++P +DH L  GD F     P+++I  PGHTIGHI +H   
Sbjct: 75  PALLQNHKAQVYGAAADRHRLPPLDHALKGGDVFSLLGTPVEVIEVPGHTIGHIAFHLPE 134

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L  +GCGR+FE + A+M+ SL ++ +   +T I+ GHEYTE+N  FALS  
Sbjct: 135 LTAAFTGDSLMVMGCGRLFEGTAAQMYHSLTQLAALPPETLIHSGHEYTESNMRFALSIL 194

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P +  L+   +K+ + R++  +T P+ +  E   NPFLR     + + ++M +A  L VF
Sbjct: 195 PDDPSLRARATKIAACRAEGSFTVPARLEKELATNPFLRAHEAQIARAIDMPDADPLRVF 254

Query: 246 TELRIRKN 253
           T LR  K+
Sbjct: 255 TRLRAMKD 262


>gi|297182971|gb|ADI19118.1| Zn-dependent hydrolases, including glyoxylases [uncultured alpha
           proteobacterium HF0070_34E11]
          Length = 257

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 148/242 (61%), Gaps = 1/242 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ IL+H+   + T AIDA D    +K L  +GW L+ I+ THHH DHT     L + +
Sbjct: 14  DNYGILLHDKHTKKTIAIDAGDEASYNKALDAQGWQLSEIWVTHHHWDHTDGIQGLYERW 73

Query: 73  NCTIFGPLEESS-KIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
            C + GP ++S+  I  +  G+++GD+F F +  +K+I TPGHT+  I ++  +++ L  
Sbjct: 74  QCKVIGPAKDSTVPIAHLSKGITEGDSFLFANSTVKVIHTPGHTLDMINFYLPSENILFS 133

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
            DTLFSLGCGR+FE     M+ S+ KI +  DKT IY  HEYT+ N  FALS D  N  L
Sbjct: 134 ADTLFSLGCGRVFEGDMNMMYNSINKILALPDKTTIYCSHEYTQANGKFALSVDADNKSL 193

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
               ++V+ + + N  T P+ + LEK+ NPFLR  + S+R  L +++AS + VF+ LR  
Sbjct: 194 ITRINQVEKLVAANKPTIPTILELEKQTNPFLRTSSPSIRNKLGLKDASEVEVFSALRTA 253

Query: 252 KN 253
           K+
Sbjct: 254 KD 255


>gi|85704173|ref|ZP_01035276.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Roseovarius sp. 217]
 gi|85671493|gb|EAQ26351.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Roseovarius sp. 217]
          Length = 278

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 138/249 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L H+    +TAAID P+   I + L +KGW L+ +  THHH DH +  
Sbjct: 29  LTVPCLADNYAYLAHDPATGVTAAIDVPEAAPILQALDKKGWKLSLVLLTHHHADHVQGL 88

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       + G   ++ ++P +D  +SDGD    GS    ++   GHT+GH+ +HF  
Sbjct: 89  GELLARHPAQVIGAAADAHRLPPLDRAVSDGDQIGIGSETGVVMDVSGHTVGHLAFHFPQ 148

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L ++GCGR+FE + A+MFESL KI S   +T I  GHEYTE+NA FA + D
Sbjct: 149 SAVVFTADSLMAMGCGRVFEGTMAQMFESLGKISSLPPRTTICSGHEYTESNAKFARTVD 208

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++ + R+    T PS ++ E   NPFLR  +  ++  L M  ++ + VF
Sbjct: 209 PDNAALISRSIEISAARAAGRPTVPSILADELATNPFLRAGDAGIQAQLGMTGSAPVDVF 268

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 269 AEIRARKDR 277


>gi|254474804|ref|ZP_05088190.1| hydroxyacylglutathione hydrolase [Ruegeria sp. R11]
 gi|214029047|gb|EEB69882.1| hydroxyacylglutathione hydrolase [Ruegeria sp. R11]
          Length = 257

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 144/248 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+HN     TA +DAP+   I   L ++GW L  I  THHH DH    
Sbjct: 8   ITLPCLSDNYAFLLHNDDTGQTALVDAPEEAAIKAELDKRGWGLDLILLTHHHWDHVDGV 67

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+  F   + G   ++ ++P +D  +S+GD FD     ++++   GHT+GHI +H  +
Sbjct: 68  DALRAAFGAKVVGASADAHRLPDLDLSVSEGDRFDCLGAEVEVLDVSGHTVGHIAFHLPS 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  +   D+L +LGCGR+FE +  +M+ SL+K+K+   +T +Y GHEYT++NA FA++ +
Sbjct: 128 EKAVFTADSLMALGCGRLFEGTPEQMWASLQKLKALPSETTVYSGHEYTQSNARFAITIE 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+   + + + R++   T PST+  EK  NPFLR +   ++  L M +A +  VF
Sbjct: 188 PDNKALRLRANAIDNARAEGRPTVPSTLQEEKDTNPFLRADLAEVKNALGMAHAQDAEVF 247

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 248 AEIRSRKD 255


>gi|159489683|ref|XP_001702826.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158271043|gb|EDO96871.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 261

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 142/257 (55%), Gaps = 8/257 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRL------TAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + +    DN+  L+H            TA +D  +   + + L  +GW L  + NTHHH 
Sbjct: 4   VRVPCLSDNYVWLLHEAAPAGGSGGGRTAVVDPAEEAPVVEALAARGWSLDAVLNTHHHG 63

Query: 60  DHTRANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT ANL LK+ F    I GP  +  +IPGID  +  GDT+  G   +++  TPGHT GH
Sbjct: 64  DHTGANLALKRRFPGLVIVGPRADKDRIPGIDVQVGTGDTWHLGGLEVRVFDTPGHTRGH 123

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y       L  GDTLF+LGCGR+FE S  +M+ SL ++    D T +Y  HEYT++NA
Sbjct: 124 ITYWVPQAASLFPGDTLFALGCGRLFEGSPQQMWTSLSQLAPLPDDTLVYCAHEYTQSNA 183

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA++ DP N  L +  + + + R++   T PS +  EK  NPFLR  + ++R+ L  + 
Sbjct: 184 RFAVTVDPGNAALAQRKAAIDAARARGEPTVPSRLGEEKATNPFLRPHDPAIRQQLGFDA 243

Query: 239 AS-NLAVFTELRIRKNQ 254
           A+ +  VF  +R  K++
Sbjct: 244 AAPDWQVFGAIRAAKDR 260


>gi|126725795|ref|ZP_01741637.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2150]
 gi|126704999|gb|EBA04090.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2150]
          Length = 255

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 142/248 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  +  + +  +TA +D P+   I   L  +GW L  I  THHH DH +  
Sbjct: 6   ITVPCLSDNYAFIARDQETGVTALVDVPEAAPILAELDARGWGLDLILLTHHHDDHIQGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +    N  + G   ++ ++P +D  L++GD+ + G+    ++   GHTIGHI +HF  
Sbjct: 66  PEVIAKTNAKVVGAKADAHRLPKLDMALNEGDSINIGASEGVVLDVSGHTIGHIAFHFAK 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE S+A+M+ESL K+      T +  GHEYT  N  FA+S +
Sbjct: 126 AKTIFTADSLMALGCGRLFEGSFAQMWESLSKMAVLDPDTLVCSGHEYTAANGRFAMSVE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +LQ    ++ S  ++++ T PS +SLE   NPFLR  +  +R NLNM++AS+  VF
Sbjct: 186 PENTDLQTRVKEIASANAKDVPTVPSLLSLELATNPFLRPHSPEIRVNLNMQDASDADVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRRRKD 253


>gi|87199342|ref|YP_496599.1| hydroxyacylglutathione hydrolase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135023|gb|ABD25765.1| Hydroxyacylglutathione hydrolase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 254

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 131/241 (54%), Gaps = 2/241 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+     TA ID PD     +    +GW +T I+NTH H DH   N  +K   
Sbjct: 13  DNYGFLVHDSDSGETACIDTPDAEAYLREANARGWRITQIWNTHWHPDHAGGNEAIKAAT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            CT+  P +++ KI G+D  ++ GDT   GS   ++I   GHT+GH  YH        VG
Sbjct: 73  GCTVVAPEDDAGKIAGVDRAVAHGDTVQLGSFTAEVIDVGGHTMGHCAYHLPEASVAFVG 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D LF LGCGR+FE +  + + SL +IK+    T +Y  HEYT++NA FAL  DP N  L+
Sbjct: 133 DALFPLGCGRMFEGTPPQFWASLSRIKALPPGTTLYSAHEYTQSNARFALHADPDNAALR 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
            Y   V++ R++  +T P+T++ E   NPFLR +   +        +S +  F  LR  K
Sbjct: 193 AYADGVEARRARGEWTVPTTLAAELAANPFLRADTPGMAARWG--GSSPVDTFAALRAAK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|149913690|ref|ZP_01902223.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           AzwK-3b]
 gi|149812810|gb|EDM72639.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           AzwK-3b]
          Length = 255

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 135/247 (54%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L H+     TAAID PD   I  ML E  W L+H+  THHH DH +    
Sbjct: 8   IPCLSDNYAFLAHDPDTGQTAAIDVPDAAPILAMLEENDWTLSHVLLTHHHADHVQGLEA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L       + G   ++ ++P +D  ++DGD+   G+   ++I  PGHT+GHI ++F    
Sbjct: 68  LLDAAPAKVVGAAADAHRLPPLDISVADGDSIIIGNLIAEVIEVPGHTVGHIAFYFPESA 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L   D+L +LGCGR+FE +  +M++SL ++ +    T +Y GHEYT  NA FAL+ DP 
Sbjct: 128 ALFSADSLMALGCGRVFEGTMDQMYDSLSRLAALPSDTTVYSGHEYTRANAKFALTIDPA 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L    + + + R +   T PS +S E   NPFLR  +  ++ +L M  A    VF E
Sbjct: 188 NAALTSRAAAIDAAREKGHPTVPSKLSEELATNPFLRASDPDIQAHLGMVGADPAKVFAE 247

Query: 248 LRIRKNQ 254
           +R RK++
Sbjct: 248 IRGRKDR 254


>gi|89053533|ref|YP_508984.1| hydroxyacylglutathione hydrolase [Jannaschia sp. CCS1]
 gi|122499324|sp|Q28TK3|GLO2_JANSC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|88863082|gb|ABD53959.1| Hydroxyacylglutathione hydrolase [Jannaschia sp. CCS1]
          Length = 256

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 138/248 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+H+     TA ID PD   I   L  +GW LT I  THHH DH    
Sbjct: 7   ITIPCLQDNYAFLLHDPSTGATACIDVPDAAPIQAALGAQGWTLTDILLTHHHWDHIDGV 66

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L +     ++G   ++ ++P +DH L++GDT   G+    ++   GHT+GH+ +HF  
Sbjct: 67  PALVEATGAKVWGAAADAHRLPPLDHALAEGDTIRIGALEGDVMDVSGHTVGHVAFHFPA 126

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M  SLEK+K     T +  GHEYT +NA FAL+ +
Sbjct: 127 ATAVFTADSLMALGCGRLFEGTPAQMHGSLEKLKMLPPGTLVCSGHEYTASNARFALTIE 186

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     ++ + R+    T PST++ E   NPFLR +  ++   L+ME A  + VF
Sbjct: 187 PDNPDLIFRVERITAARAAGQPTVPSTLAEELATNPFLRADAPTVAAPLDMEGADPVDVF 246

Query: 246 TELRIRKN 253
           T +R +K+
Sbjct: 247 TRIRAQKD 254


>gi|83859176|ref|ZP_00952697.1| metallo-beta-lactamase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852623|gb|EAP90476.1| metallo-beta-lactamase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 255

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 137/242 (56%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI   +   TA ID P+  +I +  +   W +  I+NTHHH DH   N  +++ 
Sbjct: 12  QDNYGFLIRCSETGATACIDTPEADVILEESQTLDWPIRAIWNTHHHWDHAGGNEAIRQA 71

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
               I  P  E++ I  +D  ++ GD    G+   +++   GHT+GH+ Y F       V
Sbjct: 72  TGARIVAPRAEAATIGHVDQPVAAGDAVALGNLTARVMDVGGHTLGHVAYWFEEAGVAFV 131

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GD+LF+LGCGR+FE +  +M   L +++    +T IY  HEYT+ NA FALS DP N  L
Sbjct: 132 GDSLFALGCGRMFEGTPQQMQAGLARLRGLPPETVIYCAHEYTQANARFALSVDPENAAL 191

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           Q Y  +V  +R+++  T P+ ++ E + NPFLR ++  LR  L ++ AS+  VF ELR R
Sbjct: 192 QSYARRVDELRAEDKPTIPTVLAAECESNPFLRWDDEGLRARLGLQAASDAEVFAELRRR 251

Query: 252 KN 253
           K+
Sbjct: 252 KD 253


>gi|255645837|gb|ACU23409.1| unknown [Glycine max]
          Length = 329

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 146/243 (60%), Gaps = 1/243 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   I   L  K   LT+I NTHHH D
Sbjct: 74  SSLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPIIDALSRKNRNLTYILNTHHHHD 133

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N+ LK  +   + G   +  +IPGID  L+DGD + F  H ++++ TPGHT GHI 
Sbjct: 134 HTGGNVELKARYGAKVIGSGTDKERIPGIDIHLNDGDKWMFAGHEVRVMDTPGHTRGHIS 193

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S SD T+IY GHEYT NN  F
Sbjct: 194 FYFPGSGAIFTGDTLFSLSCGKLFEGTPQQMLSSLKKIMSLSDDTNIYCGHEYTLNNIKF 253

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N ELQ Y ++V  +RS+ L T P+T+ +EK  NPFLR  + ++R++L +   +
Sbjct: 254 ALSIEPENEELQSYAAQVAYLRSKGLPTIPTTLKVEKACNPFLRTSSAAIRQSLKIAATA 313

Query: 241 NLA 243
           N A
Sbjct: 314 NDA 316


>gi|85713816|ref|ZP_01044806.1| beta-lactamase-like protein [Nitrobacter sp. Nb-311A]
 gi|85699720|gb|EAQ37587.1| beta-lactamase-like protein [Nitrobacter sp. Nb-311A]
          Length = 255

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 147/243 (60%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     TAAIDAP+   I + L  +GW LT I  THHH DH      LK+ +
Sbjct: 13  DNFGVLIHDPAANATAAIDAPEAEPIIQALDREGWALTDILVTHHHSDHVGGVAELKQKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           NC +  P ++ + I  +D  +  GD    G+   +++ TPGHT+ H+ Y F ++  +   
Sbjct: 73  NCRVVAPHDKGAGIANVDLRVGQGDIVKVGTLLGRVLETPGHTLDHVSYVFDDEKVVFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+FE ++  M++SL K+++  D   +Y GHEYT +N  FAL+ +P+N  L+
Sbjct: 133 DTLFSIGCGRVFEGTHPMMWDSLLKLRALPDSFRLYCGHEYTASNVKFALTIEPNNPALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
               +V  +R++   T P+ +  EKK N FLR ++ ++   ++M+ AS   VF ELR RK
Sbjct: 193 ARAEEVARLRAEGKPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGAEVFAELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|163745695|ref|ZP_02153055.1| hydroxyacylglutathione hydrolase, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382513|gb|EDQ06922.1| hydroxyacylglutathione hydrolase, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 255

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/249 (35%), Positives = 139/249 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +H       ID P+   I   L  +GW L+ ++ THHH DH +  
Sbjct: 6   VTIPCLSDNYAFLLRDHDSGDVTLIDVPEAAPIMAELDRRGWTLSQVWLTHHHPDHVQGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   F   + G   ++ ++P +D  +++GD+   G+   +++   GHT+GHI  H   
Sbjct: 66  AELLTRFPAQVVGAKADARRLPPLDREVAEGDSIALGALHAEVLDVSGHTVGHIALHVPE 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +     D+L +LGCGR+FE + A+M+ESL+K+ +    T I  GHEYT  NA FAL+ D
Sbjct: 126 ANAAFTADSLMALGCGRLFEGTPAQMWESLQKLAALPRDTTICSGHEYTAANAKFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L      +++ R+    T PS +SLE + NPFLR  + ++R  L M +A++  VF
Sbjct: 186 PDNAALISRSKDIEATRTAGRPTVPSQLSLELETNPFLRPGDPAIRATLGMPDATDTEVF 245

Query: 246 TELRIRKNQ 254
           TE+R RK+Q
Sbjct: 246 TEIRKRKDQ 254


>gi|18406237|ref|NP_565999.1| GLX2-1 (GLYOXALASE 2-1); hydroxyacylglutathione hydrolase
           [Arabidopsis thaliana]
 gi|21264419|sp|O24495|GLO2M_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 1, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|2570338|gb|AAC49865.1| glyoxalase II isozyme [Arabidopsis thaliana]
 gi|17380664|gb|AAL36162.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|20196860|gb|AAB64315.2| putative glyoxalase II [Arabidopsis thaliana]
 gi|20259003|gb|AAM14217.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|330255174|gb|AEC10268.1| Hydroxyacylglutathione hydrolase 1 [Arabidopsis thaliana]
          Length = 331

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 134/231 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+        +D  +   + + L  K W LT+I NTHHH DH   N  LK+ +
Sbjct: 88  DNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDDHIGGNAELKERY 147

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI ++F     +  G
Sbjct: 148 GAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHISFYFPGSATIFTG 207

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  FALS +P N  LQ
Sbjct: 208 DLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQ 267

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ +++  A
Sbjct: 268 SYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSATEA 318


>gi|83952817|ref|ZP_00961547.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX
           II)protein [Roseovarius nubinhibens ISM]
 gi|83835952|gb|EAP75251.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX
           II)protein [Roseovarius nubinhibens ISM]
          Length = 255

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 135/249 (54%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L H+     TA +D P+   I+ +L E+GW  + +  THHH DH +  
Sbjct: 6   VTVPCLSDNYAYLAHDPGTGATAVVDVPEAAPITAVLAERGWQASLVILTHHHDDHVQGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       + G   ++ ++P +D  L DG T D G     +    GHTIGHI  HF  
Sbjct: 66  PELLAEHQAKVAGNAADAHRLPPLDIALRDGGTVDIGGETGHVFDVSGHTIGHIALHFPQ 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                  D+L +LGCGR+FE +  +M++SL K+ +   +T I  GHEYT  NA FALS D
Sbjct: 126 SAVAFTADSLMALGCGRVFEGTMDQMWQSLSKLAALPPETTICSGHEYTAANARFALSID 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++ + RS N  T PST+S E   NPFLR  + +L+  L+M +AS+  VF
Sbjct: 186 PANSALISRAERIATARSANQPTVPSTLSDELATNPFLRASDPALKSALDMGDASDAEVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRHRKDR 254


>gi|42571211|ref|NP_973679.1| GLX2-1 (GLYOXALASE 2-1); hydroxyacylglutathione hydrolase
           [Arabidopsis thaliana]
 gi|330255173|gb|AEC10267.1| Hydroxyacylglutathione hydrolase 1 [Arabidopsis thaliana]
          Length = 313

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 134/231 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+        +D  +   + + L  K W LT+I NTHHH DH   N  LK+ +
Sbjct: 70  DNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDDHIGGNAELKERY 129

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI ++F     +  G
Sbjct: 130 GAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHISFYFPGSATIFTG 189

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  FALS +P N  LQ
Sbjct: 190 DLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQ 249

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ +++  A
Sbjct: 250 SYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSATEA 300


>gi|218670474|ref|ZP_03520145.1| hydroxyacylglutathione hydrolase [Rhizobium etli GR56]
          Length = 187

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 129/187 (68%), Gaps = 1/187 (0%)

Query: 1   MTSLNIAISLYH-DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L +A+ L   DNF +L+H+ +   TAAIDAP+   + +    +GW +THIF THHH 
Sbjct: 1   MKPLELAVFLCRTDNFGVLVHDPETGFTAAIDAPEEAPMLEAATRRGWKITHIFTTHHHT 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK+ F C I GP+ E+  IPG+D  ++DGD F FG+H + +I TPGHT GHI
Sbjct: 61  DHVAANLALKEQFGCEIIGPINEAVAIPGLDRTMADGDRFLFGNHTVNVIETPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF++D  L   DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT +NA 
Sbjct: 121 CYHFVDDKLLFAADTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLSNAR 180

Query: 180 FALSCDP 186
           FAL+ DP
Sbjct: 181 FALTVDP 187


>gi|326387159|ref|ZP_08208769.1| hydroxyacylglutathione hydrolase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208340|gb|EGD59147.1| hydroxyacylglutathione hydrolase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 254

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 135/241 (56%), Gaps = 2/241 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ +   T AID PD          +GW +T I+NTH H DH   N  +K   
Sbjct: 13  DNYGYLVHDPESGETVAIDTPDADAYLAAAESRGWRITQIWNTHWHPDHAGGNEAIKAQT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C I  P  ++ +I G+D  +  GDT   G+    +I   GHT+GH+ YH  +   + VG
Sbjct: 73  GCLITAPEGDAPRIAGVDRTVEQGDTVTLGAFEATVIDVGGHTLGHVAYHIPDAAMVFVG 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D+LF+LGCGR+FE + A+ + SL ++K+    T +Y  HEYT +NA FA+  DP N  LQ
Sbjct: 133 DSLFALGCGRMFEGTPAQFWASLSRLKALPGNTLVYCAHEYTASNARFAVHADPDNAALQ 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
            Y ++V++ R+    T P+ ++ E   NPFLR ++ +++      +A  +A F  LR  K
Sbjct: 193 SYAAEVEARRANGEATVPTIMAREIATNPFLRADDPAMQARWGGGDA--VATFAALRAAK 250

Query: 253 N 253
           +
Sbjct: 251 D 251


>gi|92116087|ref|YP_575816.1| hydroxyacylglutathione hydrolase [Nitrobacter hamburgensis X14]
 gi|122418732|sp|Q1QQZ1|GLO2_NITHX RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91798981|gb|ABE61356.1| Hydroxyacylglutathione hydrolase [Nitrobacter hamburgensis X14]
          Length = 255

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 145/243 (59%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +LIH+     TAAIDAP+   I + L  +GW LT I  THHH DH      LK+ +
Sbjct: 13  DNFGVLIHDPATDATAAIDAPEAGPIIEALDREGWTLTDILVTHHHADHIGGIAELKQKY 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
            C +  P ++ + I  +D  +  GD    G+   +++ TPGHT+ HI Y F ++  +   
Sbjct: 73  KCRVVAPHDKKAPIANVDLRVGQGDIVKVGTLLGRVLETPGHTLDHISYVFDDEKVVFAA 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFS+GCGR+ E +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ +P+N  L+
Sbjct: 133 DTLFSIGCGRVIEGTYPMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVEPNNAALK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
                V  +R++N  T P+ +  EKK N FLR ++ ++   ++M+ AS   VF ELR RK
Sbjct: 193 ARAEDVARLRAENKPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGADVFGELRERK 252

Query: 253 NQS 255
           N+S
Sbjct: 253 NKS 255


>gi|2570340|gb|AAC49866.1| glyoxalase II mitochondrial isozyme [Arabidopsis thaliana]
          Length = 331

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 134/231 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+        +D  +   + + L  K W LT+I NTHHH DH   N  LK+ +
Sbjct: 88  DNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDDHIGGNAELKERY 147

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI ++F     +  G
Sbjct: 148 GAKVIGSAVDKHRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHISFYFPGSATIFTG 207

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  FALS +P N  LQ
Sbjct: 208 DLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQ 267

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ +++  A
Sbjct: 268 SYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSATEA 318


>gi|307294742|ref|ZP_07574584.1| hydroxyacylglutathione hydrolase [Sphingobium chlorophenolicum L-1]
 gi|306879216|gb|EFN10434.1| hydroxyacylglutathione hydrolase [Sphingobium chlorophenolicum L-1]
          Length = 240

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 130/224 (58%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I + +DN+  L+H+     T A+D      + +  R++GW +  I+NTH H DH   N
Sbjct: 5   VRIPVLNDNYVWLLHDDASGETVAVDPAVAEPVLEAARQRGWTIGQIWNTHWHGDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K    C I GP  E+ KI  +D  +++GD+   G H   ++  P HT GHI YH  +
Sbjct: 65  AAIKAATGCIITGPAAEAEKIGTLDRMVAEGDSVRIGDHQATVLEVPAHTAGHIAYHLAD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  + VGDTLF++GCGR+FE + A+MF ++++  +  D T +Y  HEYT++N  FAL+ +
Sbjct: 125 DRLIFVGDTLFAMGCGRLFEGTAAQMFANMQRFAALPDDTTVYCAHEYTQSNGRFALTVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           P N  L+    +V + R++   T P++I LE+  N F+R  + +
Sbjct: 185 PDNAALRTRMDQVDAARARGEPTVPTSIGLERATNIFMRARDIA 228


>gi|294010314|ref|YP_003543774.1| hydroxyacylglutathione hydrolase [Sphingobium japonicum UT26S]
 gi|292673644|dbj|BAI95162.1| hydroxyacylglutathione hydrolase [Sphingobium japonicum UT26S]
          Length = 240

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 137/250 (54%), Gaps = 14/250 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  L+H+     T A+D      + +  R++ W ++ I+NTH H DH   N
Sbjct: 5   VRIPVLSDNYVWLLHDDASGETVAVDPAVAEPVLEAARQRDWTISQIWNTHWHGDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K    CTI GP  E+ KI  +D  + +GD+   G+H   ++  P HT GH+ YH  +
Sbjct: 65  AAIKAATGCTITGPAAEAEKIGTLDRMVREGDSVRIGAHQAAVLEVPAHTAGHVAYHLAD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  + VGDTLF++GCGR+FE + A+MF ++ +  +  D T +Y  HEYT++N  FAL+ +
Sbjct: 125 DRLIFVGDTLFAMGCGRLFEGTAAQMFANMRRFAALPDDTVVYCAHEYTQSNGRFALTVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+   ++V + RS+   T P+++  E+  N F+R              AS++A  
Sbjct: 185 PDNAALRARMAEVDAARSRGEATVPTSVGQERATNVFMR--------------ASDVAQL 230

Query: 246 TELRIRKNQS 255
            E R  K+ +
Sbjct: 231 AERRAAKDAA 240


>gi|119094192|gb|ABL61014.1| hydroxyacylglutathione hydrolase [uncultured marine bacterium
           HF10_25F10]
          Length = 250

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 142/241 (58%), Gaps = 5/241 (2%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+ +L+H+ +   TA +DA D       L E GW LT I+ THHH DHT A L      
Sbjct: 13  DNYGVLLHDAERGETALVDAGDAEAAEAALDEAGWPLTQIWITHHHGDHT-AGLGALAGD 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +FGP E    I GID  L  G++F F    +++I+TPGHT+  + Y+   +  +  G
Sbjct: 72  GVEVFGPAE----IGGIDTVLDGGNSFAFAGREVEVISTPGHTLTMLNYYLPAEKLVFTG 127

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF++GCGR+FE     M++SL K+ + +D T IY GHEYT  NA FALS DP N  L+
Sbjct: 128 DTLFAMGCGRLFEGDAPMMWDSLCKLMALADDTVIYCGHEYTAANARFALSVDPANTALR 187

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +  + V  +RS      P+ I+LEK  NPFLR  +  LR +L ME AS+  VF E+R RK
Sbjct: 188 RRAAAVDELRSIGQPAVPTMIALEKATNPFLRASDAGLRAHLGMEGASDAEVFAEVRRRK 247

Query: 253 N 253
           +
Sbjct: 248 D 248


>gi|89069067|ref|ZP_01156448.1| hydroxyacylglutathione hydrolase, putative [Oceanicola granulosus
           HTCC2516]
 gi|89045436|gb|EAR51501.1| hydroxyacylglutathione hydrolase, putative [Oceanicola granulosus
           HTCC2516]
          Length = 252

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/249 (36%), Positives = 136/249 (54%), Gaps = 1/249 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+HN + R TA +DAP+   I+ +L  +GW L+ I  THHH DH    
Sbjct: 4   VTIPCRTDNYAFLLHNAESRETALVDAPEAAPIAAVLSARGWQLSDILITHHHGDHVEGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+   +  + G   ++ ++P +D  + +GD       P+ I    GHT+GH+ +HF  
Sbjct: 64  AGLRTD-DVRVIGAAADAHRLPDLDLAVREGDALTVCGEPVTIFDVSGHTVGHVAFHFPE 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                  D+L +LGCGR+FE +  +M+ SL K+++  + T I  GHEYT  NA FA + D
Sbjct: 123 TGAAFTADSLMALGCGRLFEGTPEQMWHSLLKLRALPEDTVICSGHEYTAANARFAQTID 182

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L      V   R+ +  T PST+  E   NPFLR +   L+  L ME AS++ VF
Sbjct: 183 PANGALMSRSRAVDEARTLDQPTVPSTLKEEIATNPFLRADTPELKAALGMERASDVEVF 242

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 243 AEIRARKDR 251


>gi|254294710|ref|YP_003060733.1| hydroxyacylglutathione hydrolase [Hirschia baltica ATCC 49814]
 gi|254043241|gb|ACT60036.1| hydroxyacylglutathione hydrolase [Hirschia baltica ATCC 49814]
          Length = 262

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 142/242 (58%), Gaps = 1/242 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  LIH+     T +ID+PD   I  +   KGW +THI NTH H DH   N  +++  
Sbjct: 19  DNYGYLIHHPASNSTISIDSPDAETILNIAASKGWNITHILNTHWHADHAGGNAKIQEAT 78

Query: 73  NCTIFGPLEESSKIPG-IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
            C IFGP E +S++   +D  L+ G+T +FG   I++++TPGHT+ HI Y+        V
Sbjct: 79  GCRIFGPQEVNSRLQAPLDDVLTGGETLNFGDLSIEVLSTPGHTLEHISYYIPILDAAFV 138

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDT+F+LGCGR+FE +    + SL+KI++  D T IY  HEYT  N  F  S D  N +L
Sbjct: 139 GDTMFALGCGRMFEGNPEMFWNSLKKIRALPDTTKIYCAHEYTLANLKFTESIDAENEDL 198

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           + Y   ++ +R+    T P+ +  EK+ NPFLR ++T +   LNM+  S + VF  +R  
Sbjct: 199 KAYAKTLRELRADQQPTIPALLGKEKQTNPFLRADSTQMINLLNMQGKSPIDVFAHIRKM 258

Query: 252 KN 253
           K+
Sbjct: 259 KD 260


>gi|255636437|gb|ACU18557.1| unknown [Glycine max]
          Length = 315

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 144/243 (59%), Gaps = 1/243 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH D
Sbjct: 60  SSLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHD 119

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N+ LK  +   + G   +  +IPGID  L+DGD + F  H +++  TPGHT  HI 
Sbjct: 120 HTGGNVELKARYGAKVIGSGTDKKRIPGIDIHLNDGDKWMFAGHEVRVKDTPGHTQSHIS 179

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T+IY GHEYT NN  F
Sbjct: 180 FYFPGSGAIFTGDTLFSLSCGKLFEGTPQQMLSSLKKIMSLPDNTNIYCGHEYTLNNTKF 239

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N ELQ Y ++V  +RS+ L T P+T+ +EK  NPFLR  + ++R++LN+   +
Sbjct: 240 ALSIEPENEELQSYAAQVAYLRSKGLPTIPTTLKMEKACNPFLRTSSAAIRQSLNIAATA 299

Query: 241 NLA 243
           N A
Sbjct: 300 NDA 302


>gi|86136458|ref|ZP_01055037.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp. MED193]
 gi|85827332|gb|EAQ47528.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp. MED193]
          Length = 255

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 139/248 (56%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+H+ K   TA +DAP+   +   L  +GW L  I  THHH DH    
Sbjct: 6   ITLPCLSDNYAYLLHDAKSGQTALVDAPEAAAVKSALSARGWGLDAILLTHHHYDHIDGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +   ++G   ++ ++P +DH L  G  F+     ++++   GHT+GHI +    
Sbjct: 66  DALRRDYGAKVYGAKPDAHRLPPLDHALDYGVRFELFGEEVQVLDVSGHTVGHIAFFLPE 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE +   M++SL ++ +   +T +Y GHEYT++NA FAL+ +
Sbjct: 126 SQAVFTADSLMALGCGRLFEGTPDMMWQSLNRLMALPPETMVYSGHEYTQSNARFALTIE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +LQ    ++ + R++   T PS + LE   NPFLR     ++  L ME+A N  VF
Sbjct: 186 PDNAKLQLRVDEINAKRAKGEATVPSRLQLELDTNPFLRAHLDEMKSTLGMESAENAEVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRQRKD 253


>gi|297828043|ref|XP_002881904.1| glyoxalase 2-1 [Arabidopsis lyrata subsp. lyrata]
 gi|297327743|gb|EFH58163.1| glyoxalase 2-1 [Arabidopsis lyrata subsp. lyrata]
          Length = 331

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 133/231 (57%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+        +D  +   + + L  K W LT+I NTHHH DH   N  LK+ +
Sbjct: 88  DNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDDHIGGNAELKERY 147

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L D D + F  H ++++ TPGHT GHI ++F     +  G
Sbjct: 148 GAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRVLDTPGHTQGHISFYFPGSATIFTG 207

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  FALS +P N  LQ
Sbjct: 208 DLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQ 267

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            Y ++V  +RSQ L + P+T+ +EK  NPFLR  +  +RK+L++ +++  A
Sbjct: 268 SYATRVAHLRSQGLPSIPTTVKVEKACNPFLRTWSKDIRKSLSIPDSATEA 318


>gi|224093054|ref|XP_002309787.1| predicted protein [Populus trichocarpa]
 gi|118483171|gb|ABK93490.1| unknown [Populus trichocarpa]
 gi|118485660|gb|ABK94680.1| unknown [Populus trichocarpa]
 gi|222852690|gb|EEE90237.1| predicted protein [Populus trichocarpa]
          Length = 328

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 149/254 (58%), Gaps = 2/254 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   +   L  K W LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDEDTGTVGVVDPSEATPVIDALSRKNWNLTYILNTHHHHD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + F  H ++++ TPGHT GHI 
Sbjct: 133 HTGGNQELKARYGAKVIGSGVDKDRIPGIDIVLNDGDKWMFAGHEVQVMDTPGHTRGHIS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T+IY GHEYT +N+ F
Sbjct: 193 FYFPGSGAIFTGDTLFSLSCGKLFEGTPEQMLSSLKKIVSLPDDTNIYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P+N  LQ Y + +  +RS++L T P+ + +EK  NPFLR  +T +R+ LN+   A
Sbjct: 253 ALSIEPNNEALQSYAAHIAHLRSKSLPTIPTKLKVEKACNPFLRTSSTEIRQTLNIPATA 312

Query: 240 SNLAVFTELRIRKN 253
           S+      +R  K+
Sbjct: 313 SDSETLGVIRQAKD 326


>gi|254440799|ref|ZP_05054292.1| metallo-beta-lactamase superfamily protein [Octadecabacter
           antarcticus 307]
 gi|198250877|gb|EDY75192.1| metallo-beta-lactamase superfamily protein [Octadecabacter
           antarcticus 307]
          Length = 253

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 139/248 (56%), Gaps = 2/248 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    +N+  L+HN + + T  +DAPD   I   L  +GW LT I  THHH DH    
Sbjct: 6   VTIPCLANNYAFLLHNARTKETLLVDAPDAPPIQAALDAQGWTLTDILLTHHHGDHVDGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+   +  + G   ++ ++P ID  + +GDT        ++    GHTIGH   HF  
Sbjct: 66  EPLRG--SARVIGAAADAHRLPPIDLAVVEGDTITICGEAAQVFDVSGHTIGHFALHFAT 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GD+L +LGCGR+FE + A+M++S+ K+++  D+T +  GHEYT+ NA FAL+ +
Sbjct: 124 SDVLFTGDSLMALGCGRLFEGTPAQMWQSMLKLRALPDETRVCSGHEYTQTNARFALTIE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     +V   R++   T PS + +EK+ NPFLR +  +L+    M N+    VF
Sbjct: 184 PDNSDLISRIEEVTRTRAEKQPTVPSDLGVEKRTNPFLRADVPALQTAFGMTNSDPTDVF 243

Query: 246 TELRIRKN 253
           TE+R +++
Sbjct: 244 TEIRKKRD 251


>gi|254472367|ref|ZP_05085767.1| hydroxyacylglutathione hydrolase [Pseudovibrio sp. JE062]
 gi|211958650|gb|EEA93850.1| hydroxyacylglutathione hydrolase [Pseudovibrio sp. JE062]
          Length = 257

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 134/242 (55%), Gaps = 1/242 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DNF +L+H+     T AID P+     ++L E GW LT I  THHH DH      L +  
Sbjct: 14  DNFGVLVHHPDSGCTVAIDVPEAAPYLQVLEETGWNLTDILITHHHWDHVGGLAELVEKT 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + GP      I  +   + DGD    G   +K I TPGHT+ HI + F        G
Sbjct: 74  GAKVTGPERSRQHITTMTRFVEDGDDILIGPIAVKAIGTPGHTLDHISWWFQEAGIAHTG 133

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIK-SFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           DTLF+LGCGR+FE     M+ SL  +  +   +T IY GHEYT +NA FAL+ DP+N  L
Sbjct: 134 DTLFALGCGRVFEGDAEMMWASLSHLANTLPPETTIYCGHEYTLSNAKFALTIDPNNQAL 193

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           Q+   +++++R     T P++++ E   NPFLR+ +  ++KNLNM NA    +F E+R R
Sbjct: 194 QERTKRIEALREVGRPTLPTSMAAELSTNPFLRVRDPEVQKNLNMVNAEPADIFAEIRRR 253

Query: 252 KN 253
           K+
Sbjct: 254 KD 255


>gi|312281789|dbj|BAJ33760.1| unnamed protein product [Thellungiella halophila]
          Length = 330

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 139/243 (57%), Gaps = 1/243 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    +N+  L+H+        +D  +   +   L  K W LT+I NTHHH D
Sbjct: 75  SSLKIELVPCSRENYAYLLHDEDTGTVGVVDPSEAAPVIDALSRKNWNLTYILNTHHHED 134

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H +++I TPGHT GHI 
Sbjct: 135 HIGGNAELKERYGAKVIGSAVDKDRIPGIDILLKDSDEWMFAGHEVRVIDTPGHTQGHIS 194

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI +  D T+IY G E T +N  F
Sbjct: 195 FYFPGSAAIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVALPDDTNIYCGRENTASNLKF 254

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  L+ Y ++V  +RSQ L + P+T+ +EK  NPFLR  +  +R++L++ +++
Sbjct: 255 ALSVEPKNETLRSYATQVAHLRSQGLPSIPTTVKVEKACNPFLRTSSKDIRRSLSIPDSA 314

Query: 241 NLA 243
           N A
Sbjct: 315 NEA 317


>gi|254454033|ref|ZP_05067470.1| hydroxyacylglutathione hydrolase [Octadecabacter antarcticus 238]
 gi|198268439|gb|EDY92709.1| hydroxyacylglutathione hydrolase [Octadecabacter antarcticus 238]
          Length = 253

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 137/248 (55%), Gaps = 2/248 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+HN +   T  +DAPD   I   L  +GW LT +  THHH DH    
Sbjct: 6   VTIPCLADNYAFLLHNARTNETLLVDAPDAPPIQAALDARGWTLTDVLLTHHHGDHIVGL 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+   +  + G   ++ ++P +D  + DGDT        ++    GHT+GHI  HF  
Sbjct: 66  GPLRG--SARVIGAAADAHRLPPLDLAVGDGDTVTICGEAAQVFDVSGHTMGHIALHFAK 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L   D+L +LGCGR+FE +  +M++S+ K++S  D+T +  GHEYT+ NA FAL+ +
Sbjct: 124 SGVLFTADSLMALGCGRLFEGTPVQMWQSMLKLRSLPDETRVCSGHEYTQTNARFALTIE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     +V   R+ N  T PS + +EK+ NPFLR +  +L+    M N+    VF
Sbjct: 184 PDNSDLISRIEEVSRARAANHPTVPSNLGIEKRTNPFLRADVPALQTAFGMTNSDPTDVF 243

Query: 246 TELRIRKN 253
           T++R +++
Sbjct: 244 TQIRKKRD 251


>gi|145347600|ref|XP_001418251.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578480|gb|ABO96544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 227

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/216 (39%), Positives = 127/216 (58%), Gaps = 4/216 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGW-FLTHIFNTHHHIDHTRANLNLKKF 71
           DN+   +   K +  A +DAPD   I++ L   GW   + I NTHHH DH  AN  ++  
Sbjct: 12  DNYGFAVRCRKTKTVALVDAPDEGAIARALSSAGWESPSMILNTHHHRDHVGANGGVRAR 71

Query: 72  F---NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           F      +  P  E+ KI  +D  + +GD  + G     +  TPGHT+GH+ YHF  +  
Sbjct: 72  FPDARVVVVAPRREAEKIGDVDVAVEEGDVVEIGDVRATVRETPGHTLGHVVYHFEEEKK 131

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
           + VGDT+F+LGCGR+FE + A M+ S++K+ + SD T +Y  HEYT++NA FALS DP N
Sbjct: 132 VFVGDTMFALGCGRLFEGTPAMMWASMQKLLAMSDDTQVYCAHEYTQSNAKFALSVDPTN 191

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
             L+    ++ ++R++   T P+TI LE+  NPF R
Sbjct: 192 EALRARAREIDALRAKGEPTVPTTIGLERLTNPFCR 227


>gi|113477245|ref|YP_723306.1| hydroxyacylglutathione hydrolase [Trichodesmium erythraeum IMS101]
 gi|122964586|sp|Q10Y41|GLO2_TRIEI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110168293|gb|ABG52833.1| Hydroxyacylglutathione hydrolase [Trichodesmium erythraeum IMS101]
          Length = 257

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 142/248 (57%), Gaps = 8/248 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+    + A +D  +   +   L   G  L  IFNTHHH DH  AN  L +KF
Sbjct: 11  DNYIFLLHDPNQNIGAVVDPAEVRPVIDKLESLGAELVTIFNTHHHFDHVGANKQLIQKF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF--- 128
               ++G +E+  +IPG    L +GD   F     +++  PGHTIGHI Y+F +  F   
Sbjct: 71  PQLKVYGGVEDRGRIPGQQVFLQEGDRVHFADRVGEVLFVPGHTIGHIAYYFPSVAFGET 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF+ GCGR+FE + A+M +SL K+++  D T I+  HEYT  N  FA++ D 
Sbjct: 131 GELFCGDTLFAGGCGRLFEGTPAQMVDSLNKLRNLPDNTRIWCAHEYTLKNLQFAITVDK 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ   ++VK+ R +N  T PS I +EK+ NPFLR E  +L+  L +++   +  F 
Sbjct: 191 DNTDLQSRWAEVKTARGRNEATVPSMIGVEKRTNPFLRWEQPALQ--LAVQSQDPVQTFA 248

Query: 247 ELRIRKNQ 254
            LR RK++
Sbjct: 249 RLRGRKDR 256


>gi|284050643|ref|ZP_06380853.1| hydroxyacylglutathione hydrolase [Arthrospira platensis str.
           Paraca]
 gi|291568347|dbj|BAI90619.1| putative glyoxalase II [Arthrospira platensis NIES-39]
          Length = 256

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 137/248 (55%), Gaps = 9/248 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH   N  L+K F
Sbjct: 11  DNYIFLLHDPEQNQAAVVDPAEADPVLAKLSELGAELIAIFNTHHHADHVGGNRELRKHF 70

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-----ND 126
            N T++G  E+  +IPG +  L +GD  +FG     +   PGHT GHI Y+F        
Sbjct: 71  PNLTVYGGAEDRDRIPGQEVFLKEGDRVEFGGRKADVFFVPGHTRGHIAYYFPATDKEGG 130

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
              C GDTLF+ GCGR+FE + ++M  SL K++S  D T I+  HEYT NN  FAL+ D 
Sbjct: 131 ELFC-GDTLFAGGCGRLFEGTPSQMVSSLSKLRSLPDDTRIWCAHEYTLNNLKFALTVDG 189

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N+ L+    KV   RSQN  T PS I +EK  NPFLR +  +L+  L ++   ++  F 
Sbjct: 190 DNISLRDRLEKVTIARSQNQPTIPSLIGVEKATNPFLRWDEPALK--LAVQGKDDIQTFA 247

Query: 247 ELRIRKNQ 254
            +R  K+Q
Sbjct: 248 RIRGMKDQ 255


>gi|140220|sp|P05446|GLO2_RHOBL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|45973|emb|CAA77309.1| URF 3 [Rhodobacter blasticus]
          Length = 255

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 130/248 (52%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DNF  L+H+     TA +DAP+   +   L  +GW LT I  THHH DH +A 
Sbjct: 6   LTVPCLKDNFAFLLHDAASGRTALVDAPEAAPVLSALAAQGWRLTDILLTHHHDDHIQAV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +       + G   ++ ++P +DH L +GD    G+    +I  PGHT GHI +HF  
Sbjct: 66  PEIHAATGARVHGAAADAHRLPPLDHALREGDRVAIGAESAVVIDVPGHTRGHIAFHFPG 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L + GCGR+FE + AEM+ SL K+ +   +T I  GH+Y + N  FAL+ +
Sbjct: 126 SALAFTGDSLMAAGCGRLFEGTPAEMWASLSKLAALPPETLICSGHDYLDGNLRFALALE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++  MR +     P T++ E   NPFLR     ++  + +  AS+  VF
Sbjct: 186 PGNPALISRQGRLSEMRREGRLPMPWTLAEELATNPFLRAPLPQMKAAVGLPQASDTVVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRARKD 253


>gi|85708922|ref|ZP_01039988.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp. NAP1]
 gi|85690456|gb|EAQ30459.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp. NAP1]
          Length = 251

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 135/241 (56%), Gaps = 3/241 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+HN     TAAID PD     +    KGW +THI+NTH H DH   N+ + +  
Sbjct: 12  DNYGFLLHNSVTDETAAIDTPDAKEYLRQAEAKGWTITHIWNTHWHPDHAGGNVEIVEKT 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +E  K+  ID  ++ GDT + G H   +I   GHT GHI YH + +    VG
Sbjct: 72  GARVLAP-KEVEKLSPIDRVVAHGDTVNLGEHRADVIDVSGHTNGHIAYHVVEEGMAFVG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D++F+LGCGR+FE    + + SLE+IK  S  T +Y  HEYT+ NA FAL  DP N  LQ
Sbjct: 131 DSVFALGCGRMFEGEPEQFWRSLERIKRLSTGTVLYCAHEYTQANAKFALHADPDNEALQ 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +Y  ++   R++  +T P+ +  E + NPFLR ++ +L +     NA +   F  LR  K
Sbjct: 191 EYAREIDEKRARGEWTIPTVLKRELETNPFLRADDPALMERWGG-NAPH-ETFAALRAAK 248

Query: 253 N 253
           +
Sbjct: 249 D 249


>gi|209525558|ref|ZP_03274097.1| hydroxyacylglutathione hydrolase [Arthrospira maxima CS-328]
 gi|209494057|gb|EDZ94373.1| hydroxyacylglutathione hydrolase [Arthrospira maxima CS-328]
          Length = 256

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 137/248 (55%), Gaps = 9/248 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH   N  L+K F
Sbjct: 11  DNYIFLLHDPEQNQAAVVDPAEADPVLAKLSELGAELIAIFNTHHHADHVGGNRELRKHF 70

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-----ND 126
            N T++G  E+  +IPG +  L +GD  +FG     +   PGHT GHI Y+F        
Sbjct: 71  PNLTVYGGAEDRDRIPGQEVFLKEGDRVEFGGRKADVFFVPGHTRGHIAYYFPATDKEGG 130

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
              C GDTLF+ GCGR+FE + ++M  SL K++S  D T I+  HEYT NN  FAL+ D 
Sbjct: 131 ELFC-GDTLFAGGCGRLFEGTPSQMVSSLSKLRSLPDDTRIWCAHEYTLNNLKFALTVDG 189

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N+ L+    KV   RSQN  T PS I +EK  NPFLR +  +L+  L ++   ++  F 
Sbjct: 190 DNINLRDRLEKVTIARSQNQPTIPSLIGVEKATNPFLRWDEPALQ--LAVQGKDDIQTFA 247

Query: 247 ELRIRKNQ 254
            +R  K+Q
Sbjct: 248 RIRGMKDQ 255


>gi|144898750|emb|CAM75614.1| Zn-dependent hydrolases, including glyoxylases [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 255

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 139/247 (56%), Gaps = 3/247 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I++  DN+  L H  +   TA ID      +  +L  KGW LTHI NTHHH DHT  NL 
Sbjct: 9   IAVLSDNYIYLAHEPESGATAVIDPALAAPVLAVLAAKGWRLTHILNTHHHGDHTGGNLE 68

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK      + G  +++ +IPGID  + +G++F  G     ++ TPGHT GHI + F + H
Sbjct: 69  LKAATGAQVVGARKDALRIPGIDIEVGEGESFLLGHAAAMVMETPGHTSGHIAFWFPDSH 128

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE +  EM+ SL +++     T +Y  HEYT  N  FA   +  
Sbjct: 129 ALFCGDTLFSLGCGRMFEGTPTEMWHSLARLRDLPGDTLVYCAHEYTAGNGRFARLVERD 188

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFT 246
           N  +     +V  +  +   + PST++ E+  NPFLR +  ++ + + M+  ++ + VF 
Sbjct: 189 NPAMLARVDEVARLAGRP--SVPSTLTQERAANPFLRADVPAVARAVGMDAGTDPILVFA 246

Query: 247 ELRIRKN 253
           ELR RK+
Sbjct: 247 ELRRRKD 253


>gi|254455862|ref|ZP_05069291.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082864|gb|EDZ60290.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 239

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 136/246 (55%), Gaps = 14/246 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  LI +   +    +D  +   I   L+ K   L +I NTHHH DH   N +
Sbjct: 6   IPCLKDNYSYLIIDDSNKSACVVDPSEAEPIINYLKNKDINLKYILNTHHHFDHIGGNED 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LKK F+  + G  ++S +IPGID  L DG  ++  +   KII  PGHT GHIC++F  + 
Sbjct: 66  LKKEFSSIVVGFKKDSERIPGIDIFLEDGQIWEADNFKAKIIHVPGHTTGHICFNFFQEK 125

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
               GDTLFSLGCGRIFE +Y +M+ESL KIKS   +T IY GHEYT +N+ F +  DP 
Sbjct: 126 LAFTGDTLFSLGCGRIFEGTYEQMYESLNKIKSLPKETKIYCGHEYTLSNSKFCMENDPD 185

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  LQK   ++K + S  L T P+TI  E   N FLR              A NL  F++
Sbjct: 186 NQNLQKKIEQIKKLTSNGLPTIPTTIKEELDCNIFLR--------------AKNLESFSK 231

Query: 248 LRIRKN 253
           LR  K+
Sbjct: 232 LRDLKD 237


>gi|94496106|ref|ZP_01302684.1| Zn-dependent hydrolase [Sphingomonas sp. SKA58]
 gi|94424285|gb|EAT09308.1| Zn-dependent hydrolase [Sphingomonas sp. SKA58]
          Length = 243

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 125/221 (56%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+H+     T  ID      + +  + +GW +  I+NTH H DHT  N  
Sbjct: 10  IPALSDNYIWLMHDSASGDTVVIDPAVADPVLEAAQARGWRIGQIWNTHWHGDHTGGNAA 69

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           +K    CT+ GP  E+ +I  +D  + +GD    G H  +++A P HT GHI YH  +D 
Sbjct: 70  IKAATGCTVTGPAAEAERIDMLDRLVGEGDNVRIGDHIAQVMAMPAHTAGHITYHLSDDR 129

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
              VGDTLF++GCGR+FE + A+MF +++++ +  D T IY  HEYT  N  FAL  +P 
Sbjct: 130 MAFVGDTLFAMGCGRLFEGTAAQMFANMQRLAALPDDTQIYCAHEYTLANGRFALGVEPD 189

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
           N+ L++    V++ R++   T P++I  E++ N F+R  + 
Sbjct: 190 NVALKQRMEAVEAARARGEPTVPTSIGAERETNIFMRARDA 230


>gi|222641920|gb|EEE70052.1| hypothetical protein OsJ_30016 [Oryza sativa Japonica Group]
          Length = 864

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 85/213 (39%), Positives = 128/213 (60%), Gaps = 5/213 (2%)

Query: 1   MTSLNIAISL-----YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNT 55
           MTS++ ++ +       DN+  ++H+        +D  +   I   L ++   LT+I NT
Sbjct: 76  MTSVSSSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNT 135

Query: 56  HHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           HHH DHT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT
Sbjct: 136 HHHYDHTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHT 195

Query: 116 IGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            GH+CYHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT 
Sbjct: 196 SGHVCYHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTL 255

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT 208
           +N+ FALS +P N +LQ+Y +    +R +N  T
Sbjct: 256 SNSKFALSIEPGNKDLQEYAANAADLRKRNTPT 288


>gi|114769423|ref|ZP_01447049.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [alpha proteobacterium HTCC2255]
 gi|114550340|gb|EAU53221.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [alpha proteobacterium HTCC2255]
          Length = 255

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 135/241 (56%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  LI   +   TA ID PD Y I  M+ E GW L  I  THHH DH      L+K  
Sbjct: 13  DNYAYLIRCEETGHTAVIDVPDAYPILNMINELGWKLNSILITHHHSDHVDGVEQLQKLT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +S ++P ++  +S GD    G+   +I+ TPGHTIGHI Y F +   +  G
Sbjct: 73  GANVIGAKSDSHRLPNLNISVSTGDVISIGNQQAEILNTPGHTIGHISYFFKDSKKVFTG 132

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D+L SLGCGR+FE ++  M+ +L+       +T +Y GHEY+ +NA FALS D  N  L+
Sbjct: 133 DSLMSLGCGRLFEGTHKMMWNTLKLFMKLPKETLVYSGHEYSYSNAKFALSVDSSNTRLK 192

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
           +Y  +++ +   N YT P+++ LE  +NPFLR      +  L+M   ++  VF  LRI K
Sbjct: 193 EYYKEIQDLLKDNKYTVPTSLELEFAINPFLRSALPEFKLGLDMCQKTDHEVFQYLRILK 252

Query: 253 N 253
           +
Sbjct: 253 D 253


>gi|126734141|ref|ZP_01749888.1| Hydroxyacylglutathione hydrolase [Roseobacter sp. CCS2]
 gi|126717007|gb|EBA13871.1| Hydroxyacylglutathione hydrolase [Roseobacter sp. CCS2]
          Length = 257

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 139/249 (55%), Gaps = 2/249 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LIHN +   TA +DAP+   I   L  +GW LT I  THHH DH    
Sbjct: 10  VVVPCLRDNYAFLIHNAETDETALVDAPEAEPIQAELNARGWTLTDILITHHHNDHIDGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+   +  + G   ++ ++P +D  +++G+         ++    GHT+GHI +H   
Sbjct: 70  DALRG--DARVIGAEADAHRLPDLDLAVTEGNQITVCGQQTEVFDVSGHTVGHIAFHMPA 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M++SL+K+++  D T +  GHEYT  NA FA S D
Sbjct: 128 AQLVFTADSLMALGCGRLFEGTPAQMWDSLQKLRALPDDTLVCSGHEYTAANARFAASLD 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     +++  R+    T PST++ EK+ NPFLR +    +  ++M +AS + VF
Sbjct: 188 PDNSDLISRIKRIEMARAAGQLTVPSTLTEEKRTNPFLRADVPEFKAAIDMSDASAVDVF 247

Query: 246 TELRIRKNQ 254
           T  R +K++
Sbjct: 248 TYTRAQKDK 256


>gi|170747350|ref|YP_001753610.1| hydroxyacylglutathione hydrolase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653872|gb|ACB22927.1| hydroxyacylglutathione hydrolase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 258

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 129/243 (53%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI + +    AAID P+   + + L E GW LT I  TH H DH      +K+  
Sbjct: 15  DNIGVLIRDPQTGACAAIDVPEAGPVLRALNETGWRLTDILVTHRHGDHVEGIPEVKRAT 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +P +D  + +GDT   G    ++  TPGH   H+ Y F     +C G
Sbjct: 75  GARVVAPAKAGDAVPQVDVTVREGDTVTVGRLEAQVWETPGHCADHVTYWFAQAGLVCAG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +     D T ++ GH+Y  +NA FAL+ DP N +L+
Sbjct: 135 DTLFTLGCGRVMESPPQTLYRSLRRFDDLPDATQVFSGHDYVLSNARFALAADPDNPDLR 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL-AVFTELRIR 251
              ++ +  +++  +  PST+  E+  NPFLR    +L K++++   S+  AVF  LR  
Sbjct: 195 ARLAEAERAQAEGRFLIPSTMGAERATNPFLRSGQPALAKSVDLPPQSDPEAVFVALRAW 254

Query: 252 KNQ 254
           KN+
Sbjct: 255 KNR 257


>gi|259415874|ref|ZP_05739794.1| hydroxyacylglutathione hydrolase [Silicibacter sp. TrichCH4B]
 gi|259347313|gb|EEW59090.1| hydroxyacylglutathione hydrolase [Silicibacter sp. TrichCH4B]
          Length = 271

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 139/253 (54%), Gaps = 6/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L++       A IDAP+   I   L  +GW L  I  THHH DH  A 
Sbjct: 20  VTVPCLADNYAYLVNGPDG--VAVIDAPEAAPIIAALEARGWSLGVIMITHHHHDHVGAI 77

Query: 66  LNLKKFFNCTIFGPLEESSKIPG----IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             L+  + C + GP  E+ KI      +D GL  G     G+   ++IA PGHT+GHI +
Sbjct: 78  NALRDKYGCPVMGPKAEADKIAAQGAPLDMGLEPGFEGGTGAGRCQVIAVPGHTLGHIAF 137

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           ++     L   D+L  +GCGR+FE + A M++++  + + SD T ++ GHEYTE+NA FA
Sbjct: 138 YYPEGPALFSADSLMVMGCGRLFEGTPAMMWQTMTTLAALSDDTLVFSGHEYTESNARFA 197

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           LS DP N  LQK   ++   R  +L T P+ + LEK  NPFLR  +  L+K+L +E   +
Sbjct: 198 LSIDPDNAALQKRAREISQARKSDLPTVPARLELEKATNPFLRAGDADLKKSLGLEGVED 257

Query: 242 LAVFTELRIRKNQ 254
             VF  +R  K++
Sbjct: 258 AEVFAHIRAAKDR 270


>gi|163793799|ref|ZP_02187773.1| metallo-beta-lactamase family protein [alpha proteobacterium
           BAL199]
 gi|159180910|gb|EDP65427.1| metallo-beta-lactamase family protein [alpha proteobacterium
           BAL199]
          Length = 256

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 145/254 (57%), Gaps = 1/254 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L I  +    DN+  L+H+     TA +D  +   +   L  +GW LT I NTHHH 
Sbjct: 1   MAALEIVLVPALSDNYVYLLHDAGTGATAVVDPGEAPPVEAALAARGWTLTQIVNTHHHH 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  LK  +   + GP  ES++I G+D  + DGDT     H   +  TPGHT GH+
Sbjct: 61  DHTDGNDALKAKYGVPLVGPRAESARIAGMDVMVGDGDTVQVAGHSAIVYETPGHTTGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +H  +   L  GDTLF+LGCGR+FE +  + ++SL  +++    T IY GHEYT++NA 
Sbjct: 121 SFHIPDSQALFCGDTLFALGCGRMFEGTPTQFWKSLSTLRALPSNTKIYCGHEYTQSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA+S D  N +L+   +++  +R+    T PS ++ E   NPFLR ++ ++   + M  A
Sbjct: 181 FAVSVDGGNAKLKARAAEIDRLRAAKQPTVPSILADEFDTNPFLRADDPAMAAAVGMAGA 240

Query: 240 SNLAVFTELRIRKN 253
             +AVF E+R RK+
Sbjct: 241 DPIAVFAEIRKRKD 254


>gi|75906553|ref|YP_320849.1| beta-lactamase-like protein [Anabaena variabilis ATCC 29413]
 gi|123610796|sp|Q3MGD2|GLO2_ANAVT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|75700278|gb|ABA19954.1| Beta-lactamase-like protein [Anabaena variabilis ATCC 29413]
          Length = 257

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 138/258 (53%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  L+H+ +  + A +D  +   + K L +    L  IFNTHHH DH   N
Sbjct: 4   IRLAALSDNYIFLLHDSQKNIAAVVDPAEAEPVLKQLAQLNAELVAIFNTHHHNDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
             L + F    ++G  E+  +IPG    L  GD   F     ++I  PGHT  HI Y+F 
Sbjct: 64  QQLIQNFPQLKVYGGAEDKGRIPGQQVFLQPGDRVQFTDRVAEVIFVPGHTRAHIAYYFP 123

Query: 124 -----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE + A+M ESL K++S  + T ++  HEYT  N 
Sbjct: 124 PQTADTPGELFC-GDTLFAGGCGRLFEGTPAQMVESLTKLRSLPENTRVWCAHEYTLKNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FALS D  N ELQK   +VK+ RSQ + T PS + +EK  NPFLR E  SL+  +N   
Sbjct: 183 QFALSVDSENTELQKRFDEVKTKRSQGIATVPSLLGVEKLTNPFLRWEQPSLQSAVN--- 239

Query: 239 ASNLAVFTELRIRKNQSK 256
            SN  V T  RIR  + K
Sbjct: 240 -SNDPVQTFARIRGLKDK 256


>gi|167644350|ref|YP_001682013.1| hydroxyacylglutathione hydrolase [Caulobacter sp. K31]
 gi|167346780|gb|ABZ69515.1| hydroxyacylglutathione hydrolase [Caulobacter sp. K31]
          Length = 248

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 132/244 (54%), Gaps = 9/244 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ +     TA ID PD   I   L++ GW L  I NTH H DH   N  ++   
Sbjct: 13  DNYGFLVRDDATGTTATIDTPDADAILAELKKLGWKLDLILNTHWHPDHAGGNAAIQAAT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             TI GP +E S+I  +D  +   DT   G   + +I T GHT+GHI YH   DH   VG
Sbjct: 73  GATIVGP-QEVSRIAPLDRPVVQDDTVMLGETALSVIDTGGHTLGHIAYHDAADHIAFVG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +  +M+ SL K+ +  D T +Y  HEYT +NA FALS D  +  L+
Sbjct: 132 DTLFALGCGRLFEGTAEQMWGSLSKLTALPDDTTVYCAHEYTASNARFALSVD-QDPALK 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
              + V + R +   T P+TI LEK  NPFLR     LR +L    A     F E+R  K
Sbjct: 191 SRANAVFAARERGEATVPTTIGLEKATNPFLRAP--LLRPHLPPAEA-----FGEIRAAK 243

Query: 253 NQSK 256
           +  K
Sbjct: 244 DSFK 247


>gi|17228076|ref|NP_484624.1| hypothetical protein all0580 [Nostoc sp. PCC 7120]
 gi|81773021|sp|Q8YZ99|GLO2_ANASP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|17129925|dbj|BAB72538.1| all0580 [Nostoc sp. PCC 7120]
          Length = 257

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 138/258 (53%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  L+H+    + A +D  +   + K L +    L  IFNTHHH DH   N
Sbjct: 4   IRLAALSDNYIFLLHDSHKNIAAVVDPAEAEPVLKQLAQLKAELVAIFNTHHHNDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
             L +KF    ++G  ++  +IPG    L  GD   F     ++I  PGHT  HI Y+F 
Sbjct: 64  QKLIQKFPQVKVYGGAKDQGRIPGQQVFLQPGDRVQFADRVAEVIFVPGHTRAHIAYYFP 123

Query: 124 -----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE + A+M ESL K++S  + T ++  HEYT  N 
Sbjct: 124 PQTDDTPGELFC-GDTLFAGGCGRLFEGTPAQMVESLTKLRSLPENTRVWCAHEYTLKNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FALS D  N ELQK   +VK+ RSQ + T PS + +EK  NPFLR E  SL+  +N   
Sbjct: 183 QFALSVDSKNTELQKRLDEVKTKRSQGIATVPSLLGVEKLTNPFLRWEQPSLQLAVN--- 239

Query: 239 ASNLAVFTELRIRKNQSK 256
            SN  V T  RIR  + K
Sbjct: 240 -SNDPVQTFARIRGLKDK 256


>gi|114776985|ref|ZP_01452005.1| Hydroxyacylglutathione hydrolase [Mariprofundus ferrooxydans PV-1]
 gi|114552506|gb|EAU54966.1| Hydroxyacylglutathione hydrolase [Mariprofundus ferrooxydans PV-1]
          Length = 262

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 135/249 (54%), Gaps = 5/249 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  LI  H       ID  +   + +  RE G  LTHIFNTHHH DHT  N +
Sbjct: 14  LPVLKDNYIYLIEAHASSALIVIDPAEAVSVRRACRELGKPLTHIFNTHHHWDHTDGNQS 73

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LKK F   + G   ++ +IPGI+  +S+          I+++   GHT GHI Y  ++D 
Sbjct: 74  LKKDFGAVVIGAAHDAERIPGINLKVSEASPPLVDGLNIRVLDVAGHTRGHIAY-LLDDA 132

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
             C GDTLF  GCGR+FE + A+M++SL+KI      T IY  HEYT  N  FA+  DP 
Sbjct: 133 LFC-GDTLFGAGCGRLFEGTPAQMWQSLQKIAQLDGNTRIYCAHEYTLANLAFAVMVDPE 191

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA---SNLAV 244
           N  L++  ++    R Q++ T PSTI +EK  NPFLR  + +         A     LAV
Sbjct: 192 NSTLKERLARDSEKRQQDIPTIPSTIEIEKATNPFLRPLDAAFLSAYAAGKAVKPEALAV 251

Query: 245 FTELRIRKN 253
           FT +R +K+
Sbjct: 252 FTHIRQQKD 260


>gi|225433994|ref|XP_002271863.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
          Length = 321

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 135/234 (57%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH DHT  N  
Sbjct: 73  VPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHDHTGGNAE 132

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +   + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI ++F    
Sbjct: 133 LKARYGAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHISFYFPGSG 192

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ FALS +P 
Sbjct: 193 AIFTGDTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKFALSIEPK 252

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +   ++
Sbjct: 253 NEVLQSYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATAD 306


>gi|225433992|ref|XP_002271795.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
          Length = 329

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 140/246 (56%), Gaps = 4/246 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH DHT  N  
Sbjct: 81  VPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHDHTGGNAE 140

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +   + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI ++F    
Sbjct: 141 LKARYGAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHISFYFPGSG 200

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ FALS +P 
Sbjct: 201 AIFTGDTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKFALSIEPK 260

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASNLA 243
           N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +    +++  L 
Sbjct: 261 NEVLQSYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATADDSEALG 320

Query: 244 VFTELR 249
           +  E +
Sbjct: 321 IIREAK 326


>gi|297743843|emb|CBI36726.3| unnamed protein product [Vitis vinifera]
          Length = 300

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 134/229 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+        +D  +   +   L  K   LT+I NTHHH DHT  N  LK  +
Sbjct: 57  DNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHDHTGGNAELKARY 116

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI ++F     +  G
Sbjct: 117 GAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHISFYFPGSGAIFTG 176

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ FALS +P N  LQ
Sbjct: 177 DTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKFALSIEPKNEVLQ 236

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +   ++
Sbjct: 237 SYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATAD 285


>gi|188581690|ref|YP_001925135.1| hydroxyacylglutathione hydrolase [Methylobacterium populi BJ001]
 gi|179345188|gb|ACB80600.1| hydroxyacylglutathione hydrolase [Methylobacterium populi BJ001]
          Length = 259

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 129/243 (53%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   +   L  +GW LT I  TH H DH      + +  
Sbjct: 16  DNIGVLIRDPASGACAAIDVPEAGPVLAALDAEGWTLTDILVTHRHGDHIEGIPEVVERT 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +  + +PG    + +GDT   G    ++  TPGH   H+ YHF +      G
Sbjct: 76  GARVTAPEKARAAVPGAARYVKEGDTVTVGGLSAQVWETPGHCADHVTYHFADAGVAFAG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E   A ++ SL++  +  D T +Y GH+Y  +N  FAL+ DP N +L+
Sbjct: 136 DTLFTLGCGRVMEAEPATLWRSLKRFLALPDATAVYSGHDYVLSNGRFALAADPDNADLK 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL-AVFTELRIR 251
           +  ++ + +  +  +  PSTI  EK  NPFLR+   +L ++  +E  S+  AVFT LR  
Sbjct: 196 ERVAQAERLAQEGRFLIPSTIGEEKATNPFLRVSEPALARSAGLEPGSDPEAVFTALRAW 255

Query: 252 KNQ 254
           KN+
Sbjct: 256 KNR 258


>gi|262277919|ref|ZP_06055712.1| hydroxyacylglutathione hydrolase [alpha proteobacterium HIMB114]
 gi|262225022|gb|EEY75481.1| hydroxyacylglutathione hydrolase [alpha proteobacterium HIMB114]
          Length = 256

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 145/251 (57%), Gaps = 3/251 (1%)

Query: 6   IAISLYH---DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + ++L H   DN+  +I N   +    +D  +   +   +++ G  L +I  THHH DH 
Sbjct: 4   LQVNLVHCLSDNYSYIISNPITKKAIVVDPAEAEPVINSIKKLGLKLEYILITHHHADHV 63

Query: 63  RANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             N  LK+ +NC I G   +S +IPGID  + D + F+F    I++   PGHT GHI Y 
Sbjct: 64  GGNNELKEKYNCKIIGFKNDSRRIPGIDIQIKDKEIFNFEDEEIELNFAPGHTSGHIFYF 123

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           F  +    VGD +FSLGCGRIFE +  +M++S+ KIKS  ++T IY GHEYTE+N  F L
Sbjct: 124 FKKNKLAFVGDVVFSLGCGRIFEGTPEQMYKSVMKIKSLPEETKIYCGHEYTESNLKFCL 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + D  N  L+K   +V+ +R + L T P+TIS EKK N F R +  ++ + L ++ +   
Sbjct: 184 AYDADNHNLKKRGDEVRELRQKGLPTIPTTISDEKKNNIFFRCDENTIIEKLGLKTSEPQ 243

Query: 243 AVFTELRIRKN 253
            VF +LR  K+
Sbjct: 244 MVFKKLRELKD 254


>gi|295687841|ref|YP_003591534.1| hydroxyacylglutathione hydrolase [Caulobacter segnis ATCC 21756]
 gi|295429744|gb|ADG08916.1| hydroxyacylglutathione hydrolase [Caulobacter segnis ATCC 21756]
          Length = 249

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 129/244 (52%), Gaps = 8/244 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ +      A ID PD+  I   L   GW L  I NTH H DH   N  LK   
Sbjct: 13  DNYGFLVRDEASGQVATIDTPDSETILTALDALGWKLDLILNTHWHPDHAGGNEALKAAT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              I GP  E ++I  +D  L+DGDT   G    +++ T GHT+GH+ YH   D    VG
Sbjct: 73  GAMIAGP-SEVTRIAPVDRALTDGDTVMLGETRFEVLDTGGHTLGHVSYHAPADGIAFVG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +  +M+ SL ++ +  D+T +Y  HEYT +NA FALS D     L+
Sbjct: 132 DTLFALGCGRLFEGTPEQMWASLSRLTALPDQTTVYCAHEYTASNARFALSVD-DAPALK 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
                V + R +   T P+TI+ EK  NPFLR     LR N     AS    F E+R  K
Sbjct: 191 ARADAVFAARERGEPTVPTTIAAEKATNPFLRAP--LLRPN----AASPAEAFAEIRATK 244

Query: 253 NQSK 256
           +  K
Sbjct: 245 DSFK 248


>gi|300868557|ref|ZP_07113174.1| Hydroxyacylglutathione hydrolase [Oscillatoria sp. PCC 6506]
 gi|300333435|emb|CBN58366.1| Hydroxyacylglutathione hydrolase [Oscillatoria sp. PCC 6506]
          Length = 257

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 142/253 (56%), Gaps = 8/253 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+H+    + A +D      + + L+  G  LT IFNTHHH DH   N  
Sbjct: 6   LPILSDNYIFLLHDRDRNIAAVVDPGLAQPVLQQLQALGTPLTAIFNTHHHNDHIGGNSE 65

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L ++F    ++  +++  +IPG +  L DGD   F +   +I   PGHT  HI Y+F  +
Sbjct: 66  LLQRFPYAKVYAGIKDRGRIPGAEVFLEDGDRVSFAAQTAQIFFVPGHTKAHIAYYFPPN 125

Query: 127 HF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           H      L  GDTLF+ GCGR+ E +  +M  SL K+++  D T ++  HEYT  N  FA
Sbjct: 126 HPKENGELFCGDTLFAGGCGRVSESTPDQMLASLNKLRALPDNTRVWCAHEYTLKNLQFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP N +LQ   +KVK+ R+++  T PSTI+LEK  NPFLR +  +L+   N ++ + 
Sbjct: 186 LTVDPDNPDLQHRFAKVKAARNRSEATIPSTIALEKNTNPFLRCDRPNLQSATNSKDPT- 244

Query: 242 LAVFTELRIRKNQ 254
              FT LR  K+Q
Sbjct: 245 -LTFTRLRRMKDQ 256


>gi|146278242|ref|YP_001168401.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17025]
 gi|160395513|sp|A4WUN2|GLO2_RHOS5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145556483|gb|ABP71096.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 255

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 132/248 (53%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H+     TA +D P+   +   L E+ W LT I  THHH DH    
Sbjct: 6   VTVPCLSDNYAFLVHDAASGETAVVDVPEAGPVMAALAERNWRLTQILLTHHHGDHVAGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     + G   ++ ++P +D  L++GD    GS    ++  PGHT+GHI +HF +
Sbjct: 66  AALREATGARVAGAAADAHRLPPLDLALAEGDRVRIGSEDGTVLEVPGHTVGHIAFHFAD 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L ++GCGR+FE +   M++SL K+ +    T I  GHEYT+ NA FA + +
Sbjct: 126 SGLAFTGDSLMAMGCGRLFEGTPRMMWQSLRKLSALPADTLICSGHEYTQANARFACTLE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L      + + R +   T PS +S E   NPFLR    +L+  + M +A +  VF
Sbjct: 186 PENPVLIFRVGSIAAARKEGRPTVPSQLSDEIATNPFLRAGEAALKAAVGMADAEDAEVF 245

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 246 AEIRRRKD 253


>gi|119510457|ref|ZP_01629590.1| Beta-lactamase-like protein [Nodularia spumigena CCY9414]
 gi|119464879|gb|EAW45783.1| Beta-lactamase-like protein [Nodularia spumigena CCY9414]
          Length = 257

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 137/256 (53%), Gaps = 10/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+H+ +  + A +D  +   + K L E    L  IFNTHHH DH   N
Sbjct: 4   IRLEALSDNYIFLLHDEEQNIAAVVDPAEAEPVLKKLAELQAELVAIFNTHHHNDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
             L + F N T++G  E+  +IPG    L  GD   FG    ++   PGHT  HI Y+F 
Sbjct: 64  KKLIQDFPNLTVYGGAEDRGRIPGQQVFLQQGDRIQFGDRTAEVFFIPGHTRAHIAYYFF 123

Query: 124 -----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE +  +M ESL K++S  D T ++  HEYT  N 
Sbjct: 124 PVTSDQTGELFC-GDTLFAGGCGRLFEGTPTQMVESLGKLRSLPDHTRVWCAHEYTLKNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL+ D  N ELQ+   +VK+ RS+   T PS + +EK  NPFLR E  SL+  L  ++
Sbjct: 183 QFALTVDSENTELQRRYEEVKNYRSRQEATVPSFLGVEKLTNPFLRWEQPSLQ--LVTKS 240

Query: 239 ASNLAVFTELRIRKNQ 254
           +  +  F  LR  K++
Sbjct: 241 SDPIQTFARLRGMKDR 256


>gi|218441771|ref|YP_002380100.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7424]
 gi|226723986|sp|B7KEB4|GLO2_CYAP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218174499|gb|ACK73232.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7424]
          Length = 257

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 141/248 (56%), Gaps = 10/248 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+ +  + A +D  +   +   L++ G  L  IFNTHHH DH  AN  L + F
Sbjct: 11  DNYIFLLHDPQRNIAAVVDPAEPEPVLTCLKKLGAELVTIFNTHHHGDHVGANRALIEHF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM------N 125
            N T++G  E+  +IPG +  L +GD   FG    ++   PGHT  HI Y+F        
Sbjct: 71  PNLTVYGGEEDRGRIPGQEVFLKEGDRVQFGDRSGEVFFVPGHTRAHIAYYFPPQGEEET 130

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
               C GDT+F+ GCGR+FE + A+M  SL K+++  D T I+  HEYT NN  FAL+ +
Sbjct: 131 GELFC-GDTIFAGGCGRLFEGTPAQMVNSLSKLRALPDNTRIWCAHEYTLNNLKFALTVE 189

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N++LQ   S VK  RS+   T PS + +EK  NPFLR +  +++  +  +++  + VF
Sbjct: 190 PENIDLQNRFSDVKIARSEGEATVPSLLGIEKLTNPFLRWDTQAIKSAMGSQDS--VQVF 247

Query: 246 TELRIRKN 253
             LR +K+
Sbjct: 248 GRLRGKKD 255


>gi|332557736|ref|ZP_08412058.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides WS8N]
 gi|332275448|gb|EGJ20763.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides WS8N]
          Length = 255

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 135/249 (54%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H+     T+ +D P+   I K L E+GW L+ I  THHH DH    
Sbjct: 6   VTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPILKALEERGWHLSQILLTHHHSDHVAGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI +HF +
Sbjct: 66  EELRAATGARVAGAAADAHRLPPLDLELAEGDPVQVGASEGRVIDVPGHTVGHIAFHFPD 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA FA + +
Sbjct: 126 SALAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARFAATLE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A +  VF
Sbjct: 186 PDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAEDAEVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRRRKDK 254


>gi|77462845|ref|YP_352349.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Rhodobacter sphaeroides 2.4.1]
 gi|221638714|ref|YP_002524976.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides KD131]
 gi|123592439|sp|Q3J436|GLO2_RHOS4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|77387263|gb|ABA78448.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Rhodobacter sphaeroides 2.4.1]
 gi|221159495|gb|ACM00475.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides KD131]
          Length = 255

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 135/249 (54%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H+     T+ +D P+   I K L E+GW L+ I  THHH DH    
Sbjct: 6   VTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPILKALEERGWHLSQILLTHHHSDHVAGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI +HF +
Sbjct: 66  EELRAATGARVAGAAADAHRLPPLDLELAEGDLVRVGASEGRVIEVPGHTVGHIAFHFPD 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA FA + +
Sbjct: 126 SSLAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARFAATLE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A +  VF
Sbjct: 186 PDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAEDAEVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRRRKDK 254


>gi|307153559|ref|YP_003888943.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7822]
 gi|306983787|gb|ADN15668.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7822]
          Length = 257

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 143/247 (57%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ +  + A +D      + + L+E G  L  IFNTHHH DH   N  L + F
Sbjct: 11  DNYIFLLHDPQENIAAVVDPAQPQPVLECLKELGASLVAIFNTHHHQDHVGGNRELMQHF 70

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-----MND 126
            + T++G  ++  +IPG    L++GD   F     ++   PGHT  HI Y+F      + 
Sbjct: 71  PDLTVYGGEQDRGRIPGQQVFLTEGDRVKFAHREAEVFFVPGHTKAHIAYYFPPTEGQDT 130

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE + A+M +S+ K+++  D T ++  HEYT NN  FAL+ +P
Sbjct: 131 GELFCGDTIFAGGCGRLFEGTPAQMVDSIGKLRALPDHTRVWCAHEYTLNNLKFALTVEP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ   S+V+  RSQ   T PS + +EK  NPFLR ++ +++  +N ++A  + VF 
Sbjct: 191 ENSDLQNRYSQVQMARSQGEATVPSLLGIEKLTNPFLRWDSPAIQSAMNSDDA--VQVFG 248

Query: 247 ELRIRKN 253
            LR +K+
Sbjct: 249 RLRGKKD 255


>gi|114762056|ref|ZP_01441524.1| hydroxyacylglutathione hydrolase, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114545080|gb|EAU48083.1| hydroxyacylglutathione hydrolase, putative [Roseovarius sp.
           HTCC2601]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 134/248 (54%), Gaps = 2/248 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          IDAP+   I + L  +GW L  +  THHH DH    
Sbjct: 4   VTVPCLSDNYAYLVKAPDG--VCLIDAPEAGPIIEALESRGWELDTLLITHHHHDHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ + CT+ GP  E +K+P +D  +  GDT      P+++I  PGHT+GH+ +HF +
Sbjct: 62  AELRERYGCTVVGPKAEEAKLPPLDTAVDGGDTLQVAGTPVEVIFVPGHTLGHVAFHFPD 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGRIFE +   M+ESL K+ +   +T +  GHEYT  NA FAL+ +
Sbjct: 122 AQAVFTADSLMALGCGRIFEGTPDMMWESLSKLIALPPETLVCSGHEYTSANARFALTIE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+     +   R++   T    +S E   NPFLR  +  +R  L M +A + AVF
Sbjct: 182 PGNEALKLRSDAIAKARTEGRATATCKLSEELATNPFLRPASPEIRDRLGMNDAPDAAVF 241

Query: 246 TELRIRKN 253
            E+R RK+
Sbjct: 242 AEVRARKD 249


>gi|126461738|ref|YP_001042852.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17029]
 gi|160395512|sp|A3PIB4|GLO2_RHOS1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|126103402|gb|ABN76080.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 255

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 135/249 (54%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H+     T+ +D P+   + K L E+GW L+ I  THHH DH    
Sbjct: 6   VTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPVLKALEERGWHLSQILLTHHHSDHVAGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI +HF +
Sbjct: 66  EELRAATGARVAGAAADAHRLPPLDLELAEGDLVRVGASEGRVIEVPGHTVGHIAFHFPD 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA FA + +
Sbjct: 126 SSLAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARFAATLE 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A +  VF
Sbjct: 186 PDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAEDAEVF 245

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 246 AEIRRRKDK 254


>gi|329114359|ref|ZP_08243121.1| Hydroxyacylglutathione hydrolase [Acetobacter pomorum DM001]
 gi|326696435|gb|EGE48114.1| Hydroxyacylglutathione hydrolase [Acetobacter pomorum DM001]
          Length = 273

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 137/232 (59%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI +  DN+   + + +   TA ID  +   I   + ++G  L  I  THHH DHT    
Sbjct: 39  AIPVLSDNYAWFLRDTETGTTAVIDPGEAAPIVNFIEKEGGRLDLILLTHHHHDHTGGAE 98

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ ++  + GP  E  ++P +D  L D D+   G+    +IA PGHT+GHIC++F N 
Sbjct: 99  ALRQRYHARVAGPAAEQQRMPPLDIALHDQDSLAVGACTSTVIAVPGHTLGHICFYFPNP 158

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE + A+MFESL K+ +  D T +Y GHEYT+ N+ FAL  +P
Sbjct: 159 PSLFCGDTLFSLGCGRLFEGTAAQMFESLHKLDALPDATRVYCGHEYTQGNSAFALHAEP 218

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            N  L++  ++V+ +R++N  T PST+ +E+  NPFLR +N      L  E 
Sbjct: 219 QNAALKERVAEVRRLRAENKPTVPSTLEMERATNPFLRAKNVQTFAQLRREK 270


>gi|170740305|ref|YP_001768960.1| hydroxyacylglutathione hydrolase [Methylobacterium sp. 4-46]
 gi|254798848|sp|B0UBD0|GLO2_METS4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|168194579|gb|ACA16526.1| hydroxyacylglutathione hydrolase [Methylobacterium sp. 4-46]
          Length = 255

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 123/243 (50%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   + ++L E GW LT I  TH H DH      +K   
Sbjct: 12  DNIGVLIRDPATGACAAIDVPEAGAVLRVLGETGWSLTDILVTHRHFDHVEGTPEVKART 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +P +D  + +GD    GS    +  TPGH   H+ Y F  +     G
Sbjct: 72  GARVTAPAKAGDAVPEVDATVREGDAVRLGSLVAAVWETPGHCADHVTYWFERERIAFAG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +  +  D+T IY GH+Y  +NA FAL+ DP N  L+
Sbjct: 132 DTLFTLGCGRVMESPPEVLWRSLSRFLALPDETAIYSGHDYVLSNARFALAADPDNPNLK 191

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFTELRIR 251
                 + ++    +  P+T+  EK  NPFLR    +L + + M   S+  AVFT LR  
Sbjct: 192 ARAELAERVKRDGRFLIPTTLGEEKATNPFLRATEPALARAVGMAPGSDPAAVFTALREW 251

Query: 252 KNQ 254
           KN+
Sbjct: 252 KNR 254


>gi|329890614|ref|ZP_08268957.1| hydroxyacylglutathione hydrolase [Brevundimonas diminuta ATCC
           11568]
 gi|328845915|gb|EGF95479.1| hydroxyacylglutathione hydrolase [Brevundimonas diminuta ATCC
           11568]
          Length = 243

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 123/218 (56%), Gaps = 2/218 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWF-LTHIFNTHHHIDHTRANLNLKKF 71
           DN+  LI +    L AA+D PD   +   L   GW  L  I NTH H DHT  N  L+  
Sbjct: 13  DNYGFLIRDEATGLVAAVDTPDAEAVLADLEASGWGRLDLILNTHWHADHTGGNERLQAE 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
             C I GP EE  +   +DH L DG+    G     ++ +PGHT+GH+ YH  +D    V
Sbjct: 73  TGCEIAGP-EEVRRAAPLDHVLVDGEAVRLGETTFDVVLSPGHTLGHVVYHAADDGLAFV 131

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GD +F+LGCGR+FE +  +M++SL +I ++ + T +Y  HEYT +NA FALS    +  L
Sbjct: 132 GDVIFALGCGRLFEGTPQQMWDSLNRIAAWPEATTLYCAHEYTASNARFALSLPDADEAL 191

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           + +   + + R +   + P+T+ +E++ NPFLR  + +
Sbjct: 192 KAHAEAIFAARERGEASVPTTVGIERRFNPFLRARDAA 229


>gi|299769481|ref|YP_003731507.1| hydroxyacylglutathione hydrolase [Acinetobacter sp. DR1]
 gi|298699569|gb|ADI90134.1| hydroxyacylglutathione hydrolase [Acinetobacter sp. DR1]
          Length = 243

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 126/217 (58%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
            N+  ++ + + +   A+D  +  ++++  ++    L  I+ TH H DH     +L    
Sbjct: 15  QNYIWILEDTETQEAVAVDPTEAELVTQFCQKHQLNLKQIWLTHWHKDHIGGVADLTAAQ 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N T++GP +E +KIPGI H L   D   F    ++IIATPGHT+GHI Y       +  G
Sbjct: 75  NITVYGPRDELTKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELEAVFCG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FAL+ +PHNL L 
Sbjct: 135 DTLFAMGCGRLFEGTAEQMYHSLSRLAALPTSTKVYCTHEYTLSNAEFALTVEPHNLALA 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           +   +V+ +R Q L T PSTI LE   NPFLR E+  
Sbjct: 195 ERAQEVRELRKQGLITLPSTIELELATNPFLRAESVE 231


>gi|103486177|ref|YP_615738.1| hydroxyacylglutathione hydrolase [Sphingopyxis alaskensis RB2256]
 gi|98976254|gb|ABF52405.1| Hydroxyacylglutathione hydrolase [Sphingopyxis alaskensis RB2256]
          Length = 246

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 130/234 (55%), Gaps = 5/234 (2%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L I  I +  DN+  L+H      T  +D      +    + +GW +T I+NTH H 
Sbjct: 1   MAALEIVRIPVLSDNYVWLVHEPASGATMVVDPAVADPVLDAAKARGWAITDIWNTHWHP 60

Query: 60  DHTRANLNLKK----FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DHT  N  +K+    +  CTI GP  E  +IP +D  +  GDT   G H   +   P HT
Sbjct: 61  DHTGGNAAIKEAAKAWGGCTITGPAAEHERIPTLDVLVKGGDTVRLGDHVADVWDVPAHT 120

Query: 116 IGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            GHI YHF +D  + VGDT+F++GCGR+FE +  +MF +++K+++  D T +Y  HEYT 
Sbjct: 121 AGHIAYHFADDAAIFVGDTMFAMGCGRLFEGTAEQMFANMQKLRALDDATRVYCAHEYTL 180

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           +NA FA++ DP N  L    + V++ R+    T P++I  E+  NPF R  + +
Sbjct: 181 SNARFAITVDPANEALAARLAAVEAARAAGEATVPTSIGAERATNPFFRAPDAA 234


>gi|85374329|ref|YP_458391.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter litoralis
           HTCC2594]
 gi|122544277|sp|Q2N9P7|GLO2_ERYLH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|84787412|gb|ABC63594.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter litoralis
           HTCC2594]
          Length = 251

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 127/241 (52%), Gaps = 3/241 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+     TAAID PD     K  + KGW +THI+NTH H DH   N ++ +  
Sbjct: 12  DNYGFLLHDPDSGETAAIDTPDGKEYLKQAKAKGWTITHIWNTHWHPDHAGGNKDIVEAT 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +E  K+ GID  +  GDT D G     +I   GHT GHI YH        VG
Sbjct: 72  GAKVIAP-QEVEKLSGIDRVVGHGDTVDIGDFTADVIDVSGHTNGHIAYHLPEAGIAFVG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D++F+LGCGR+FE    + ++SL +IK+   +T +Y  HEYT  NA FA+  DP N  L 
Sbjct: 131 DSVFALGCGRMFEGEPKQFWDSLSRIKALPPETMLYCAHEYTAANARFAVHADPENDALV 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
            Y  ++ + R ++  T P+ +  E   NPFLR ++ +L      +       F  LR  K
Sbjct: 191 AYVEEITAKRERDEPTVPTQLKRELATNPFLRADDPALVAKWGGDAPHE--TFAALRAGK 248

Query: 253 N 253
           +
Sbjct: 249 D 249


>gi|220920492|ref|YP_002495793.1| hydroxyacylglutathione hydrolase [Methylobacterium nodulans ORS
           2060]
 gi|254798847|sp|B8ICA2|GLO2_METNO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|219945098|gb|ACL55490.1| hydroxyacylglutathione hydrolase [Methylobacterium nodulans ORS
           2060]
          Length = 255

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 125/243 (51%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +L+H+      AAID P+   + + L+E GW LT I  TH H DH      +K   
Sbjct: 12  DNIGVLLHDPVTSACAAIDVPEAGAVLRALKETGWRLTDILVTHRHFDHVEGIPEVKART 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +P +D  + +GD    GS    +  TPGH   H+ Y F  +     G
Sbjct: 72  GARVTAPAKAGDAVPEVDATVREGDVVKVGSLVGTVWETPGHCADHVTYWFERERLAFAG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +  +  D+T IY GH+Y  +NA FAL+ DP N  L+
Sbjct: 132 DTLFTLGCGRVMESPPEVLWRSLSRFLALPDETAIYSGHDYVLSNARFALAADPDNSNLK 191

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFTELRIR 251
                 + ++    +  P+T+  EK  NPFLR    +L ++++M   S+  AVF  LR  
Sbjct: 192 ARAELAERVKRDGRFLIPTTLGEEKATNPFLRAGEPALARSVDMAPGSDPAAVFAALREW 251

Query: 252 KNQ 254
           KN+
Sbjct: 252 KNR 254


>gi|149184782|ref|ZP_01863100.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp.
           SD-21]
 gi|148832102|gb|EDL50535.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp.
           SD-21]
          Length = 251

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 127/241 (52%), Gaps = 3/241 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+     TAAID PD+    +    K W +T I+NTH H DH   N  + +  
Sbjct: 12  DNYGFLLHDPDSGETAAIDTPDSAEYLRQAEAKRWTITQIWNTHWHPDHAGGNKAIVEAT 71

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P  E  K+  ID  + +GDT   G    ++I   GHT GHI YH        VG
Sbjct: 72  GAKVVAP-HEVEKLSPIDEVVGNGDTVSLGEWKARVIDVSGHTNGHIAYHIAEADTAFVG 130

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           D++F+LGCGR+FE    + + SLE+I+   D T +Y  HEYT+ NA FAL  DP N EL+
Sbjct: 131 DSVFALGCGRMFEGKPEQFWHSLERIRQLPDNTLLYCAHEYTQANAKFALHADPDNAELR 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
            Y  +++  R+++  T P+ +S E   NPFLR ++  +R        +    F  LR  K
Sbjct: 191 LYAGRIEEKRAKDEPTVPTLLSRELVTNPFLRADDADIRDRWG--GTTPAETFAALRAAK 248

Query: 253 N 253
           +
Sbjct: 249 D 249


>gi|86605820|ref|YP_474583.1| glyoxalase II family protein [Synechococcus sp. JA-3-3Ab]
 gi|123506832|sp|Q2JVC3|GLO2_SYNJA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86554362|gb|ABC99320.1| glyoxalase II family protein [Synechococcus sp. JA-3-3Ab]
          Length = 252

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 132/250 (52%), Gaps = 3/250 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H+ +    A +D      +   L E G  L  IFNTHHH DH   N
Sbjct: 4   LQLPALRDNYIYLLHDPETATAAVVDPTVAEPVLDKLAELGAELVAIFNTHHHHDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
           L L  ++    ++G   +  +IPG    L  G+T  F     K++  PGHT GH+ Y+F 
Sbjct: 64  LQLLARYPRAVVYGSQADRGRIPGQTVELQAGETVAFAGRQAKVLFVPGHTRGHVAYYFP 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE +  +M  SL++++   + T ++  HEYT NN  FAL+ 
Sbjct: 124 ESGDLFCGDTLFAGGCGRLFEGTPEQMLGSLDQLRQLPEATRVWCAHEYTLNNLKFALTV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           D  N +LQ    +V ++R     T PSTI  E++ NPFLR +  +LR     ++   + V
Sbjct: 184 DGDNPDLQARYQQVVALRQAGSPTVPSTIGEERRTNPFLRWDQPALRAATGAQDP--VRV 241

Query: 245 FTELRIRKNQ 254
           F  LR  K+Q
Sbjct: 242 FARLRGMKDQ 251


>gi|22299182|ref|NP_682429.1| putative hydroxyacylglutathione hydrolase [Thermosynechococcus
           elongatus BP-1]
 gi|81742856|sp|Q8DIF1|GLO2_THEEB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|22295364|dbj|BAC09191.1| tll1639 [Thermosynechococcus elongatus BP-1]
          Length = 252

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 135/243 (55%), Gaps = 3/243 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK-KF 71
           DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH  AN  L+ +F
Sbjct: 11  DNYIFLLHDPQTGTAAVVDPAEPEPVLAKLAELGATLRAIFNTHHHWDHVGANCALRSRF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
            +  ++G  E+  +IP     L  GD   FG     ++  PGHT GHI Y+      L  
Sbjct: 71  PDIAVYGSSEDQGRIPEQTVFLKAGDRVPFGQTYFDVLFVPGHTRGHIAYYAPTTGDLFC 130

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF  GCGR+FE S A+M +SL +++   ++T ++  HEYT+ N  FAL+ +  N  L
Sbjct: 131 GDTLFGGGCGRLFEGSPAQMLDSLNQLRQLPEETRVWCAHEYTQKNLSFALTVEADNPTL 190

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
           Q+  ++V   R+Q   T PSTI LEK  NPFLR E  S++  + +   + L  FT LR +
Sbjct: 191 QERYAQVCRDRAQGKATIPSTIGLEKATNPFLRCEVRSIQ--IAVGATTPLQTFTRLRGK 248

Query: 252 KNQ 254
           ++Q
Sbjct: 249 RDQ 251


>gi|308805200|ref|XP_003079912.1| hydroxyacylglutathione hydrolase, putative (ISS) [Ostreococcus
           tauri]
 gi|116058369|emb|CAL53558.1| hydroxyacylglutathione hydrolase, putative (ISS) [Ostreococcus
           tauri]
          Length = 301

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 136/252 (53%), Gaps = 9/252 (3%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK--GWFL-THIFNTHHHIDHTRANLNL 68
            DN+   I   +   TA +DAP    + +  + +   W   + I  TH H DH      L
Sbjct: 49  RDNYGFAIRCAETGETAIVDAPSVADVVRAFKSEIPTWRAPSTILVTHWHDDHAGGCDGL 108

Query: 69  KKFFNCT----IFGPLEESSKIPG-IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF 123
           +  F       +  P  E  KI   +D  +SDGD    G     ++ TPGHT+GH  YHF
Sbjct: 109 RDAFGSVSDIKVIAPKREMGKISARVDRWVSDGDVVSVGDLRATVLETPGHTLGHAIYHF 168

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +D  + VGDTLF+LGCGR+FE +  +M+ S+ KI + SD+T ++  HEYT+ NA FALS
Sbjct: 169 ADDGHVFVGDTLFALGCGRLFEGTPEQMWSSVSKILAMSDETKVWCAHEYTQANAKFALS 228

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            DP N  L     ++ + R +   T P+T+  E++ NPF R ++  +++ +NM   +NLA
Sbjct: 229 VDPENAALVARAKEIAAQRERGESTIPTTVGDERRTNPFCRPDSEDVQRGVNMLRGANLA 288

Query: 244 -VFTELRIRKNQ 254
            VF  +R  K++
Sbjct: 289 SVFGAIRAAKDK 300


>gi|46203965|ref|ZP_00050697.2| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 259

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 122/243 (50%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   +   L  +GW LT I  TH H DH      + +  
Sbjct: 16  DNIGVLIRDPASGACAAIDVPEAEAVLAALDAEGWRLTEILVTHRHADHIEGIPEVVERT 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +  + +PG    +S+GDT   G     +  TPGH   H+ YHF +   +  G
Sbjct: 76  GARVTAPDKARAAVPGAARYVSEGDTVTVGGLTATVWETPGHCADHVTYHFADAGVVFAG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +     D T +Y GH+Y  +N  FAL+ DP N  L+
Sbjct: 136 DTLFTLGCGRVMEAEPETLWRSLTRFLDLPDTTEVYSGHDYVLSNGRFALAADPDNAALK 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NASNLAVFTELRIR 251
           +  ++ + +     +  PSTI  EK  NPFLR    +L ++   E  A   AVFT LR  
Sbjct: 196 QRVAEAERLAETGGFLIPSTIGAEKATNPFLRAGEPALARSAGSEPGADPAAVFTALRSW 255

Query: 252 KNQ 254
           KN+
Sbjct: 256 KNR 258


>gi|186683109|ref|YP_001866305.1| beta-lactamase domain-containing protein [Nostoc punctiforme PCC
           73102]
 gi|226724003|sp|B2IVH7|GLO2_NOSP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|186465561|gb|ACC81362.1| beta-lactamase domain protein [Nostoc punctiforme PCC 73102]
          Length = 257

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 137/254 (53%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+++ K  + A +D  +   + K L E    L  IFNTHHH DH   N
Sbjct: 4   IRLEALSDNYIFLLYDDKRNIAAVVDPAEAQPVLKKLAELKADLVAIFNTHHHNDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L +KF    ++G  E+  +IPG    L  GD  +F     ++I  PGHT  HI Y+F 
Sbjct: 64  KQLIEKFPQLIVYGGAEDRGRIPGQKVFLQQGDRVEFADRIAEVIFVPGHTRAHIAYYFP 123

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLFS GCGR+FE +  +M +SL K++S  D T I+  HEYT  N  
Sbjct: 124 PQEASETGDLFCGDTLFSGGCGRLFEGTPTQMVDSLSKLRSLPDNTRIWCAHEYTLKNLQ 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N +LQ+  ++VK+ RS+   T PS + +EK  NPFLR +  SL+    ++++
Sbjct: 184 FALTVDGDNADLQRRFNEVKAYRSRGEATIPSLLGVEKHTNPFLRWDQASLQS--TVKSS 241

Query: 240 SNLAVFTELRIRKN 253
             +  F  +R  KN
Sbjct: 242 DGVQTFARIREMKN 255


>gi|254423476|ref|ZP_05037194.1| metallo-beta-lactamase superfamily protein [Synechococcus sp. PCC
           7335]
 gi|196190965|gb|EDX85929.1| metallo-beta-lactamase superfamily protein [Synechococcus sp. PCC
           7335]
          Length = 290

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 135/248 (54%), Gaps = 8/248 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  ++HN      A +D  D   + + L E G  L  IFNTHHH DH   N  L  +F
Sbjct: 44  DNYIFVLHNPADNTAAVVDPADAPPVLQKLDELGATLITIFNTHHHNDHVGGNRELLDRF 103

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-----ND 126
               ++G  ++  +IPG  H L +GD   F     ++I  PGHT GHI Y+F+       
Sbjct: 104 PKAEVYGGAQDQGRIPGQRHFLGEGDRVSFADRTGRVIFVPGHTRGHIAYYFLPIKANEP 163

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF+ GCGR+FE +  +M  SL K+++  D TH++ GHEYT +N  FA++ + 
Sbjct: 164 GDLFCGDTLFAGGCGRLFEGTPTQMATSLAKLRNLPDTTHVWCGHEYTLSNLKFAITVEG 223

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N EL+   + V + R QN  T PS +S EK  NPFLR  +  L+   N ++   + VF 
Sbjct: 224 KNEELRSRLASVTTARQQNQPTIPSLLSTEKATNPFLRWNSPELQSVANSQDP--ITVFA 281

Query: 247 ELRIRKNQ 254
            +R  K++
Sbjct: 282 HIRKLKDR 289


>gi|258541869|ref|YP_003187302.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632947|dbj|BAH98922.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636004|dbj|BAI01973.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639059|dbj|BAI05021.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642113|dbj|BAI08068.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645168|dbj|BAI11116.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648223|dbj|BAI14164.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651276|dbj|BAI17210.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654267|dbj|BAI20194.1| hydroxyacylglutathione hydrolase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 241

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (58%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI +  DN+   + + +   TA +D  +   ++  + ++G  L  I  THHH DHT    
Sbjct: 7   AIPVLSDNYAWFLRDTETGTTAVVDPGEATPVADFIEKEGGRLDLILLTHHHHDHTGGAE 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ ++  + GP  E  ++P +D  L D D+   G+    +IA PGHT+GHICY F N 
Sbjct: 67  ALRQRYHARVAGPAAEQQRMPPLDIALHDQDSIAVGACIGTVIAVPGHTLGHICYDFPNP 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE +  +MFESL K+ +  D T +Y GHEYT  N+ FAL  +P
Sbjct: 127 PSLFCGDTLFSLGCGRLFEGTAEQMFESLHKLDTLPDATRVYCGHEYTLGNSAFALHAEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           HN  L++  ++V+ ++++N  T PST+ +E+  NPFLR +N      L  E 
Sbjct: 187 HNAALKERVAEVRRLQAENKPTVPSTLGMERATNPFLRAQNVQAFAQLRREK 238


>gi|240139057|ref|YP_002963532.1| putative hydroxyacylglutathione hydrolase (gloB-like) with
           metallo-hydrolase/oxidoreductase domain
           [Methylobacterium extorquens AM1]
 gi|254561651|ref|YP_003068746.1| hydroxyacylglutathione hydrolase [Methylobacterium extorquens DM4]
 gi|240009029|gb|ACS40255.1| putative hydroxyacylglutathione hydrolase (gloB-like) with
           metallo-hydrolase/oxidoreductase domain
           [Methylobacterium extorquens AM1]
 gi|254268929|emb|CAX24890.1| putative hydroxyacylglutathione hydrolase (gloB-like) with
           metallo-hydrolase/oxidoreductase domain
           [Methylobacterium extorquens DM4]
          Length = 259

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 125/243 (51%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   +   L  +GW LT I  TH H DH      + +  
Sbjct: 16  DNIGVLIRDPASGACAAIDVPEAGPVLAALDAEGWQLTDILVTHRHGDHIEGIPEVVERT 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +PG    + +GDT   G     +  TPGH   H+ Y+F +   +  G
Sbjct: 76  GARVTVPEKARGAVPGAARTVKEGDTVTVGGLTAAVWETPGHCADHVTYYFADAGVVFSG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +     D T +Y GH+Y  +N  FAL+ DP N +L+
Sbjct: 136 DTLFTLGCGRVMEAEPETLWRSLSRFLDLPDATAVYSGHDYVLSNGRFALAADPDNADLK 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFTELRIR 251
           +  ++ + + +Q  +  PSTI  EK  NPFLR+    L ++  +E  S+  AVFT LR  
Sbjct: 196 ERVAEAERLAAQGGFLIPSTIGQEKATNPFLRVGQPVLARSAGLEPGSDPAAVFTALRAW 255

Query: 252 KNQ 254
           KN+
Sbjct: 256 KNR 258


>gi|148555708|ref|YP_001263290.1| hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
 gi|148500898|gb|ABQ69152.1| Hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
          Length = 272

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 127/230 (55%), Gaps = 3/230 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  L+H      T  +D      +      +GW +  I+NTH H DH   N
Sbjct: 35  VRIPVLDDNYVWLLHEPVSGETVVVDPAVAGPVLAEAERRGWTIGQIWNTHWHGDHIGGN 94

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K      +  P  E++KIP +D  L +GD+   G+    ++  P HT GHI  H  +
Sbjct: 95  DAIKAATGARVSAPAAEAAKIPSLDVPLREGDSVRIGAVEGMVMEVPAHTAGHIAIHLPD 154

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  + VGDTLF++GCGR+FE + A+M  +++++ +  D T +Y  HEYT++N  +AL+ +
Sbjct: 155 EQAVFVGDTLFAMGCGRLFEGTPAQMHANMDRLAALPDATRVYCAHEYTQSNGRYALAAE 214

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR---IENTSLRK 232
           P N  ++    +V + R++   T P+TI LE++ NPF+R   +E  + R+
Sbjct: 215 PGNGAIRARMERVDAARARGEATVPTTIGLERETNPFMRAGSVEELARRR 264


>gi|86607653|ref|YP_476415.1| glyoxalase II family protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123504126|sp|Q2JPX4|GLO2_SYNJB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86556195|gb|ABD01152.1| glyoxalase II family protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 252

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 134/250 (53%), Gaps = 3/250 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+HN      A +D      + + L E G  L  IFNTHHH DH   N
Sbjct: 4   LQLPALRDNYIYLLHNPDTATAAVVDPAVAEPVLEKLAELGAELVAIFNTHHHHDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L +++    ++G   +  +IPG    L  G+T +F     K++  PGHT GHI Y+F 
Sbjct: 64  RQLLERYPRARVYGSQVDRGRIPGQTVELKAGETVEFAGRLAKVLFVPGHTRGHIAYYFS 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE +  +M  SL++++   + T ++  HEYT NN  FAL+ 
Sbjct: 124 ESGDLFCGDTLFAGGCGRLFEGTPEQMVGSLDQLRQLPEATRVWCAHEYTLNNLRFALTV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           D  N +LQ    +V ++R     T PSTI  E++ NPFLR +  +L+    +++   + V
Sbjct: 184 DGDNPDLQARYQQVAALRQTGSPTVPSTIGEERRTNPFLRWDQPALQAATGLQDP--VRV 241

Query: 245 FTELRIRKNQ 254
           F  LR  K+Q
Sbjct: 242 FARLRGMKDQ 251


>gi|209545180|ref|YP_002277409.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532857|gb|ACI52794.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 242

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 122/231 (52%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+   + +     TA +D  +   +   + E G  L  IF THHH DH  A   
Sbjct: 8   VPILTDNYAWFLRDEDSGATALVDPAEEAPLVTAVEEAGGRLDQIFLTHHHADHVAATDA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L+K F   + G   ++ ++P +D  +++GD    G     ++ TPGHT GHI +HF    
Sbjct: 68  LRKRFGAIVTGAAADAYRLPMLDQAVAEGDDIALGGAIGTVMETPGHTRGHIAFHFPLVP 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE S  EMF SL +I +  D T I  GHEYT +NA FA   +P 
Sbjct: 128 ALFCGDTLFSLGCGRLFEGSAEEMFHSLRRIAALPDATLICCGHEYTLSNARFAQEVEPE 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           N  L    +++  +R++   T P  + LEK+ NPFLR  + +    L  E 
Sbjct: 188 NAALHARVAEIDILRAEARPTVPVRLGLEKQTNPFLRAPDVATFARLRREK 238


>gi|162149076|ref|YP_001603537.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787653|emb|CAP57249.1| Hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 254

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 122/231 (52%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+   + +     TA +D  +   +   + E G  L  IF THHH DH  A   
Sbjct: 20  VPILTDNYAWFLRDEDSGATALVDPAEEAPLVTAVEEAGGRLDQIFLTHHHADHVAATDA 79

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L+K F   + G   ++ ++P +D  +++GD    G     ++ TPGHT GHI +HF    
Sbjct: 80  LRKRFGAIVTGAAADAYRLPMLDQAVAEGDDIALGGAIGTVMETPGHTRGHIAFHFPLVP 139

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFSLGCGR+FE S  EMF SL +I +  D T I  GHEYT +NA FA   +P 
Sbjct: 140 ALFCGDTLFSLGCGRLFEGSAEEMFHSLRRIAALPDATLICCGHEYTLSNARFAQEVEPE 199

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           N  L    +++  +R++   T P  + LEK+ NPFLR  + +    L  E 
Sbjct: 200 NAALHARVAEIDILRAEARPTVPVRLGLEKQTNPFLRAPDVATFARLRREK 250


>gi|262279582|ref|ZP_06057367.1| hydroxyacylglutathione hydrolase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259933|gb|EEY78666.1| hydroxyacylglutathione hydrolase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 243

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 124/216 (57%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + + +   A+D  +  ++++  +     L  I+ TH H DH     +L    N
Sbjct: 16  NYIWILEDTETQEAVAVDPTEAELVTQFCQNHQLNLKQIWLTHWHKDHIGGVADLTAAQN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
            T++GP +E +KIPGI H L   D   F    ++IIATPGHT+GHI Y       +  GD
Sbjct: 76  ITVYGPRDELTKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELEAVFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FAL+ +PHN  L +
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLSRLAALPTHTKVYCTHEYTLSNAEFALTVEPHNHALSE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
              +V+ +R Q L T PSTI LE   NPFLR EN  
Sbjct: 196 RAEEVRELRKQGLITLPSTIELELATNPFLRAENVE 231


>gi|16329542|ref|NP_440270.1| glyoxalase II [Synechocystis sp. PCC 6803]
 gi|2494855|sp|P72933|GLO2_SYNY3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|1652024|dbj|BAA16950.1| glyoxalase II [Synechocystis sp. PCC 6803]
          Length = 257

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 133/247 (53%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+ +    A +D  +   +   L   G  L  I+NTHHH DH  AN  L  K+
Sbjct: 11  DNYIFLLHDRQRNQAAVVDPAEAKPVLDCLETLGADLVTIYNTHHHGDHVGANRELLAKY 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF--- 128
            N  ++G +E+  +IPG    L DGD   F      +   PGHT GHI Y+F        
Sbjct: 71  PNLEVYGGVEDQGRIPGQTVFLRDGDRLSFADREATVYFVPGHTRGHIAYYFAPGSGETI 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE + A+M +S+ K++   D+T ++  HEYT  N  FAL+ DP
Sbjct: 131 GDLFCGDTIFAGGCGRLFEGTPAQMVQSIGKLRQLPDQTRLWCAHEYTLGNLKFALTVDP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ+    V+  R +   T PS +  EK+ NPFLR +N +++  + M   +   VF 
Sbjct: 191 SNKDLQERFQTVQGDRQRGQATIPSWLGTEKRTNPFLRWDNPAIQARVGMTEPAR--VFG 248

Query: 247 ELRIRKN 253
           +LR  K+
Sbjct: 249 KLRGMKD 255


>gi|119484331|ref|ZP_01618948.1| Beta-lactamase-like protein [Lyngbya sp. PCC 8106]
 gi|119457805|gb|EAW38928.1| Beta-lactamase-like protein [Lyngbya sp. PCC 8106]
          Length = 257

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 137/254 (53%), Gaps = 10/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+H+  + + A +D  +   +   LRE    L  IFNTHHH DH   N  
Sbjct: 6   LPVLSDNYIFLLHDPTHNIAAVVDPAEAAPVVHRLRELNAELVTIFNTHHHSDHVGGNRQ 65

Query: 68  LKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF--- 123
           L + F   T++G  E+  +IPG    LS+GD   F     ++   PGHT  HI Y+F   
Sbjct: 66  LLQHFPQATVYGGAEDQDRIPGQQVFLSEGDQVKFSDRSGEVFFVPGHTRAHIAYYFPAQ 125

Query: 124 ---MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                    C GDTLF+ GCGR+FE +  +M  SL K++S  D T ++  HEYT  N  F
Sbjct: 126 TEGETGELFC-GDTLFAGGCGRLFEGTPQQMVSSLTKLRSLPDNTRVWCAHEYTLKNLKF 184

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ D +N +L+    +VK  RS++  T PSTI LEK  NPF+R ++ +L+  +  ++  
Sbjct: 185 ALTVDENNADLKHRFEQVKVDRSRDQATVPSTIGLEKLTNPFMRWDDVALQSKVKSQDP- 243

Query: 241 NLAVFTELRIRKNQ 254
            +  F  LR  K+Q
Sbjct: 244 -VQTFARLRGMKDQ 256


>gi|95928634|ref|ZP_01311381.1| Hydroxyacylglutathione hydrolase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135424|gb|EAT17076.1| Hydroxyacylglutathione hydrolase [Desulfuromonas acetoxidans DSM
           684]
          Length = 249

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 135/247 (54%), Gaps = 5/247 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  +I +     T AID  +   +   L + G  L+ I NTH H DH   NL 
Sbjct: 7   LQAHDDNYAYMISDGD--TTIAIDPGEAEPVLDYLEKHGRSLSLILNTHMHQDHCGGNLT 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+   C I G  E   +I G+D  L +         P++++ TPGHT G  CY+     
Sbjct: 65  LKRLTGCHIAGGDE---RIVGVDRLLQEDSVLPGLPWPLQVMHTPGHTRGDCCYYLPQCE 121

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFS GCGR+FE +  +++ SL+KI +  + T +Y GHEYTE N  FA S +P 
Sbjct: 122 ALFCGDTLFSGGCGRVFEGTMEQLYHSLQKITALPETTRLYCGHEYTEENYRFAASIEPS 181

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           +  +    S+V  +R+    T P T++ E   NPFLR E   L++ L ME AS + VFT+
Sbjct: 182 SATVHDKLSRVHYLRNHGKPTLPVTLAEELLCNPFLRCEEKELQRALKMEQASAVEVFTD 241

Query: 248 LRIRKNQ 254
           LR RKN+
Sbjct: 242 LRQRKNR 248


>gi|218247241|ref|YP_002372612.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8801]
 gi|226723987|sp|B7K3R6|GLO2_CYAP8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218167719|gb|ACK66456.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8801]
          Length = 257

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+++   +  A +D  +   + + L + G  L  IFNTHHH DH  AN  L+++F
Sbjct: 11  DNYIFLLYDADTQTAAVVDPAEPTPVLECLNKLGAQLVAIFNTHHHYDHVGANNQLQQYF 70

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-----MND 126
            N  I+G  E+  +IPG    L +GD  +FG    +++  PGHT  HI Y+F        
Sbjct: 71  PNLCIYGGSEDRGRIPGQQVFLKEGDRVEFGQRVGEVLFVPGHTRAHIAYYFPPKLSQET 130

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF  GCGR+FE +  +M  SL K+++  D T ++  HEYT  N  FAL+ DP
Sbjct: 131 GELFCGDTLFGGGCGRLFEGTPTQMVNSLTKLRNLPDNTRVWCAHEYTLKNLQFALTVDP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            NL L+    +VK  R Q   T PS +  EK  NPFLR +N++++  + M + +   VF 
Sbjct: 191 DNLVLKNRYHQVKEFRHQGQATVPSILGEEKLTNPFLRWDNSAIQLTIGMTDPAR--VFG 248

Query: 247 ELRIRKN 253
           +LR  K+
Sbjct: 249 KLRGMKD 255


>gi|163851933|ref|YP_001639976.1| hydroxyacylglutathione hydrolase [Methylobacterium extorquens PA1]
 gi|163663538|gb|ABY30905.1| hydroxyacylglutathione hydrolase [Methylobacterium extorquens PA1]
          Length = 259

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 124/243 (51%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   +   L  +GW LT I  TH H DH      + +  
Sbjct: 16  DNIGVLIRDPASGACAAIDVPEAGPVLAALDAEGWQLTDILVTHRHGDHIEGIPEVVERT 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +PG    + +GDT   G     +  TPGH   H+ Y+F +   +  G
Sbjct: 76  GARVTVPEKARRAVPGAARTVKEGDTVTVGGLTAAVWETPGHCADHVTYYFADAGVVFSG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +     D T +Y GH+Y  +N  FAL+ DP N +L+
Sbjct: 136 DTLFTLGCGRVMEAEPETLWRSLSRFLDLPDATAVYSGHDYVLSNGRFALAADPDNADLK 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFTELRIR 251
           +  ++ +   +Q  +  PSTI  EK  NPFLR+    L ++  +E  S+  AVFT LR  
Sbjct: 196 ERVAEAERFAAQGGFLIPSTIGQEKATNPFLRVGQPVLARSAGLEPGSDPAAVFTALRAW 255

Query: 252 KNQ 254
           KN+
Sbjct: 256 KNR 258


>gi|330445179|ref|ZP_08308831.1| hydroxyacylglutathione hydrolase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489370|dbj|GAA03328.1| hydroxyacylglutathione hydrolase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 252

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 139/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N K      +D  D   + + L +    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQN-KENHCVVVDPGDATPVFEALEKNNLTLDAILITHHHSDHIGGIS 64

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ F    + GP  E   IPGI   + DGD  D       +++ PGHT+GH+ Y  + 
Sbjct: 65  ELKRRFPTIKVVGPASEP--IPGITQPVEDGDQVDIFGERFMVMSVPGHTLGHVVY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGR+FE + A+MF+SL+KI +  D+T ++  HEYT +N  FAL  +
Sbjct: 121 DEKLFCGDTLFSAGCGRLFEGTPAQMFDSLQKIAALPDETEVFCAHEYTASNLSFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
             N  LQKY   V  +R+    T PST+SLEK +NPFLR +  S+++++     + S+L 
Sbjct: 181 QDNPHLQKYRDNVIRLRANGESTLPSTLSLEKLINPFLRCDQPSIKRSVADKAYDDSDLE 240

Query: 244 VFTELRIRKNQ 254
            F  LR  K++
Sbjct: 241 TFAALRRWKDK 251


>gi|209695826|ref|YP_002263756.1| putative metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
 gi|226723983|sp|B6EJV4|GLO2_ALISL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|208009779|emb|CAQ80085.1| putative metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
          Length = 252

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 141/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN+       +D  +   +   L+E G  L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHNNDNH-CVVVDPGEAAPVLACLKEHGLILDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F N  + GP  E+  IP + H + DGD  +  +    ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPNINVVGP--ENEPIPTLTHPVGDGDFVELFNEKFMVLGVEGHTKGHIAY--IG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  FAL+ +
Sbjct: 121 DEKLFCGDTLFSAGCGRLFEGTAEQMFHSLQKLAALPDETEVYCAHEYTASNLAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  LQ+Y  KV  +R+    T P+T+  EK +NPFLR    S+++ ++  +EN S +A
Sbjct: 181 PDNDYLQQYREKVLRLRANGKATIPTTMQREKLINPFLRTSEASVKQAVSSKVENDSEVA 240

Query: 244 VFTELRIRKNQ 254
            F  LR  K++
Sbjct: 241 TFAALRRWKDE 251


>gi|99081931|ref|YP_614085.1| hydroxyacylglutathione hydrolase [Ruegeria sp. TM1040]
 gi|99038211|gb|ABF64823.1| Hydroxyacylglutathione hydrolase [Ruegeria sp. TM1040]
          Length = 271

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 137/253 (54%), Gaps = 6/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+        A IDAP+   I   L  + W L  I  THHH DH    
Sbjct: 20  VTVPCLADNYAYLVKGPDG--VALIDAPEAEPILTALEARDWSLGVIMITHHHHDHVGGV 77

Query: 66  LNLKKFFNCTIFGPLEESSKIPG----IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             L++ F C + GP  E+ KI      +D  L  G     G+   +++A PGHT+GHI +
Sbjct: 78  AALREKFGCPVMGPKAEADKIAAQGVTLDMELEPGFEGGTGAGRCQVLAVPGHTLGHIAF 137

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           ++     L   D+L  +GCGR+FE + A M++++  + +  D+T IY GHEYTE+NA FA
Sbjct: 138 YYPEAPALFSADSLMVMGCGRLFEGTPAMMWQTMTTLSALPDETLIYSGHEYTESNAGFA 197

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           LS +P N  LQK   ++   R     T P+ +SLEK+ NPFLR  + +L+K L +E   +
Sbjct: 198 LSLEPENAALQKRMDEITKTRQNGQPTVPALLSLEKQTNPFLRAGDPNLKKTLGLEGVED 257

Query: 242 LAVFTELRIRKNQ 254
             VF  +R+ K++
Sbjct: 258 AEVFAHIRVAKDK 270


>gi|325122743|gb|ADY82266.1| putative hydroxyacylglutathione hydrolase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 243

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 124/216 (57%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + + +   A+D  +  ++++  +     L  I+ TH H DH     +L    N
Sbjct: 16  NYIWILEDTETQEAVAVDPTEAELVTQFCQNHQLTLKQIWLTHWHKDHIGGVTDLTTAQN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
            T++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y       +  GD
Sbjct: 76  ITVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELEAVFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +   +T +Y  HEYT +NA FAL+ +PHN  L +
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLSRLAALPTQTKVYCTHEYTLSNAEFALTVEPHNHALSE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
              +V+ +R Q   T PSTI LE   NPFLR E+  
Sbjct: 196 RAEEVRELRKQGSITLPSTIELELATNPFLRAESAE 231


>gi|90414052|ref|ZP_01222035.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum 3TCK]
 gi|90324847|gb|EAS41375.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum 3TCK]
          Length = 252

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 144/250 (57%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHDHIGGIS 64

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ + N  + GP  E   IPGI   + DGD  +       ++  PGHT+GH+ Y  + 
Sbjct: 65  ELKRHYPNLNVVGPASE--PIPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  FAL  +
Sbjct: 121 DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLA 243
             N  LQ+Y  +V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  + S+L 
Sbjct: 181 QDNPHLQRYREEVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFDDSDLE 240

Query: 244 VFTELRIRKN 253
            F  LR  K+
Sbjct: 241 TFAALRRWKD 250


>gi|332706119|ref|ZP_08426190.1| hydroxyacylglutathione hydrolase [Lyngbya majuscula 3L]
 gi|332355097|gb|EGJ34566.1| hydroxyacylglutathione hydrolase [Lyngbya majuscula 3L]
          Length = 257

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 136/249 (54%), Gaps = 10/249 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+ K  + A +D  +   + + L+E    L  IFNTHHH+DH   N  L ++F
Sbjct: 11  DNYIFLLHDPKQNIAAVVDPAEAKPVIQCLKEMDADLVAIFNTHHHMDHVGGNRQLIQQF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM------N 125
            +  ++G  E+  +IPG    L + D  +FG    +++  PGHT GHI Y+F        
Sbjct: 71  PDVCVYGGAEDRGRIPGQQVFLEECDRVEFGDRLGEVLFVPGHTRGHIAYYFPPVVSGET 130

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
               C GDTLF+ GCGR+FE + ++M ESL K++   D T ++  HEYT  N  FALS D
Sbjct: 131 GELFC-GDTLFAGGCGRLFEGTASQMVESLGKLRDLPDNTRVWCAHEYTLKNLQFALSVD 189

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
             N +LQ   ++V+  R +   T PS + +EK  NPFLR E  +L+  +  +    +  F
Sbjct: 190 GENPDLQGRFAQVQEARHRKEATVPSQLGVEKHTNPFLRWEEPALQSAVQAKEP--VKTF 247

Query: 246 TELRIRKNQ 254
             LR  K++
Sbjct: 248 ARLRGMKDR 256


>gi|260772246|ref|ZP_05881162.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260611385|gb|EEX36588.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 252

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   +   LR++   L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIENSD-RCCAVVDPGDAQPVLAYLRQQELTLEAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +++ +  + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVRQYPHVDVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  FA++ +
Sbjct: 121 DSKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLTLPEETEIYCAHEYTASNVAFAMAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +LQ Y   V  MR+Q   T P+T+  EK VNPFLR    S+ K++    E    LA
Sbjct: 181 PDNEQLQIYRDTVIRMRAQGQATLPTTLQREKWVNPFLRTGVPSVIKSVANRTEQHDPLA 240

Query: 244 VFTELRIRKNQ 254
           +F+ LR  KN+
Sbjct: 241 IFSALREWKNE 251


>gi|148554582|ref|YP_001262164.1| hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
 gi|148499772|gb|ABQ68026.1| Hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
          Length = 242

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 121/224 (54%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +++  DN+  L+H+     T  +D      +      +GW +T I+NTH H DH   N
Sbjct: 5   VGVAVLADNYVWLMHDAASGETVVVDPTVDAPVLSAAAMRGWRITQIWNTHWHDDHVAGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + +K    C I  P +    IP +D  + +GD    G     +++TPGHT  H+ YH  +
Sbjct: 65  IGIKAATGCRITAPDDPEHPIPAVDRIVGEGDRVRIGGFEGHVLSTPGHTAVHLTYHLPD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+LGCGR+FE +  +MF +L ++ +   +T +Y  HEYT+ NA FA++ +
Sbjct: 125 ASILFTGDTLFALGCGRLFEGTADQMFANLRRLAALPPETAVYCAHEYTQANARFAITVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           P N +L +    + + R+    T P++I+ E+  NPFLR    +
Sbjct: 185 PDNAKLAERMLAIDAARAAGRPTVPTSIAAERDTNPFLRAATVA 228


>gi|119386520|ref|YP_917575.1| hydroxyacylglutathione hydrolase [Paracoccus denitrificans PD1222]
 gi|119377115|gb|ABL71879.1| Hydroxyacylglutathione hydrolase [Paracoccus denitrificans PD1222]
          Length = 248

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 132/249 (53%), Gaps = 7/249 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+H +    TA +DAP+   I   L  +GW L  I  THHH DH +A 
Sbjct: 6   VPVRCLTDNYAWLLHGNGR--TALVDAPEAAPILAELAARGWSLDQIALTHHHADHIQAV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       + G   +++++P +D  +  G+ F       ++I  PGHTIGH+ +H   
Sbjct: 64  PELVDRTGAWVVGNAGDATRLPPLDQPVRPGERFTLCGEDAEVIDVPGHTIGHVAFHLPA 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE     M+ SL ++ +   +T +  GH+Y   N  FALS +
Sbjct: 124 SAMVFTADSLMALGCGRLFEGDADMMWASLSRLNALPAETLVCSGHDYCRGNGAFALSVE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  LQK  ++  + +       PST++ E+  NPFLR+    L  +L ++ AS+ AVF
Sbjct: 184 PGNAALQKRLAETAAGQRP---CAPSTLAEERVTNPFLRVRE--LADSLGLQGASDAAVF 238

Query: 246 TELRIRKNQ 254
            ELR RK++
Sbjct: 239 AELRARKDR 247


>gi|260428819|ref|ZP_05782796.1| hydroxyacylglutathione hydrolase [Citreicella sp. SE45]
 gi|260419442|gb|EEX12695.1| hydroxyacylglutathione hydrolase [Citreicella sp. SE45]
          Length = 251

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 137/249 (55%), Gaps = 2/249 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          IDAP+   I+  L E+GW L  +  THHH DH    
Sbjct: 4   VTVPCLSDNYAYLVRGPGG--VCLIDAPEAAPIAAALSERGWGLDTLLITHHHHDHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+  F C++ GP  E  K+P +D  +  GD  +      ++I  PGHT+GHI +HF  
Sbjct: 62  DELRATFGCSVVGPRAEQEKMPALDLAVQGGDVLEVAGTRCEVIYVPGHTLGHIAFHFPE 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A M++SL K+ +   +T +  GHEYT++NA FAL+ +
Sbjct: 122 AQAVFTADSLMALGCGRVFEGTPAMMWDSLSKLAALPPETMVCSGHEYTQSNARFALTIE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+   + +   R++ L T    +S E   NPFLR ++  +R  L M+ A++  VF
Sbjct: 182 PGNATLKSRANDIAKARAEGLPTATCKLSEELATNPFLRPDSPEIRDLLGMKTATDAEVF 241

Query: 246 TELRIRKNQ 254
            E+R RK++
Sbjct: 242 AEIRARKDK 250


>gi|160395581|sp|Q6LN63|GLO2_PHOPR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
          Length = 252

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 143/250 (57%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHDHIGGIS 64

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ + N  + GP  E   IPGI   + DGD  +       ++  PGHT+GH+ Y  + 
Sbjct: 65  ELKRHYPNLNVVGPASE--PIPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  FAL  +
Sbjct: 121 DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLA 243
             N  LQ+Y   V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  + S+L 
Sbjct: 181 QDNPHLQRYREDVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFDDSDLE 240

Query: 244 VFTELRIRKN 253
            F  LR  K+
Sbjct: 241 TFAALRRWKD 250


>gi|91223497|ref|ZP_01258762.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           alginolyticus 12G01]
 gi|91191583|gb|EAS77847.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           alginolyticus 12G01]
          Length = 252

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 141/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAKPVLEFLQANELTLEAILITHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F N  + GP  +S  IP +   + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPNVAVVGP--KSEPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKLTSLPEETQVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N+   +
Sbjct: 181 PDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTSNPDVVQSVASRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|54310045|ref|YP_131065.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum SS9]
 gi|46914484|emb|CAG21263.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum SS9]
          Length = 264

 Score =  168 bits (426), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 143/250 (57%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH DH     
Sbjct: 18  SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHDHIGGIS 76

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ + N  + GP  E   IPGI   + DGD  +       ++  PGHT+GH+ Y  + 
Sbjct: 77  ELKRHYPNLNVVGPASEP--IPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVAY--VG 132

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  FAL  +
Sbjct: 133 DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAFALVAE 192

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLA 243
             N  LQ+Y   V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  + S+L 
Sbjct: 193 QDNPHLQRYREDVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFDDSDLE 252

Query: 244 VFTELRIRKN 253
            F  LR  K+
Sbjct: 253 TFAALRRWKD 262


>gi|218530684|ref|YP_002421500.1| hydroxyacylglutathione hydrolase [Methylobacterium chloromethanicum
           CM4]
 gi|218522987|gb|ACK83572.1| hydroxyacylglutathione hydrolase [Methylobacterium chloromethanicum
           CM4]
          Length = 259

 Score =  168 bits (426), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 124/243 (51%), Gaps = 1/243 (0%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN  +LI +      AAID P+   +   L  + W LT I  TH H DH      + +  
Sbjct: 16  DNIGVLIRDPASGACAAIDVPEAGPVLAALDAEDWQLTDILVTHRHGDHIEGIPEVVERT 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              +  P +    +PG    + +GDT   G     +  TPGH   H+ Y+F +   +  G
Sbjct: 76  GARVTVPEKARGAVPGAARTVKEGDTVTVGGLTAAVWETPGHCADHVTYYFADAGVVFSG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+ E     ++ SL +     D T +Y GH+Y  +N  FAL+ DP N +L+
Sbjct: 136 DTLFTLGCGRVMEAEPETLWRSLSRFLDLPDATAVYSGHDYVLSNGRFALAADPDNADLK 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-LAVFTELRIR 251
           +  ++ + + +Q  +  PSTI  EK  NPFLR+    L ++  +E  S+  AVFT LR  
Sbjct: 196 ERVAEAERLAAQGGFLIPSTIGQEKATNPFLRVGQPVLARSAGLEPGSDPAAVFTALRAW 255

Query: 252 KNQ 254
           KN+
Sbjct: 256 KNR 258


>gi|282900670|ref|ZP_06308612.1| Beta-lactamase-like protein [Cylindrospermopsis raciborskii CS-505]
 gi|281194470|gb|EFA69425.1| Beta-lactamase-like protein [Cylindrospermopsis raciborskii CS-505]
          Length = 257

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 139/256 (54%), Gaps = 10/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++  + + A +D      + + L E    L  IFNTHHH DH   N
Sbjct: 4   IQLSALSDNYIFLLYDSYHNIAAVVDPAQPEPVMEKLTELQCNLVAIFNTHHHHDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L +KF   TI+  +++  +IPG    L   D   FG     ++  PGHT  HI Y+F 
Sbjct: 64  QKLIEKFPQVTIYAGIQDRGRIPGQQVFLQANDIVKFGDRQAIVLFIPGHTRAHIAYYFP 123

Query: 125 ------NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE + A+M ESL ++++  D T ++  HEYT NN 
Sbjct: 124 PVTPGETGELFC-GDTLFAGGCGRLFEGTPAQMVESLTQLRALPDNTRVWCAHEYTWNNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL+ D  N ELQK  ++V ++R     T PS + +EK+ NPFLR +  SL+  +N  +
Sbjct: 183 RFALTVDSENQELQKRLTEVTALRQLQQPTVPSLLGIEKQTNPFLRWDQPSLQLAVN--S 240

Query: 239 ASNLAVFTELRIRKNQ 254
           +  +  F ++R  K++
Sbjct: 241 SDPIQTFAKIRGMKDK 256


>gi|84500105|ref|ZP_00998371.1| hydroxyacylglutathione hydrolase, putative [Oceanicola batsensis
           HTCC2597]
 gi|84392039|gb|EAQ04307.1| hydroxyacylglutathione hydrolase, putative [Oceanicola batsensis
           HTCC2597]
          Length = 254

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 129/249 (51%), Gaps = 3/249 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          IDAP+   +    +++GW    +  THHH DHT   
Sbjct: 6   VTVPCRSDNYAYLVKGPDG--VCIIDAPEAAPLIAAAKDRGWTPDVLMITHHHGDHTAGT 63

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +LK  F    + GP  E  K+P +D  LS+G     G      +  PGHT+GH+ +HF 
Sbjct: 64  DDLKAAFPGLRVMGPKAEEDKLPPLDMALSEGMNGGEGEAYTVPLDVPGHTLGHMAFHFP 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               +   D+L S GCGR+FE +   M  +L+K+ +   +T IY GHEYT  N  FALS 
Sbjct: 124 EAGVIFTADSLMSWGCGRVFEGTPEMMHATLQKLAALLPETLIYSGHEYTLANMKFALSI 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           +P N +L     KV++ R     T P T++ E K NPFLR +   + K + ME A+ + +
Sbjct: 184 EPDNPDLLARADKVQAQRDAGEATVPVTLAEELKTNPFLRCDTPQVAKAVGMEGAAPVDI 243

Query: 245 FTELRIRKN 253
           F E+R RK+
Sbjct: 244 FAEVRKRKD 252


>gi|81300212|ref|YP_400420.1| hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 7942]
 gi|123556842|sp|Q31ND6|GLO2_SYNE7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160395580|sp|Q5N5S6|GLO2_SYNP6 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81169093|gb|ABB57433.1| Hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 7942]
          Length = 258

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 131/250 (52%), Gaps = 9/250 (3%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KK 70
            DN+  L+ + + R  A +D  +   +   L+ +G  LT I NTHHH DH   N  L ++
Sbjct: 10  QDNYIFLLVDVEQRQAAVVDPAEAEPVLAALQAEGLTLTAILNTHHHGDHVGGNRRLLRQ 69

Query: 71  FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN----- 125
           F    +     +  +IPG    L  GD         +++  PGHT GHI Y+F       
Sbjct: 70  FPEAAVSASAVDRDRIPGQTVLLEAGDRLQICGQTAEVLFVPGHTRGHIAYYFPEVAEGN 129

Query: 126 -DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M +SL++++S  D T IY  HEYT NN  FAL+ 
Sbjct: 130 PRGALFCGDTLFAGGCGRLFEGTPAQMLDSLQQLRSLPDDTAIYCAHEYTLNNLRFALTV 189

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           +P N +LQ+    V   R Q   T PS + +EK  NPFLR +  +L+  ++ ++   +  
Sbjct: 190 EPDNFDLQQRYQAVAIARQQGQATIPSRLDIEKATNPFLRWDQAALQAAVSSQDP--VQT 247

Query: 245 FTELRIRKNQ 254
              LR RK+Q
Sbjct: 248 LARLRSRKDQ 257


>gi|269966274|ref|ZP_06180363.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio
           alginolyticus 40B]
 gi|269829189|gb|EEZ83434.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio
           alginolyticus 40B]
          Length = 252

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 141/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAIVDPGDAKPVLEFLQANELTLEAILITHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F N  + GP  +S  IP +   + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPNVAVVGP--KSEPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKLTSLPEETQVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N+   +
Sbjct: 181 PDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTSNPDVVQSVASRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|166367672|ref|YP_001659945.1| hydroxyacylglutathione hydrolase [Microcystis aeruginosa NIES-843]
 gi|189041224|sp|B0JW10|GLO2_MICAN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166090045|dbj|BAG04753.1| probable hydroxyacylglutathione hydrolase [Microcystis aeruginosa
           NIES-843]
          Length = 257

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 141/247 (57%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+++   ++ A +D  +   + + L      L  IFNTHHH DH  AN  L  ++
Sbjct: 11  DNYIFLLYDPAQKIAAVVDPAEPEPVFRRLEALQVDLVAIFNTHHHGDHVGANQALINRY 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----NDH 127
            +  ++G  E+  +IPG    L +GD  +F     ++   PGHT  HI Y+F      D+
Sbjct: 71  PHLCVYGGKEDRGRIPGQQLFLEEGDRVEFAGRWAEVFFVPGHTRAHIAYYFPPVNPGDY 130

Query: 128 F-LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFS GCGR+FE +  +M  SL K++S  D+T ++  HEYT NN  FAL+ DP
Sbjct: 131 GELFCGDTLFSGGCGRLFEGTPGQMVASLTKLRSLPDQTRVWCAHEYTLNNLKFALTVDP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
           +N  LQ+   +V+  R+++L T P+ +  EK  NPFLR ++ +L   + M+++  + VF 
Sbjct: 191 NNAALQQRYREVEKHRAEDLPTIPAILGTEKLTNPFLRWDSPAL--AMTMDSSEPVQVFA 248

Query: 247 ELRIRKN 253
            LR +K+
Sbjct: 249 RLRGKKD 255


>gi|37522908|ref|NP_926285.1| hydroxyacylglutathione hydrolase [Gloeobacter violaceus PCC 7421]
 gi|81709044|sp|Q7NG34|GLO2_GLOVI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|35213910|dbj|BAC91280.1| gll3339 [Gloeobacter violaceus PCC 7421]
          Length = 252

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 128/243 (52%), Gaps = 3/243 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  ++ +   R  A +D  +   + + L   G  L  IFNTHHH DH   N  L + +
Sbjct: 11  DNYVFVLEDEAARTAAVVDPAEARPVLEALVRLGLKLVAIFNTHHHHDHVGGNRELLEAY 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
               ++    +  +IPG    L DGDT  FG    ++I  PGHT GHI YHF     L  
Sbjct: 71  PGIAVYASRRDRGRIPGQTVELEDGDTVAFGCERARVIFVPGHTHGHIAYHFAGCGHLFC 130

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF+ GCGR+FE +  +M  SL +++    +T ++  HEYT  N  FA + +P N EL
Sbjct: 131 GDTLFAGGCGRLFEGTARQMQHSLGRLRELPGETQVWCAHEYTLGNLRFAHTLEPDNAEL 190

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIR 251
            +    V+ +R++ + T PST++ E+  NPFLR E+  L++           VF  LR  
Sbjct: 191 AERLRTVEVLRARKIATVPSTMAAERATNPFLRWESRQLQRAAGAIEPEE--VFAHLRAL 248

Query: 252 KNQ 254
           K++
Sbjct: 249 KDR 251


>gi|293609480|ref|ZP_06691782.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827932|gb|EFF86295.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 243

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 124/216 (57%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + + +   A+D  +  ++++  +     L  I+ TH H DH     +L    N
Sbjct: 16  NYIWILEDTETQEAVAVDPTEADLVTQFCQNHQLTLKQIWLTHWHKDHIGGVADLTAGQN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
            T++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y       +  GD
Sbjct: 76  ITVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELEAVFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +   +T +Y  HEYT +NA FAL+ +PHN  L +
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLSRLAALPTQTKVYCTHEYTLSNAEFALTVEPHNHALSE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
              +V+ +R +   T PSTI LE   NPFLR E+  
Sbjct: 196 RAEEVRELRKKGSITLPSTIELELATNPFLRAESAE 231


>gi|28899069|ref|NP_798674.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153839746|ref|ZP_01992413.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ3810]
 gi|260366045|ref|ZP_05778517.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus K5030]
 gi|260876849|ref|ZP_05889204.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|260897330|ref|ZP_05905826.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|81727122|sp|Q87MG0|GLO2_VIBPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|28807293|dbj|BAC60558.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149746730|gb|EDM57718.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ3810]
 gi|308088245|gb|EFO37940.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|308091380|gb|EFO41075.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|308115293|gb|EFO52833.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus K5030]
 gi|328474394|gb|EGF45199.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus 10329]
          Length = 252

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 141/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   +   L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAQPVLDYLQANELTLEAILVTHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F + T+ GP  ++  IP +   + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPHVTVVGP--KAEPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL KI +  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DSKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIAALPEETQVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L++Y   V  +R+ N+ T P+T+  EK +NPFLR  N  + K++   ++N+   +
Sbjct: 181 PDNEQLRQYRDDVNRLRALNIPTLPTTLRKEKWINPFLRTTNPDVVKSVANRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|282897994|ref|ZP_06305989.1| Beta-lactamase-like protein [Raphidiopsis brookii D9]
 gi|281197138|gb|EFA72039.1| Beta-lactamase-like protein [Raphidiopsis brookii D9]
          Length = 257

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 140/256 (54%), Gaps = 10/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++  + + A +D      + + L E    L  IFNTHHH DH   N
Sbjct: 4   IQLSALSDNYIFLLYDSYHNIAAVVDPAQPEPVIEKLTELQCNLVAIFNTHHHHDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L +KF   TI+G +++  +IPG    L   D   FG     ++  PGHT  HI Y+F 
Sbjct: 64  QKLIEKFPQVTIYGGIQDRGRIPGQQVFLQANDIVKFGDRQGIVLFIPGHTRAHIAYYFP 123

Query: 125 ------NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE + A+M  SL ++++  D T ++  HEYT NN 
Sbjct: 124 PVTPGETGELFC-GDTLFAGGCGRLFEGTPAQMVGSLTQLRALPDNTRVWCAHEYTWNNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL+ D  N ELQK  ++V ++R     T PS + +EK+ NPFLR +  SL+  L +++
Sbjct: 183 RFALTVDSENQELQKRFTEVTALRQLQQPTVPSILGIEKQTNPFLRWDQPSLQ--LAVKS 240

Query: 239 ASNLAVFTELRIRKNQ 254
           +  +  F ++R  K++
Sbjct: 241 SDPIQTFAKIRGMKDK 256


>gi|269101976|ref|ZP_06154673.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161874|gb|EEZ40370.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 252

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 138/250 (55%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  L+ + + +    ID  D   + + + ++   L  I  THHH DH     
Sbjct: 6   SIPAFKDNYIWLLQSPE-KHCIVIDPGDAKPVIEAIEKQQLTLDAILITHHHNDHCGGIS 64

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ + +  + GP  ++  IPG+   + DGD  D       ++A PGHT GH+ Y  + 
Sbjct: 65  ELKRRYPSINVVGP--QNDPIPGLTQSVEDGDQVDIFGERFMVLAVPGHTHGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGRIFE +  EM+ SL+KI +  D+T IY  HEYT  N  FAL  +
Sbjct: 121 DEKLFCGDTLFSAGCGRIFEGTPEEMYASLQKIAALPDETEIYCAHEYTAGNIAFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
             N  LQ+Y  +V  +R+    T PST+  EK VNPFLR +  S++K +     ++S+LA
Sbjct: 181 QDNPHLQRYREEVNRLRANGESTLPSTLGKEKLVNPFLRCDQPSIKKAVADKATDSSDLA 240

Query: 244 VFTELRIRKN 253
            FT LR  K+
Sbjct: 241 TFTALRSWKD 250


>gi|134095499|ref|YP_001100574.1| hydroxyacylglutathione hydrolase [Herminiimonas arsenicoxydans]
 gi|226724000|sp|A4G7G5|GLO2_HERAR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|133739402|emb|CAL62452.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II) (Glx II)
           GloB-like [Herminiimonas arsenicoxydans]
          Length = 259

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 132/257 (51%), Gaps = 14/257 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  ++DN+  +IH+  +   A +D  D   I   L E    L  I  THHH DH    
Sbjct: 5   LTVPAFNDNYLWIIHDGVH--AAVVDPGDATPILAALEEHQLSLVAILLTHHHADHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF---DFGSHPIKIIATPGHTIGHICYH 122
             L + FN  +F P ++   I  + H L DGDT    +   H + ++A PGHT+GHI Y 
Sbjct: 63  AKLLQHFNVPVFAPRKD--PIANVSHPLDDGDTVHIPELDLH-LSVLAVPGHTLGHIAYV 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                +L  GDTLF+ GCGR+FE +  +M  SLEK+ +  D T +Y  HEYT +N  FAL
Sbjct: 120 AAEQGWLFCGDTLFAGGCGRLFEGTPTQMLTSLEKLAALPDDTKVYCAHEYTISNLRFAL 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------NM 236
           + +P N  L       ++ R  ++ T PSTI LEK  NPFLR    ++   L      N 
Sbjct: 180 AAEPDNAALAIRFKAEQAKREADIPTVPSTIGLEKSTNPFLRAREPAIADQLIAAGRVNE 239

Query: 237 ENASNLAVFTELRIRKN 253
            +   +AVF  LR  KN
Sbjct: 240 NDKGPVAVFAALRAWKN 256


>gi|257061424|ref|YP_003139312.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8802]
 gi|256591590|gb|ACV02477.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8802]
          Length = 257

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 135/248 (54%), Gaps = 10/248 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+++   +  A +D  +   + + L + G  L  IFNTHHH DH  AN  L+++F
Sbjct: 11  DNYIFLLYDADTQTAAVVDPAEPTPVLECLNKLGAQLVAIFNTHHHYDHVGANNQLQQYF 70

Query: 73  -NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF------MN 125
            N  I+G  E+  +IPG    L +GD  +FG    +++  PGHT  HI Y+F        
Sbjct: 71  PNLCIYGGSEDRGRIPGQQVFLKEGDRVEFGQRVGEVLFVPGHTRAHIAYYFPPKFPQQT 130

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
               C GDTLF  GCGR+FE +  +M  SL K+++  D T ++  HEYT  N  FAL+ D
Sbjct: 131 GELFC-GDTLFGGGCGRLFEGTPTQMVNSLTKLRNLPDNTRVWCAHEYTLKNLQFALTVD 189

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
             N  L+    +VK  R Q   T PS +  EK  NPFLR +N++++  + M + +   VF
Sbjct: 190 TDNSVLKNRYDQVKEFRHQGQATVPSILGEEKLTNPFLRWDNSAIQSTIGMTDPAR--VF 247

Query: 246 TELRIRKN 253
            +LR  K+
Sbjct: 248 GKLRGMKD 255


>gi|159026149|emb|CAO88800.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 257

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 140/247 (56%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+++   ++ A +D  +   + + L      L  IFNTHHH DH  AN  L  ++
Sbjct: 11  DNYIFLLYDRAQKIAAVVDPAEPEPVFRRLEALQVDLVAIFNTHHHGDHVGANQALINRY 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----NDH 127
            +  ++G  E+  +IPG    L +GD  +F     ++   PGHT  HI Y+F      D+
Sbjct: 71  PHLCVYGGKEDRGRIPGQQLFLEEGDWVEFAGRRAEVFFVPGHTRAHIAYYFPPVNPGDY 130

Query: 128 F-LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFS GCGR+FE +  +M  SL K++S  D T ++  HEYT NN  FAL+ DP
Sbjct: 131 GELFCGDTLFSGGCGRLFEGTPGQMVASLTKLRSLPDWTRVWCAHEYTLNNLKFALTVDP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
           +N  LQ+   +V+  R++++ T P+ +  EK  NPFLR ++ +L   + M+++  + VF 
Sbjct: 191 NNAALQQRYREVEKNRAEDIPTIPAILGTEKLTNPFLRWDSPAL--AMTMDSSEPVQVFA 248

Query: 247 ELRIRKN 253
            LR +K+
Sbjct: 249 RLRGKKD 255


>gi|327480859|gb|AEA84169.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri DSM 4166]
          Length = 270

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R   A+D  D   +   L    GW L+ I  THHH DH    
Sbjct: 17  ALPAFTDNYIWLLQDDAARRCVAVDPGDAAPVLDWLSAHPGWQLSDILVTHHHHDHVGGV 76

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK      ++GP  E  KIP  D  LSDG   +     ++IIA PGHT+GHI Y H  
Sbjct: 77  ERLKAQTGARVYGPAAE--KIPARDEALSDGQRIEVLGKRLQIIAVPGHTLGHIAYFHAD 134

Query: 125 NDH-FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            D  +L  GDTLF+ GCGR+FE +  +MFESL ++ S  D T +Y  HEYT +N  FA +
Sbjct: 135 PDQPWLLSGDTLFAAGCGRLFEGTPEQMFESLTRLASAPDHTLVYCTHEYTLSNLRFAQA 194

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +PHN ++     +V  +R    ++ PS + +E+K NPFLR E  ++R+  +       A
Sbjct: 195 VEPHNADIAARIGEVTQLREAGRFSLPSRLDIERKTNPFLRSEVEAVRQAASQHCSSPLA 254

Query: 240 SNLAVFTELRIRKNQ 254
           +N+AVF  LR  K++
Sbjct: 255 TNVAVFAALRAWKDR 269


>gi|172087738|ref|YP_205321.2| hydroxyacylglutathione hydrolase [Vibrio fischeri ES114]
 gi|212286064|sp|Q5E3G3|GLO2_VIBF1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|171902328|gb|AAW86433.2| hydroxyacylglutathione hydrolase [Vibrio fischeri ES114]
          Length = 252

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 142/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN+       +D  D   + + ++E  + L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHNNDNH-CVVVDPGDATPVLECIKEHDFILDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F N  + GP  E+  IP + H + DGD  +       ++  PGHT GH+ Y  + 
Sbjct: 65  ELVRQFPNVNVVGP--ENEPIPTLTHPVGDGDFVELFDEQFMVLGVPGHTNGHVAY--IG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  FAL+ +
Sbjct: 121 DEKLFCGDALFSAGCGRLFEGTAEQMFNSLQKMAALPDETEVYCAHEYTASNLAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N  L +Y  KV  +R+    T PST+  EK +NPFLR    +++K++   +++++ + 
Sbjct: 181 PDNDYLLRYREKVLHLRAHGKSTIPSTLQREKLINPFLRTSEANVKKSVASKVQDSTEVE 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  K++
Sbjct: 241 IFTALRRWKDE 251


>gi|146282602|ref|YP_001172755.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri A1501]
 gi|145570807|gb|ABP79913.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri A1501]
          Length = 292

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R   A+D  D   +   L    GW L+ I  THHH DH    
Sbjct: 39  ALPAFTDNYIWLLQDDAARRCVAVDPGDAAPVLNWLSAHPGWQLSDILVTHHHHDHVGGV 98

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK      ++GP  E  KIP  D  LSDG   +     ++IIA PGHT+GHI Y H  
Sbjct: 99  ERLKAQTGARVYGPAAE--KIPARDEALSDGQRIEVLGKRLQIIAVPGHTLGHIAYFHAD 156

Query: 125 NDH-FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            D  +L  GDTLF+ GCGR+FE +  +MFESL ++ S  D T +Y  HEYT +N  FA +
Sbjct: 157 PDQPWLLSGDTLFAAGCGRLFEGTPEQMFESLTRLASAPDHTLVYCTHEYTLSNLRFAQA 216

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +PHN ++     +V  +R    ++ PS + +E+K NPFLR E  ++R+  +       A
Sbjct: 217 VEPHNADIAARIGEVTQLREAGRFSLPSRLDIERKTNPFLRSEVEAVRQAASQHCGSPLA 276

Query: 240 SNLAVFTELRIRKNQ 254
           +N+AVF  LR  K++
Sbjct: 277 TNVAVFAALRAWKDR 291


>gi|254228409|ref|ZP_04921835.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|262393543|ref|YP_003285397.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
 gi|151938997|gb|EDN57829.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|262337137|gb|ACY50932.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
          Length = 252

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 140/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAKPVLEYLQANELTLEAILITHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F    + GP  +S  IP +   + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPEVAVVGP--KSEPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLNKLTSLPEETQVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N+   +
Sbjct: 181 PDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTTNPDVVQSVASRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|197103900|ref|YP_002129277.1| hydroxyacylglutathione hydrolase [Phenylobacterium zucineum HLK1]
 gi|196477320|gb|ACG76848.1| hydroxyacylglutathione hydrolase [Phenylobacterium zucineum HLK1]
          Length = 241

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 119/214 (55%), Gaps = 6/214 (2%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ +    L A +D P+   I + L   GW L  I NTH H DH   N  +K   
Sbjct: 13  DNYGFLVRDEASGLAACVDTPEAGAILRELDRLGWTLALILNTHWHPDHAGGNEEIKART 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
              + GP +E ++I  +D  +  GD    G    ++I + GHT+GH+ Y+   D    VG
Sbjct: 73  GAKVVGP-KEVTRIAPLDREVQGGDEVLLGETRFRVIESGGHTLGHVAYYDAEDGIAFVG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC--DPHNLE 190
           DTLF+LGCGR+FE +  +M+ SL ++ +  D T +Y  HEYTE NA FALS   DP    
Sbjct: 132 DTLFALGCGRLFEGTPEQMWASLSRLAALPDDTRVYCAHEYTEANARFALSLGDDP---V 188

Query: 191 LQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           L+   ++V + R++   T P+TI LEK  NPFLR
Sbjct: 189 LKARATEVFAARARGEPTVPTTIGLEKATNPFLR 222


>gi|260899806|ref|ZP_05908201.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ4037]
 gi|308107251|gb|EFO44791.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ4037]
          Length = 252

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 141/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   +   L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAQPVLDYLQANELTLEAILVTHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F + T+ GP  ++  IP +   + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPHVTVVGP--KAEPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MF+SL KI +  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DSKLFCGDVLFSAGCGRIFEGTPEQMFDSLSKIAALPEETQVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L++Y   V  +R+ N+ T P+T+  EK +NPFLR  N  + K++   ++N+   +
Sbjct: 181 PDNEQLRQYRDDVNRLRALNIPTLPTTLRKEKWINPFLRTTNPDVVKSVANRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|312883830|ref|ZP_07743549.1| hydroxyacylglutathione hydrolase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368579|gb|EFP96112.1| hydroxyacylglutathione hydrolase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 252

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 140/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D+  +   L +    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIENSDKR-CAIVDPGDSAPVLDYLAQHNLVLEAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +++    + GP EE   IP + H +S GD  +  +    ++   GHT+GHI Y  + 
Sbjct: 65  ELVRQYPGINVVGPKEEP--IPTLTHAVSGGDQIELFNEIFMVLDIGGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +M  SL+KI +  D+T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMHSSLQKIAALPDETEVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P N  LQ+Y  +V  MR+Q + T P+++  EK +NPFLR E  ++ ++++       +LA
Sbjct: 181 PENPYLQQYRDEVNRMRAQQIPTLPTSLQREKLINPFLRTEEKNIVRSVSNRTVKTDSLA 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|315179367|gb|ADT86281.1| hydroxyacylglutathione hydrolase GloB, hypothetical [Vibrio
           furnissii NCTC 11218]
          Length = 252

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 135/251 (53%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   +   L +    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDRR-CAVVDPGDAAPVLAYLSQHDLTLEAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +++ N  + GP +E   IP + H +  GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVRQYPNVDVVGPSQE--PIPTLTHPVDAGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T +Y  HEYT +N  FA++ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFTSLSKLVALPEETEVYCAHEYTASNVAFAMAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +LQ Y  +V  +R Q   T PST+  EK +NPFLR +  S+ K++         L+
Sbjct: 181 PDNEQLQIYRDEVIRLRGQGYSTLPSTVRREKWINPFLRTQEPSVMKSVANRTPQTDALS 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|298491671|ref|YP_003721848.1| hydroxyacylglutathione hydrolase ['Nostoc azollae' 0708]
 gi|298233589|gb|ADI64725.1| hydroxyacylglutathione hydrolase ['Nostoc azollae' 0708]
          Length = 257

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 139/258 (53%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++ +  +   +D  ++  + K L++    L  IFNTHHH DH   N
Sbjct: 4   IRLSALSDNYIFLLYDSQQDIAVVVDPAESEPVLKHLQQIKAKLVAIFNTHHHDDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L ++F    ++G +E+  +IP     L +GD   F +   K+   PGHT  HI Y+F 
Sbjct: 64  QQLIQEFPELKVYGGIEDQGRIPRQQVFLQEGDHVPFANRTAKVFFVPGHTRAHIAYYFP 123

Query: 125 ------NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                      C GDTLF+ GCGR+FE + A+M +SL K+++  D T I+  HEYT NN 
Sbjct: 124 PVTTGDTGELFC-GDTLFAGGCGRLFEGTPAQMLDSLSKLRALPDNTRIWCAHEYTLNNL 182

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL+ D  N +L K   +V +MR +   T PS + +EK+ NPFLR +  SL+    +  
Sbjct: 183 RFALTVDGDNPDLGKRYKEVIAMRKRQEATVPSLLEVEKRTNPFLRWDKPSLQ----LSA 238

Query: 239 ASNLAVFTELRIRKNQSK 256
            SN AV T   IR  + K
Sbjct: 239 KSNEAVQTFAWIRSMKDK 256


>gi|254418722|ref|ZP_05032446.1| metallo-beta-lactamase superfamily protein [Brevundimonas sp. BAL3]
 gi|196184899|gb|EDX79875.1| metallo-beta-lactamase superfamily protein [Brevundimonas sp. BAL3]
          Length = 242

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 121/212 (57%), Gaps = 3/212 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWF-LTHIFNTHHHIDHTRANLNLKKF 71
           DN+  LI +    + AA+D PD   I + L   GW  L  I NTH H DHT  N  LK  
Sbjct: 13  DNYGFLIRDTATGVVAAVDTPDAERILQELEALGWGRLDLILNTHWHPDHTEGNERLKAE 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
             C I GP EE  ++  +D  ++DGD    G    ++ ATPGHT+GH+ +  + +    V
Sbjct: 73  TGCEIVGP-EEVRRVAPLDRVVADGDVVMVGETRFEVTATPGHTLGHVVFRSVENQLAFV 131

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF+LGCGR+FE +  +M+ SL+ + ++ + T I+  HEYT +NA F L+ D    E 
Sbjct: 132 GDTLFALGCGRLFEGTPEQMWASLQALAAWPEATVIWCAHEYTASNARFTLTLD-DRPET 190

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFL 223
           + +   + + R++   T P+TI  E++ NPFL
Sbjct: 191 RAHAEAIFAARARGEPTVPTTIGTERRFNPFL 222


>gi|302381933|ref|YP_003817756.1| hydroxyacylglutathione hydrolase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192561|gb|ADL00133.1| hydroxyacylglutathione hydrolase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 242

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 118/212 (55%), Gaps = 3/212 (1%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWF-LTHIFNTHHHIDHTRANLNLKKF 71
           DN+  L  +      AAID PD  +I   +   GW  L  I NTH H DHT  N  L+  
Sbjct: 13  DNYAFLARDEATGTVAAIDTPDAQVILDGIAALGWGRLDRIINTHWHPDHTEGNARLQAE 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCV 131
             C I+GP EE  K+  +D  + +GD    G   + + ATPGH++GH+ +  + D     
Sbjct: 73  TGCDIWGP-EEVRKVAPLDRVVEEGDLVTIGQTRLHVTATPGHSLGHVVFRSVEDGIAFT 131

Query: 132 GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLEL 191
           GDTLF LGCGR+FE +  +M++SL ++ ++ D+T +Y  HEYT  NA F LS D    E+
Sbjct: 132 GDTLFPLGCGRLFEGTPEQMWDSLSRLLAWPDQTVLYGAHEYTAANARFTLSVD-DRAEV 190

Query: 192 QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFL 223
             +   + + R +   T P+T+++E+  NPFL
Sbjct: 191 AAHADTIFAARERGEPTVPTTMAVERAFNPFL 222


>gi|71726091|gb|AAZ39214.1| putative hydroxyacylglutathione hydrolase [Janthinobacterium
           lividum]
          Length = 269

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 138/261 (52%), Gaps = 18/261 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  LIH+ ++   A +D  D   I   L+     LT I  THHH DHT   
Sbjct: 12  LAVPAFADNYLWLIHDGRH--AAVVDPGDAMAILDALQAHQLTLTAILLTHHHADHTGGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF---DFGSHPIKIIATPGHTIGHICYH 122
             L + F   +FGP  E+  I  I   L++GD     + G   + +I  PGHT GHI Y 
Sbjct: 70  PELLQHFAVPVFGPRNEA--ITAITEPLAEGDVAYVPELGLQ-MTVIDVPGHTKGHIAYV 126

Query: 123 FMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
              D      +L  GDTLF+ GCGR+FE +  +M +SL K+ +  D T ++  HEYT +N
Sbjct: 127 RQRDERSGAPWLFSGDTLFAGGCGRLFEGTPGQMADSLGKLAALPDDTEVFCAHEYTLSN 186

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA + +P N+ LQ+  +     R Q L T PSTI+LEK  NPFLR    ++  +L +E
Sbjct: 187 LRFANAVEPGNVALQERIAIDTEKRQQGLSTVPSTIALEKATNPFLRYREPAILTSLKVE 246

Query: 238 -----NASNLAVFTELRIRKN 253
                +AS +  F  LR+ KN
Sbjct: 247 GKLASDASPVEAFAALRMWKN 267


>gi|167034711|ref|YP_001669942.1| hydroxyacylglutathione hydrolase [Pseudomonas putida GB-1]
 gi|226724009|sp|B0KN02|GLO2_PSEPG RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166861199|gb|ABY99606.1| hydroxyacylglutathione hydrolase [Pseudomonas putida GB-1]
          Length = 259

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 136/256 (53%), Gaps = 13/256 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAAPVERWLAANPEWVLSDILVTHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E  +IPG D  L +GD  D      +++A PGHT+GHI   F +
Sbjct: 66  ERLKQLSGARVCGPANE--RIPGRDLALDEGDKVDVLGVTFQVLAVPGHTLGHIA--FFS 121

Query: 126 D----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N  FA
Sbjct: 122 DGPPTPVLFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTEVYCAHEYTLSNLRFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----E 237
            + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++  +      
Sbjct: 182 KAVEPTNTHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEWKGHS 241

Query: 238 NASNLAVFTELRIRKN 253
           N S++AVF  LR  K+
Sbjct: 242 NTSHVAVFAALRSWKD 257


>gi|254414720|ref|ZP_05028485.1| metallo-beta-lactamase superfamily protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178568|gb|EDX73567.1| metallo-beta-lactamase superfamily protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 257

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 136/248 (54%), Gaps = 8/248 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H  K  + A +D  +   + + L + G  L  IFNTHHH DH   N  L +++
Sbjct: 11  DNYIFLLHEPKQNIAAVVDPAEAQPVLQHLEKLGAELVTIFNTHHHWDHVGGNQELIQRY 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF---MNDHF 128
            +  ++G  ++  +IPG    L +GD   F     +I   PGHT GHI Y+F    +D  
Sbjct: 71  PDVCVYGGTQDRGRIPGQQVFLQEGDEVQFSDRTAEIFFVPGHTSGHIAYYFPPVTSDEV 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE +  +M +SL K++   D T ++  HEYT  N  FA + DP
Sbjct: 131 GELFCGDTIFAGGCGRLFEGTPKQMVDSLSKLRRLPDNTRVWCAHEYTLKNLKFAQTVDP 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
           +N +LQ   + V++ R +   T PS + +EK  NPFLR E  +L++ +  ++   +  F 
Sbjct: 191 NNPDLQSRYTDVEAARRRKEATVPSLLGVEKLTNPFLRWEQPTLQEAV--KSTEPVQTFA 248

Query: 247 ELRIRKNQ 254
            LR  K++
Sbjct: 249 RLRGMKDK 256


>gi|156975482|ref|YP_001446389.1| hydroxyacylglutathione hydrolase [Vibrio harveyi ATCC BAA-1116]
 gi|171769915|sp|A7MY07|GLO2_VIBHB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|156527076|gb|ABU72162.1| hypothetical protein VIBHAR_03213 [Vibrio harveyi ATCC BAA-1116]
          Length = 252

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 140/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAKPVLEYLQANELTLEAILITHHHNDHIGGVS 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F + ++ GP  ++  IP + + + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPHVSVVGP--KAEPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + +++   +EN+   +
Sbjct: 181 PDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIQSVTNRIENSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|197335822|ref|YP_002156767.1| hydroxyacylglutathione hydrolase [Vibrio fischeri MJ11]
 gi|226724035|sp|B5F9V3|GLO2_VIBFM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|197317312|gb|ACH66759.1| hydroxyacylglutathione hydrolase [Vibrio fischeri MJ11]
          Length = 252

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 142/251 (56%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN+       +D  D   + + ++E  + L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHNNDNH-CVVVDPGDATPVLECIKEHDFILDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F +  + GP  E+  IP + H + DGD  +       ++  PGHT GH+ Y  + 
Sbjct: 65  ELVRQFPSVNVVGP--ENEPIPTLTHPVGDGDFVELFDEQFMVLGVPGHTNGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  FAL+ +
Sbjct: 121 DEKLFCGDALFSAGCGRLFEGTAEQMFNSLQKMAALPDETEVYCAHEYTASNLAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N  L +Y  KV  +R+    T PST+  EK +NPFLR    +++K++   +++++ + 
Sbjct: 181 PDNDYLLRYREKVLHLRAHGKSTIPSTLQREKLINPFLRTSEANVKKSVASKVQDSTEVE 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  K++
Sbjct: 241 IFTALRRWKDE 251


>gi|313498006|gb|ADR59372.1| GloB [Pseudomonas putida BIRD-1]
          Length = 259

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 136/256 (53%), Gaps = 13/256 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     + GP  E  +IPG D  L +GD  D      +++A PGHT+GHI   F +
Sbjct: 66  ERLRQLTGARVCGPANE--RIPGRDLALDEGDRVDVLGVTFQVLAVPGHTLGHIA--FFS 121

Query: 126 DH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N  FA
Sbjct: 122 DQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTQVYCAHEYTLSNLRFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----E 237
            + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++  +      
Sbjct: 182 KAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEWKGHS 241

Query: 238 NASNLAVFTELRIRKN 253
           N S++AVF  LR  K+
Sbjct: 242 NTSHVAVFAALRSWKD 257


>gi|226952625|ref|ZP_03823089.1| hydroxyacylglutathione hydrolase (GloB) [Acinetobacter sp. ATCC
           27244]
 gi|294649939|ref|ZP_06727331.1| hydroxyacylglutathione hydrolase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226836614|gb|EEH68997.1| hydroxyacylglutathione hydrolase (GloB) [Acinetobacter sp. ATCC
           27244]
 gi|292824168|gb|EFF82979.1| hydroxyacylglutathione hydrolase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 243

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 122/216 (56%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  L+ +   +   AID  +  ++     +    L  I+ TH H DHT    +L    N
Sbjct: 16  NYIWLLEDTTTKQVVAIDPTEASLVKDFCEQHHLQLQQIWLTHWHPDHTGGVEDLSANEN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKI  I + L   D F F    ++IIATPGHT+GHI Y       L  GD
Sbjct: 76  IAVYGPRDELSKISFISNPLQQDDHFHFNDLKVEIIATPGHTLGHIVYFIEAIDALFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +   +T +Y  HEYT  NA FA++ +PHN+ LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPIQTKVYCTHEYTLANAEFAITIEPHNVALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
              +V+++R  N  T PSTI LE   NPFLR E+  
Sbjct: 196 RMKQVRALRETNQITLPSTIELELATNPFLRTESAE 231


>gi|67922175|ref|ZP_00515690.1| Hydroxyacylglutathione hydrolase [Crocosphaera watsonii WH 8501]
 gi|67856075|gb|EAM51319.1| Hydroxyacylglutathione hydrolase [Crocosphaera watsonii WH 8501]
          Length = 257

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 137/248 (55%), Gaps = 10/248 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+      A +D  +   + K L E G  L  I NTHHH DH  AN  L KKF
Sbjct: 11  DNYIFLLHDPHNNTAAVVDPAEAKPVLKCLDELGAKLVAILNTHHHADHVGANKKLMKKF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-----ND 126
            +  I+G  E+  +IPG    L +GDT  F     K+   PGHT GHI Y+F        
Sbjct: 71  PDVCIYGGKEDQGRIPGQQVFLEEGDTVKFAEKMAKVYFVPGHTRGHIAYYFPPHDSEGK 130

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE + A+M  SL K+++  D T ++  HEYT +N  FA++ + 
Sbjct: 131 GDLFCGDTIFAGGCGRLFEGTPAQMVNSLTKLRNLPDNTRVWCAHEYTLSNLKFAVTVEQ 190

Query: 187 HNLELQ-KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
            N ELQ +Y + +K+ ++Q   T PS +  EKK NPFLR +  +L+    M + +   VF
Sbjct: 191 DNNELQNRYQAIIKARKNQQA-TVPSLLGEEKKTNPFLRWDQPALQSLTGMNDPAR--VF 247

Query: 246 TELRIRKN 253
            ++R  K+
Sbjct: 248 GQIRGMKD 255


>gi|71082924|ref|YP_265643.1| hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91762652|ref|ZP_01264617.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|123647338|sp|Q4FP49|GLO2_PELUB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71062037|gb|AAZ21040.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91718454|gb|EAS85104.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 239

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 123/217 (56%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  LI +    +   ID  +   + K L +K   L +I NTHHH DH   N  
Sbjct: 6   IRCLQDNYSYLIVDKAKNIACVIDPSEAKPVIKYLEDKNIHLKYILNTHHHYDHVGGNKE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+ +  ++ G   +  +IP ID  + D D +   +   KI   PGHT+GHIC++F N+ 
Sbjct: 66  LKEKYGASVIGYKGDKDRIPEIDILVGDQDIWHEENFQAKIFHIPGHTLGHICFYFYNEE 125

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFSLGCG+IFE +Y++M+ SL KIK+  +KT IY GHEYT+ N+ F ++ D  
Sbjct: 126 SVFTGDTLFSLGCGKIFEGTYSQMYNSLMKIKALPEKTKIYCGHEYTKQNSKFCIAHDQD 185

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           N  L+     +     +NL T PSTI  E + N FLR
Sbjct: 186 NENLKVKIKLIDEKLEKNLPTIPSTIKEELECNIFLR 222


>gi|269960614|ref|ZP_06174986.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio harveyi
           1DA3]
 gi|269834691|gb|EEZ88778.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio harveyi
           1DA3]
          Length = 252

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDKR-CAVVDPGDAKPVLEYLKANELTLEAILITHHHNDHIGGVP 64

Query: 67  NLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L   F + ++ GP  ++  IP + + + +GD  +       ++  PGHT+GHI Y    
Sbjct: 65  DLVHAFPHVSVVGP--KAEPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIGY--AG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + K++   +EN+   +
Sbjct: 181 PDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIKSVTNRIENSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|184158714|ref|YP_001847053.1| Zn-dependent hydrolase [Acinetobacter baumannii ACICU]
 gi|332873707|ref|ZP_08441650.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6014059]
 gi|183210308|gb|ACC57706.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii ACICU]
 gi|322507475|gb|ADX02929.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii 1656-2]
 gi|323518628|gb|ADX93009.1| Zn-dependent hydrolase, including glyoxylase [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332738095|gb|EGJ68979.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6014059]
          Length = 243

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 122/215 (56%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + +     A+D  +  +++   +E    L  I+ TH H DH     +L    +
Sbjct: 16  NYIWILEDTETHEAVAVDPTEAELVTHFCQEHQLTLKQIWLTHWHKDHIGGVADLTANTS 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y     + L  GD
Sbjct: 76  MAVYGPRDELSKIPGITHPLQHDDHLKFNDLNVEIIATPGHTLGHIVYFIEELNALFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPTATKVYCTHEYTLSNAEFALSVEPENHALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+ +R +   T PS+I LE   NPFLR E+ 
Sbjct: 196 RAEQVRMLRQEGKITLPSSIELELATNPFLRAESV 230


>gi|304408607|ref|ZP_07390228.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS183]
 gi|307305435|ref|ZP_07585183.1| hydroxyacylglutathione hydrolase [Shewanella baltica BA175]
 gi|304352428|gb|EFM16825.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS183]
 gi|306911738|gb|EFN42163.1| hydroxyacylglutathione hydrolase [Shewanella baltica BA175]
          Length = 263

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 138/260 (53%), Gaps = 17/260 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQQTHTQVYVVDPGDASVVIDYLEANKLTLAGILLTHHHNDHTGGVA 65

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGD----TFDFGSHPIKIIATPGHTIGHIC 120
            L+ +     T++GP  ++ KI GI H L+       T D+ S  ++++  PGHT GHI 
Sbjct: 66  ELQAYSQDRLTVYGP--DNEKIEGITHPLNATAQPRLTLDYMSGELQVLDVPGHTAGHIA 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y  + D   C GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +N  F
Sbjct: 124 Y-VIADALFC-GDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLSNLRF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-------KN 233
           AL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +         +
Sbjct: 182 ALAVNPNNRALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQHFSD 241

Query: 234 LNMENASNLAVFTELRIRKN 253
           LN  N   L  FT LR  K+
Sbjct: 242 LNHANLDELGGFTLLRQWKD 261


>gi|26990837|ref|NP_746262.1| hydroxyacylglutathione hydrolase [Pseudomonas putida KT2440]
 gi|81439999|sp|Q88FF3|GLO2_PSEPK RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24985845|gb|AAN69726.1|AE016608_12 hydroxyacylglutathione hydrolase [Pseudomonas putida KT2440]
          Length = 259

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 136/256 (53%), Gaps = 13/256 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     + GP  E  +IPG D  L +GD  D      +++A PGHT+GHI   F +
Sbjct: 66  ERLRQLTGARVCGPANE--RIPGRDLALDEGDRVDVLGVTFQVMAVPGHTLGHIA--FFS 121

Query: 126 DH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N  FA
Sbjct: 122 DQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTQVYCAHEYTLSNLRFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----E 237
            + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++  +      
Sbjct: 182 KAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTAETLVKQKADEWKGHS 241

Query: 238 NASNLAVFTELRIRKN 253
           N S++AVF  LR  K+
Sbjct: 242 NNSHVAVFAALRSWKD 257


>gi|229513879|ref|ZP_04403341.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229349060|gb|EEO14017.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
          Length = 252

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 136/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  LI N + R  A +D      +   L++    L  +  THHH DH     
Sbjct: 6   SIPAFDDNYIWLIQN-RDRDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++  + ++   L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVSTQDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|297580878|ref|ZP_06942803.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297534704|gb|EFH73540.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 252

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  LI N + R  A +D      +   L++    L  +  THHH DH     
Sbjct: 6   SIPAFDDNYIWLIQN-RDRDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--IG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAGNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVSTLDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|169633195|ref|YP_001706931.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter
           baumannii SDF]
 gi|169795485|ref|YP_001713278.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter
           baumannii AYE]
 gi|213158576|ref|YP_002319874.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB0057]
 gi|215482970|ref|YP_002325175.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii
           AB307-0294]
 gi|239501417|ref|ZP_04660727.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB900]
 gi|301346707|ref|ZP_07227448.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB056]
 gi|301513470|ref|ZP_07238707.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB058]
 gi|301595178|ref|ZP_07240186.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB059]
 gi|332855196|ref|ZP_08435747.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6013150]
 gi|332866919|ref|ZP_08437260.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6013113]
 gi|169148412|emb|CAM86277.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter
           baumannii AYE]
 gi|169151987|emb|CAP00851.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter
           baumannii]
 gi|213057736|gb|ACJ42638.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii AB0057]
 gi|213988499|gb|ACJ58798.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii
           AB307-0294]
 gi|332727573|gb|EGJ58995.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6013150]
 gi|332734342|gb|EGJ65468.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii 6013113]
          Length = 243

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 121/215 (56%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + +     A+D  +  +++   +E    L  I+ TH H DH     +L     
Sbjct: 16  NYIWILEDTETHEAVAVDPTEAELVTHFCQEHQLTLKQIWLTHWHKDHIGGVADLTANTP 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y     + L  GD
Sbjct: 76  MAVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELNALFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPTATKVYCTHEYTLSNAEFALSVEPENHALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+ +R +   T PS+I LE   NPFLR E+ 
Sbjct: 196 RAEQVRMLRQEGKITLPSSIELELATNPFLRAESV 230


>gi|284929263|ref|YP_003421785.1| hydroxyacylglutathione hydrolase [cyanobacterium UCYN-A]
 gi|284809707|gb|ADB95404.1| hydroxyacylglutathione hydrolase [cyanobacterium UCYN-A]
          Length = 258

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 141/243 (58%), Gaps = 8/243 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+HN K +    +D  +  +I   L + G  LT I NTHHH DH  AN  L + F
Sbjct: 11  DNYIFLLHNFKNKTAVVVDPAEYDVIINCLNKLGIRLTAILNTHHHQDHIGANKKLIEHF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF---MNDHF 128
            + +++G  ++  +IPG +H L +GD F+F     +I   PGHT GHI Y+F    N   
Sbjct: 71  PHISVYGSEQDKGRIPGQNHYLKEGDQFNFAGKNAEIFFIPGHTNGHIAYYFPPSSNQKI 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF+ GCGR+FE + ++M++SL K+++  D T ++  HEYT NN  FAL+ + 
Sbjct: 131 GELFCGDTLFASGCGRLFEGTASQMYKSLMKLRNLPDTTRVWCSHEYTLNNLKFALTIEK 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
           +N  L    +K  S R  N  T PS +  EK+ NPFLR ++ SL++ + + +   + VF 
Sbjct: 191 NNHNLLLRYNKAISTRKNNKATIPSFLKEEKETNPFLRCDSQSLQEIMGINDP--VKVFQ 248

Query: 247 ELR 249
           ++R
Sbjct: 249 KIR 251


>gi|146307092|ref|YP_001187557.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina ymp]
 gi|226724007|sp|A4XU09|GLO2_PSEMY RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145575293|gb|ABP84825.1| Hydroxyacylglutathione hydrolase [Pseudomonas mendocina ymp]
          Length = 257

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/253 (34%), Positives = 130/253 (51%), Gaps = 7/253 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L   G W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDPISRRCAVVDPGDAAPVLAWLEAHGDWTLSDILITHHHFDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LKK     + GP  E  KIP  D  L D D  +      +I+A PGHT+GHI Y+   
Sbjct: 66  EQLKKATGARVAGPAAE--KIPARDVDLGDNDLIEVLGLRFQIMAVPGHTLGHIAYYHAE 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            + L  GDTLF+ GCGR+FE +  +M +SL ++ +    T +Y  HEYT +N  FA + +
Sbjct: 124 QNLLLCGDTLFAGGCGRLFEGTPQQMHQSLSRLAALPGATRVYCTHEYTLSNLRFAHAVE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKNLNMENASN 241
           PHN ++    ++V   R +   + PS+I LE   NPFLR     +    ++N    ++  
Sbjct: 184 PHNPDVSARLAEVSRWRDEGRISLPSSIELELATNPFLRTGEPGVIKAAKRNDERSSSEP 243

Query: 242 LAVFTELRIRKNQ 254
            AVF  LR  K++
Sbjct: 244 SAVFASLRAWKDR 256


>gi|158338875|ref|YP_001520052.1| hydroxyacylglutathione hydrolase [Acaryochloris marina MBIC11017]
 gi|189041215|sp|B0BZI8|GLO2_ACAM1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|158309116|gb|ABW30733.1| hydroxyacylglutathione hydrolase, putative [Acaryochloris marina
           MBIC11017]
          Length = 257

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 136/254 (53%), Gaps = 10/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++H+    + A +D  D   + K L E G  L  IFNTHHH DH   N  
Sbjct: 6   LPAFSDNYIFVLHDPGQNIAAVVDPADPQPVLKKLAELGAELVAIFNTHHHSDHVGGNRT 65

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN- 125
           L + F N  ++G  ++  +IPG  H L +GD   F     ++   PGHT  HI Y+F   
Sbjct: 66  LLQAFPNTVVYGGEQDRGRIPGQQHFLKEGDQVSFAHRRAEVYFVPGHTRAHIAYYFPPT 125

Query: 126 -----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                    C GDTLF+ GCGR+FE + A+M +SL K+++  + T ++  HEYT  N  F
Sbjct: 126 TGEEWGELFC-GDTLFAGGCGRLFEGTPAQMVDSLSKLRNLPETTRVWCAHEYTLKNLQF 184

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ D  N  L+    +V++ R+ +  T PS I LEK+ NPFLR +   L   ++ ++ +
Sbjct: 185 ALTVDSDNSHLKNRFKQVQNARNLSQPTVPSDIGLEKQTNPFLRWDQPHLI--IHTKSNT 242

Query: 241 NLAVFTELRIRKNQ 254
            +  F  LR  K+Q
Sbjct: 243 PVQCFARLRGMKDQ 256


>gi|15642234|ref|NP_231867.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121586283|ref|ZP_01676073.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           2740-80]
 gi|121726557|ref|ZP_01679806.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V52]
 gi|147673202|ref|YP_001217752.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|153213781|ref|ZP_01948989.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           1587]
 gi|153817113|ref|ZP_01969780.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           NCTC 8457]
 gi|153820855|ref|ZP_01973522.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           B33]
 gi|153825354|ref|ZP_01978021.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-2]
 gi|153829953|ref|ZP_01982620.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           623-39]
 gi|183179464|ref|ZP_02957675.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-3]
 gi|227082360|ref|YP_002810911.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           M66-2]
 gi|229507689|ref|ZP_04397194.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229512116|ref|ZP_04401595.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229519251|ref|ZP_04408694.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229522183|ref|ZP_04411600.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229528760|ref|ZP_04418150.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229607193|ref|YP_002877841.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254286455|ref|ZP_04961412.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           AM-19226]
 gi|254849367|ref|ZP_05238717.1| hydroxyacylglutathione hydrolase GloB [Vibrio cholerae MO10]
 gi|255747066|ref|ZP_05421011.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262161389|ref|ZP_06030499.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262167741|ref|ZP_06035443.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|262192143|ref|ZP_06050304.1| hydroxyacylglutathione hydrolase [Vibrio cholerae CT 5369-93]
 gi|298500389|ref|ZP_07010194.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MAK 757]
 gi|81544528|sp|Q9KPX6|GLO2_VIBCH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|172047617|sp|A5F635|GLO2_VIBC3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798851|sp|C3LPP0|GLO2_VIBCM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|9656795|gb|AAF95380.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121549549|gb|EAX59575.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           2740-80]
 gi|121631010|gb|EAX63389.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V52]
 gi|124115705|gb|EAY34525.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           1587]
 gi|126512381|gb|EAZ74975.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           NCTC 8457]
 gi|126521647|gb|EAZ78870.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           B33]
 gi|146315085|gb|ABQ19624.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|148874588|gb|EDL72723.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           623-39]
 gi|149741038|gb|EDM55107.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-2]
 gi|150423404|gb|EDN15348.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           AM-19226]
 gi|183012875|gb|EDT88175.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-3]
 gi|227010248|gb|ACP06460.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           M66-2]
 gi|227014132|gb|ACP10342.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|229332534|gb|EEN98020.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229341108|gb|EEO06113.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229343940|gb|EEO08915.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229352081|gb|EEO17022.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229355194|gb|EEO20115.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229369848|gb|ACQ60271.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254845072|gb|EET23486.1| hydroxyacylglutathione hydrolase GloB [Vibrio cholerae MO10]
 gi|255735468|gb|EET90868.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262023806|gb|EEY42505.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|262028700|gb|EEY47354.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262031992|gb|EEY50569.1| hydroxyacylglutathione hydrolase [Vibrio cholerae CT 5369-93]
 gi|297541082|gb|EFH77136.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MAK 757]
 gi|327484754|gb|AEA79161.1| Hydroxyacylglutathione hydrolase [Vibrio cholerae LMA3894-4]
          Length = 252

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  LI N + R  A +D      +   L++    L  +  THHH DH     
Sbjct: 6   SIPAFDDNYIWLIQN-RDRDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVSTLDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|148546959|ref|YP_001267061.1| hydroxyacylglutathione hydrolase [Pseudomonas putida F1]
 gi|226724008|sp|A5W167|GLO2_PSEP1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|148511017|gb|ABQ77877.1| Hydroxyacylglutathione hydrolase [Pseudomonas putida F1]
          Length = 259

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 136/256 (53%), Gaps = 13/256 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     + GP  E  +IPG D  L +GD  D      +++A PGHT+GHI   F +
Sbjct: 66  ERLRQLTGARVCGPANE--RIPGRDLALDEGDRVDVLGVTFQVLAVPGHTLGHIA--FFS 121

Query: 126 DH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N  FA
Sbjct: 122 DQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTAVYCAHEYTLSNLRFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----E 237
            + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++  +      
Sbjct: 182 KAVEPTNPHVQQRFEDVSRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEWKGHS 241

Query: 238 NASNLAVFTELRIRKN 253
           N +++AVF  LR  K+
Sbjct: 242 NTTHVAVFAALRSWKD 257


>gi|226945030|ref|YP_002800103.1| hydroxyacylglutathione hydrolase [Azotobacter vinelandii DJ]
 gi|226719957|gb|ACO79128.1| hydroxyacylglutathione hydrolase [Azotobacter vinelandii DJ]
          Length = 258

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 135/253 (53%), Gaps = 8/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPD-TYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D T +++ +    GW L  I  THHH DH    
Sbjct: 6   ALPAFQDNYIWLLQDPTTRRIAVVDPGDATPVLAWLEANPGWQLADILITHHHADHIGGA 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP +E  +IP  D  L DG++ +   +  +I+  PGHT  HI Y H  
Sbjct: 66  EILKRTTGARVLGPDDE--RIPARDLTLHDGESVEVLGYAFRILEVPGHTRSHIAYFHAA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLF+ GCGR+FE +  +M  SLE++    + T +Y  HEYT +N  FA + 
Sbjct: 124 AQPWLFCGDTLFAAGCGRLFEGTPGQMRRSLERLAGLPEATLVYCSHEYTLSNLRFAQAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL-- 242
           +P N  + +  ++V + R+    + PS ++LE++ NPFLR   TS+++ +       +  
Sbjct: 184 EPDNPAIARRLAEVTAWRNAGSGSLPSELALERETNPFLRTGETSVKERVARRCGQPMLD 243

Query: 243 --AVFTELRIRKN 253
              VFTELR  K+
Sbjct: 244 PDQVFTELRAWKD 256


>gi|332187416|ref|ZP_08389154.1| hydroxyacylglutathione hydrolase [Sphingomonas sp. S17]
 gi|332012577|gb|EGI54644.1| hydroxyacylglutathione hydrolase [Sphingomonas sp. S17]
          Length = 238

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 120/219 (54%), Gaps = 3/219 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  LIH+     T A+D  +   ++     +GW +  ++ TH H DH    
Sbjct: 4   IRVPVLSDNYAWLIHDDGQ--TVALDPGEAAPVAAAAAARGWTIGQVWLTHWHPDHVGGA 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      + GP  E++KI G+D  L++GD    GS    I + PGHT GHI +H  +
Sbjct: 62  AELRAA-GAHVAGPAAEAAKINGLDTLLAEGDRIAVGSLDATIWSVPGHTAGHIAFHLAD 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +  GDTLF++GCGR+FE + A+M  ++ +  +  + T +Y GHEYT +NA FA   +
Sbjct: 121 RAVIFTGDTLFAMGCGRLFEGTAAQMHANMRRFAALPENTRVYCGHEYTLSNARFAAVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           P N  +    + V +MR     T P+TI+LE+  NPFLR
Sbjct: 181 PDNDAIAARLADVTAMREAGEPTIPTTIALERATNPFLR 219


>gi|217973498|ref|YP_002358249.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS223]
 gi|254798850|sp|B8E5A2|GLO2_SHEB2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|217498633|gb|ACK46826.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS223]
          Length = 263

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 138/260 (53%), Gaps = 17/260 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLAGILLTHHHNDHTGGVA 65

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGD----TFDFGSHPIKIIATPGHTIGHIC 120
            L+ +     T++GP  ++ KI GI H L+       T D+ S  ++++  PGHT GHI 
Sbjct: 66  ELQAYSQDRLTVYGP--DNEKIEGITHPLNATAQPRLTLDYMSGELQVLDVPGHTAGHIA 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y  + D   C GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +N  F
Sbjct: 124 Y-VIADALFC-GDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTFSNLKF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-------KN 233
           AL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +         +
Sbjct: 182 ALAVNPNNRALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQHFSD 241

Query: 234 LNMENASNLAVFTELRIRKN 253
           LN  N   L  FT LR  K+
Sbjct: 242 LNHANLDELGGFTLLRQWKD 261


>gi|90581655|ref|ZP_01237444.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio angustum
           S14]
 gi|90437139|gb|EAS62341.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio angustum
           S14]
          Length = 252

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 145/251 (57%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN K      +D  D   + + + + G+ L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHN-KDNHCVVVDPGDATPVLETIDKFGFTLDAILITHHHHDHIGGIS 64

Query: 67  NLKKFFNCT-IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ F  T + GP+ E   IPG+   + DGD  D       +++ PGHT+GH+ Y  + 
Sbjct: 65  ELKRRFPSTKVVGPVNEP--IPGLTQPVEDGDQVDIFGERFMVLSVPGHTLGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGR+FE + A+MF+SL+KI S  D+T ++  HEYT +N  FAL  +
Sbjct: 121 DEKLFCGDTLFSAGCGRLFEGTPAQMFDSLQKIASLPDETEVFCAHEYTASNLAFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
             N  LQ+Y  KV  +R+    T PST+S EK++NPFLR +  S+++++     + S+L 
Sbjct: 181 QDNPHLQQYRDKVIRLRANGKSTLPSTLSQEKRINPFLRCDQPSIKRSVADKAYDNSDLE 240

Query: 244 VFTELRIRKNQ 254
            F  LR  K++
Sbjct: 241 TFAALRRWKDK 251


>gi|295677147|ref|YP_003605671.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1002]
 gi|295436990|gb|ADG16160.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1002]
          Length = 263

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 140/260 (53%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  +I + ++ +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWVIADGRHAVV--VDPGEAAPVRACLAQRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L    +  ++GP  E+  I  + H L  GD     +  ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQDVPVYGPASEA--IARLTHRLKSGDHVTIAAPALEFSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 AADTGGTPHVFC-GDTLFACGCGRLFEGTPQQMLNSLDALAALPGATEVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME- 237
            FAL+C+PHN ELQ +  K   +R+++  T P+TI+ E+ VNPFLR +  +++ NL  + 
Sbjct: 182 RFALACEPHNAELQAWRDKANELRARHQPTLPTTIAHERAVNPFLRADEPAIQSNLEAQL 241

Query: 238 ---NASNLAVFTELRIRKNQ 254
               +  L  FT +R  KN+
Sbjct: 242 HETVSDRLKAFTLMREWKNR 261


>gi|126174220|ref|YP_001050369.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS155]
 gi|226724022|sp|A3D437|GLO2_SHEB5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|125997425|gb|ABN61500.1| Hydroxyacylglutathione hydrolase [Shewanella baltica OS155]
          Length = 263

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/260 (35%), Positives = 137/260 (52%), Gaps = 17/260 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLAGILLTHHHNDHTGGVA 65

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDT----FDFGSHPIKIIATPGHTIGHIC 120
            L+ +     T++GP  ++ KI GI H L+         D+ S  ++++  PGHT GHI 
Sbjct: 66  ELQAYSQNRLTVYGP--DNEKIEGITHPLNATAQPRFILDYMSGELQVLDVPGHTAGHIA 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y  + D   C GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +N  F
Sbjct: 124 Y-VIADALFC-GDTLFSAGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLSNLKF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-------KN 233
           AL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +         +
Sbjct: 182 ALAVNPNNRALQDYNERAVALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQHFSD 241

Query: 234 LNMENASNLAVFTELRIRKN 253
           LN  N   L  FT LR  K+
Sbjct: 242 LNHANLDELGGFTLLRQWKD 261


>gi|255319482|ref|ZP_05360696.1| hydroxyacylglutathione hydrolase [Acinetobacter radioresistens
           SK82]
 gi|262378494|ref|ZP_06071651.1| hydroxyacylglutathione hydrolase [Acinetobacter radioresistens
           SH164]
 gi|255303422|gb|EET82625.1| hydroxyacylglutathione hydrolase [Acinetobacter radioresistens
           SK82]
 gi|262299779|gb|EEY87691.1| hydroxyacylglutathione hydrolase [Acinetobacter radioresistens
           SH164]
          Length = 243

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 120/215 (55%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
            N+  ++ +   +    +D  +  ++    + +   L+ I+ TH H DH      L    
Sbjct: 15  QNYIWILEDSSTKEAVVVDPTEAQLVQDFCQTRNLILSQIWLTHWHKDHIGGVPELITER 74

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  ++GP EE S IP I H L   + F F    + I+A PGHT+GHI Y       L  G
Sbjct: 75  NIPVYGPREELSHIPFISHPLQHENHFKFNHLKVDILAVPGHTLGHIVYFIDELDILFCG 134

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF++GCGR+FE +YA+M+ SL ++ +   +T +Y  HEYT +NA FAL+ +P NL L 
Sbjct: 135 DTLFAMGCGRVFEGTYAQMYHSLNRLAALPPRTQVYCTHEYTLSNAEFALTVEPDNLALH 194

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN 227
               +V+ MR  +  T P+TI+LE + NPFLR E+
Sbjct: 195 SRVEQVRKMRDSHQCTLPTTIALELETNPFLRAES 229


>gi|27365230|ref|NP_760758.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|37680716|ref|NP_935325.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio vulnificus
           YJ016]
 gi|320155615|ref|YP_004187994.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus MO6-24/O]
 gi|81587814|sp|Q8DBD8|GLO2_VIBVU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81756819|sp|Q7MII4|GLO22_VIBVY RecName: Full=Hydroxyacylglutathione hydrolase 2; AltName:
           Full=Glyoxalase II 2; Short=Glx II 2
 gi|27361377|gb|AAO10285.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|37199465|dbj|BAC95296.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio vulnificus
           YJ016]
 gi|319930927|gb|ADV85791.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus MO6-24/O]
          Length = 252

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 139/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   +   + +    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDQR-CAVVDPGDAKPVLHYIEQHQLTLEAILITHHHNDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F N  + GP  ++  IP + H + DGD  +       ++   GHT+GHI Y  + 
Sbjct: 65  DLVRAFPNVNVVGP--KAEPIPTLTHPVEDGDRLELFDETFLVLGLGGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MF+SL K+ +  ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTAQQMFDSLNKLLALPEETEVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  L +Y   V  +R+QNL T P+T+  EK +NPFLR    S+  +++   +N+  L+
Sbjct: 181 PDNELLHQYRDTVNRLRAQNLPTIPTTLRQEKWINPFLRYLQPSVIHSVSSRTKNSDPLS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|187924847|ref|YP_001896489.1| hydroxyacylglutathione hydrolase [Burkholderia phytofirmans PsJN]
 gi|187716041|gb|ACD17265.1| hydroxyacylglutathione hydrolase [Burkholderia phytofirmans PsJN]
          Length = 263

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 139/260 (53%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ + ++   A +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWVVSDGRH--AAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L       ++GP  E+  I  + H L +GD     +  +K  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQAVPVYGPAGEA--IEHLTHRLKNGDHVSIAAPALKLSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 AADPQGTPHVFC-GDTLFACGCGRLFEGTPKQMLASLDSLAALPGATEVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N ELQ +  K   +R++++ T P+TI+ E+ VNPFLR  +     SLR+ L
Sbjct: 182 RFALACEPGNAELQAWRDKASELRARDVPTLPTTIAHERAVNPFLRAGDPAVQASLREQL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           +      L  FT +R  KN+
Sbjct: 242 HEAVPDRLTAFTLMREWKNR 261


>gi|323495339|ref|ZP_08100417.1| hydroxyacylglutathione hydrolase [Vibrio brasiliensis LMG 20546]
 gi|323310410|gb|EGA63596.1| hydroxyacylglutathione hydrolase [Vibrio brasiliensis LMG 20546]
          Length = 252

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           LNI +I  ++DN+  LI N   R  A +D  D   +   L E    L  I  THHH DH 
Sbjct: 2   LNIKSIPAFNDNYIWLIQNSDRR-CAVVDPGDAAPVLAYLNEHNLSLEAILITHHHNDHI 60

Query: 63  RANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                L ++F    + GP  E   +P + H +  GD  +       ++   GHT GHI Y
Sbjct: 61  GGVPELVRQFPQVDVVGPANE--PVPTLTHAVEAGDQIELFDEVFFVLGLEGHTSGHIGY 118

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
             + D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T +Y  HEYT +N  FA
Sbjct: 119 --VGDGKLFCGDVLFSAGCGRVFEGTMEQMHTSLSKLAALPEETEVYCAHEYTTSNVAFA 176

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENA 239
           L+ +P N +LQ+Y  +V  +R+QN  T P+TI  EK +NPFLR +  S+ +++       
Sbjct: 177 LAVEPDNSQLQQYRDEVNRLRAQNQPTLPTTIRREKWINPFLRTDQPSVIRSVANRTSQT 236

Query: 240 SNLAVFTELRIRKNQ 254
             LA+FT LR  KN+
Sbjct: 237 DPLAIFTALREWKNE 251


>gi|254225773|ref|ZP_04919378.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V51]
 gi|125621679|gb|EAZ50008.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V51]
          Length = 252

 Score =  161 bits (408), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 133/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  LI N + R  A +D      +   L++    L  +  THHH DH     
Sbjct: 6   SIPAFDDNYIWLIQN-RDRDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y   V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDDVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVSTLDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|260549429|ref|ZP_05823648.1| hydroxyacylglutathione hydrolase [Acinetobacter sp. RUH2624]
 gi|260407538|gb|EEX01012.1| hydroxyacylglutathione hydrolase [Acinetobacter sp. RUH2624]
          Length = 243

 Score =  161 bits (408), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 121/215 (56%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + +     A+D  +  ++++   E    L  I+ TH H DH     +L     
Sbjct: 16  NYIWILEDTETHEAVAVDPTEAELVTQFCDEHHLTLKQIWLTHWHKDHIGGVADLMANST 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIPGI H L   D   F     +IIATPGHT+GHI Y     + L  GD
Sbjct: 76  LAVYGPRDELSKIPGITHPLQHDDHLKFNDLKAEIIATPGHTLGHIVYFIEELNALFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPTTTKVYCTHEYTLSNAEFALSVEPENHALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+ +R++   T PS+I LE   NPFLR E+ 
Sbjct: 196 RAEQVRKLRTEGKITLPSSIELELATNPFLRAESV 230


>gi|229524239|ref|ZP_04413644.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
 gi|229337820|gb|EEO02837.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
          Length = 252

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  LI N + R  A +D      +   L++    L  +  THHH DH     
Sbjct: 6   SIPAFDDNYIWLIQN-RDRDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDECFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVSTLDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|16124774|ref|NP_419338.1| hydroxyacylglutathione hydrolase [Caulobacter crescentus CB15]
 gi|221233490|ref|YP_002515926.1| hydroxyacylglutathione hydrolase [Caulobacter crescentus NA1000]
 gi|13421702|gb|AAK22506.1| hydroxyacylglutathione hydrolase, putative [Caulobacter crescentus
           CB15]
 gi|220962662|gb|ACL94018.1| hydroxyacylglutathione hydrolase [Caulobacter crescentus NA1000]
          Length = 249

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 129/244 (52%), Gaps = 8/244 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ +      A ID PD   I   L + GW L  I NTH H DH   N  LK   
Sbjct: 13  DNYGFLVRDEASGKVATIDTPDAGAILAELAKLGWSLDLILNTHWHPDHAGGNETLKTAT 72

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
             TI GP  E ++I  +D  + DG+    G   + +I T GHT+GH+ Y+   D    VG
Sbjct: 73  GATIVGP-AEVTRIAPLDRVVRDGEEVMLGDTRLTVIDTGGHTLGHVSYYDAEDAIAFVG 131

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF+LGCGR+FE +  +M++SL ++ +  D+T +Y  HEYT +NA FALS D  +  L 
Sbjct: 132 DTLFALGCGRLFEGTAEQMWDSLGRLIALPDETTVYCAHEYTASNARFALSVD-SSAALA 190

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRK 252
                V + R+++  T P+TI +EK  NPFLR         L  +  S    F E+R  K
Sbjct: 191 ARAEAVFAARARDEATVPTTIGVEKATNPFLRA------PLLRPDAPSPAQAFAEIRAAK 244

Query: 253 NQSK 256
           +  K
Sbjct: 245 DSFK 248


>gi|87118165|ref|ZP_01074064.1| putative hydroxyacylglutathione hydrolase
           withmetallo-hydrolase/oxidoreductase domain [Marinomonas
           sp. MED121]
 gi|86165799|gb|EAQ67065.1| putative hydroxyacylglutathione hydrolase
           withmetallo-hydrolase/oxidoreductase domain [Marinomonas
           sp. MED121]
          Length = 261

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 142/255 (55%), Gaps = 13/255 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  ++ +    L   +D  D   +   L E    L  I  THHH DHT     
Sbjct: 9   IPAFSDNYIWILTDKDSSLAWVVDPGDANPVLDYLAENQLTLAGILITHHHFDHTAGVKK 68

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+ F+C + GP   S     +D GL DGDT    ++   +IATPGHT+ H+CY   N++
Sbjct: 69  LKQAFDCHVAGP---SHLDKLVDQGLEDGDTISIFNYVFHVIATPGHTLDHLCYFAKNEN 125

Query: 128 ---FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF  GCGR+FE +  +M +SL+K+    ++T +Y  HEYT  N  FA+S 
Sbjct: 126 KSPILFSGDTLFRGGCGRLFEGTAEQMHQSLQKLSDLPEETLVYCTHEYTLANYSFAVSL 185

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR-----IENTSLRKNLNMENA 239
           D +N +LQ+   K + +R  N  T P+ IS+E++VNPFLR     I N++ R+ L+ E +
Sbjct: 186 DKNNQKLQENLQKCQDLRDNNQPTLPTKISIEQEVNPFLRPHIEQISNSAARQ-LDQEIS 244

Query: 240 SNL-AVFTELRIRKN 253
           ++L   F ++R  K+
Sbjct: 245 NSLVGRFAQIRAAKD 259


>gi|330993947|ref|ZP_08317877.1| Hydroxyacylglutathione hydrolase [Gluconacetobacter sp. SXCC-1]
 gi|329758893|gb|EGG75407.1| Hydroxyacylglutathione hydrolase [Gluconacetobacter sp. SXCC-1]
          Length = 243

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 83/232 (35%), Positives = 126/232 (54%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI + +DN+   +H+      A +D  +   +   +   G  L  I  THHH DH  A  
Sbjct: 9   AIPILNDNYAWFVHDGPTGAAAMVDPAEDAPLVAAIDAAGGRLDLILLTHHHADHVAAAA 68

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+  +   I G   ++ ++P +D  + DGDT   G    +++ATPGHT G + Y+F   
Sbjct: 69  ALRTRYGARIVGAAADAWRLPALDIAVHDGDTVPLGRAEARVMATPGHTTGEVSYYFPAG 128

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFS+GCGR+FE + A+M+ SL +I +  D+T +  GHEYT++NA FAL  DP
Sbjct: 129 PALFCGDTLFSMGCGRLFEGTAADMYASLRRIAALPDETLVCCGHEYTQSNARFALHVDP 188

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            N+ L+    +V  +R +   T P T++ E+  NPFLR  + +    L  E 
Sbjct: 189 DNMALRARARQVAILRGEGRPTVPVTLAEERATNPFLRAGDVATLARLRREK 240


>gi|241765316|ref|ZP_04763294.1| hydroxyacylglutathione hydrolase [Acidovorax delafieldii 2AN]
 gi|241364997|gb|EER59908.1| hydroxyacylglutathione hydrolase [Acidovorax delafieldii 2AN]
          Length = 257

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 136/256 (53%), Gaps = 12/256 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+ +  +   +D  D   +   L+ +G  L  I  THHH DH    
Sbjct: 4   LPLPAFTDNYIWMLHDTRQAIV--VDPGDAAPVLHALQAQGLQLQAILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             L++     +FGP  E  ++P     L+DGDT +       ++  PGHT GHI Y+   
Sbjct: 62  PTLREATGAHVFGPAGE--QMPEPLQRLADGDTVEVLGLRFSVLDVPGHTAGHIAYYCAD 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +    T +   HEYT +N  FA 
Sbjct: 120 LAGAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDRLAALPGSTRVCCTHEYTLSNLRFAR 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS-- 240
           + +P N  L+ Y S  +S+R++   T PSTI+LE+++NPFLR+   ++R      +AS  
Sbjct: 180 AVEPGNQALRDYSSHCESLRARQEPTLPSTIALEREINPFLRVREATVRAAAQGFDASPP 239

Query: 241 ---NLAVFTELRIRKN 253
               +AVF  LR  KN
Sbjct: 240 QHDAVAVFAALRQWKN 255


>gi|110834083|ref|YP_692942.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
 gi|110647194|emb|CAL16670.1| Metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
          Length = 257

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 140/263 (53%), Gaps = 14/263 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT+  IAI  ++DN+    H     +   +D  D   + + LRE G  L+ +  THHH D
Sbjct: 1   MTASPIAIPAFNDNYIWAFHQQDQCVV--VDPGDAEPVERYLRENGLSLSALLITHHHPD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGH 118
           H      L K  +  ++GP +ES  IP + H L +GDT       +   I+  PGHT+GH
Sbjct: 59  HVGGVAALTKHRDIPVYGPAKES--IPAMSHPLHEGDTITPAGTDLAFTIMEVPGHTLGH 116

Query: 119 ICYHFMNDH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           I   F+ND   +L  GDTLF+ GCGR+FE + A+MF SLE++ +  + T ++  HEYT+ 
Sbjct: 117 IA--FINDSHGWLFSGDTLFAGGCGRLFEGTAAQMFHSLERLAALPEATLVFCAHEYTQA 174

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA +  P++  +Q     V  +R +   T PST++ EK  NPFLR +N  ++ +   
Sbjct: 175 NLTFAAAVTPNDSAVQTRLQAVTELRKKGKITLPSTLAEEKATNPFLRSDNEEVKASCQR 234

Query: 237 ENA----SNLAVFTELRIRKNQS 255
                  S++  F  LR  K+ +
Sbjct: 235 HEPGCGESDIQCFAALRRWKDNA 257


>gi|260554546|ref|ZP_05826767.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii ATCC
           19606]
 gi|260411088|gb|EEX04385.1| hydroxyacylglutathione hydrolase [Acinetobacter baumannii ATCC
           19606]
          Length = 243

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 120/215 (55%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + +     A+D  +  ++    +E    L  I+ TH H DH     +L     
Sbjct: 16  NYIWILEDTETHEAVAVDPTEAELVIHFCQEHQLTLKQIWLTHWHKDHIGGVADLTANTP 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y     + L  GD
Sbjct: 76  MAVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELNALFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPTATKVYCTHEYTLSNAEFALSVEPENHALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+ +R +   T PS+I LE   NPFLR E+ 
Sbjct: 196 RAEQVRMLRQEGKITLPSSIELELATNPFLRAESV 230


>gi|261253705|ref|ZP_05946278.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
 gi|260937096|gb|EEX93085.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
          Length = 252

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 139/255 (54%), Gaps = 9/255 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           LNI +I  ++DN+  LI N   R  A +D  D   +   L E    L  I  THHH DH 
Sbjct: 2   LNIKSIPAFNDNYIWLIENSDRR-CAVVDPGDAKPVLDYLAEHDLSLEAILITHHHNDHI 60

Query: 63  RANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                L ++F N  + GP  E   +P + H +  GD  +       ++   GHT+GHI Y
Sbjct: 61  GGIAELVRQFPNIDVVGPANE--PVPTLTHAVETGDQIELFDEVFFVLGLEGHTLGHIGY 118

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
             + D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T ++  HEYT +N  FA
Sbjct: 119 --VGDSKLFCGDVLFSAGCGRVFEGTMEQMHTSLSKLAALPEETQVFCAHEYTASNLAFA 176

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENA 239
           L+ +P N +LQ+Y  +V  +R+QN  T PS+I  EK +NPFLR +  ++ +++       
Sbjct: 177 LAVEPDNEQLQQYRDEVNRLRAQNKPTLPSSIRREKWINPFLRTDQPTVMRSVANRTSET 236

Query: 240 SNLAVFTELRIRKNQ 254
            +L++FT LR  KN+
Sbjct: 237 DSLSIFTALREWKNE 251


>gi|193077753|gb|ABO12621.2| putative hydroxyacylglutathione hydrolase [Acinetobacter baumannii
           ATCC 17978]
          Length = 243

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 120/215 (55%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ + +     A+D  +  ++    +E    L  I+ TH H DH     +L     
Sbjct: 16  NYIWILEDTETHEAVAVDPTEAELVIHFCQEHQLTLKQIWLTHWHKDHIGGVADLTANTP 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y     + L  GD
Sbjct: 76  MAVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELNTLFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPTATKVYCTHEYTLSNAEFALSVEPENHALQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+ +R +   T PS+I LE   NPFLR E+ 
Sbjct: 196 RAEQVRMLRQEGKITLPSSIELELATNPFLRAESV 230


>gi|70730663|ref|YP_260404.1| hydroxyacylglutathione hydrolase [Pseudomonas fluorescens Pf-5]
 gi|123655233|sp|Q4KBH9|GLO2_PSEF5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|68344962|gb|AAY92568.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas fluorescens
           Pf-5]
          Length = 255

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/253 (37%), Positives = 136/253 (53%), Gaps = 9/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +H+ +  A +D  D   +   L +  GW L+ I  THHH DH    
Sbjct: 6   ALPAFTDNYIWLLQDHRSQRCAVVDPGDAAPVLAWLEQHPGWVLSDILITHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+    T+ GP  E  KIP  D GL D           ++ A PGHT+GHI Y+   
Sbjct: 66  ERLKQHSAATVHGPARE--KIPARDIGLEDNQRVSILGWEFEVFAVPGHTLGHIAYYHHG 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE +  +M  SL ++ +  D T IY  HEYT +N  FA + +
Sbjct: 124 --LLFCGDTLFAAGCGRLFEGTPEQMHHSLGRLAALPDDTLIYCTHEYTLSNLRFAQAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENASN 241
           P N ++ +  +KV  MR Q   T PST++LEK  NPFLR   TS+++  +     +N S 
Sbjct: 182 PANPDIAERLAKVTQMREQGRMTLPSTLALEKLTNPFLRTGETSVKQKADERNGQDNQSQ 241

Query: 242 LAVFTELRIRKNQ 254
            AVF  LR  K++
Sbjct: 242 SAVFAALRAWKDK 254


>gi|126656671|ref|ZP_01727885.1| glyoxalase II [Cyanothece sp. CCY0110]
 gi|126621891|gb|EAZ92599.1| glyoxalase II [Cyanothece sp. CCY0110]
          Length = 257

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 131/247 (53%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+      A +D      +   L + G  L  IFNTHHH DH   N  L +KF
Sbjct: 11  DNYIFLLHDPDNNTAAVVDPAVAEPVLNCLDQLGAKLVAIFNTHHHADHVGGNQKLMEKF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-NDHF-- 128
            +  ++G  E+  +IPG    L +GDT +F     K+   PGHT GHI Y+F  ND    
Sbjct: 71  PDLCVYGSQEDKGRIPGQQVFLQEGDTVEFAGKTGKVYFVPGHTRGHIAYYFPPNDSEEI 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE +  +M +S+ K+++  D T I+  HEYT NN  FA++ D 
Sbjct: 131 GDLFCGDTIFAGGCGRLFEGTPTQMVQSISKLRNLPDNTRIWCAHEYTLNNLKFAVTVDK 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ     V   R     T PS +  EKK NPFLR +  +L+    M + +   VF 
Sbjct: 191 DNSDLQTRYQAVIKARENEQATVPSLLGEEKKTNPFLRWDQPALQMVTGMNDPAR--VFG 248

Query: 247 ELRIRKN 253
           ++R  K+
Sbjct: 249 KIRGMKD 255


>gi|213968846|ref|ZP_03396987.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           T1]
 gi|301384108|ref|ZP_07232526.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059182|ref|ZP_07250723.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           K40]
 gi|302135020|ref|ZP_07261010.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926449|gb|EEB60003.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           T1]
          Length = 259

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 139/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +    +D  D   + + L + + + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNQHYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + LK+     + GP  ES  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  VELKQATQARVLGPAAES--IPARDVALIDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 D--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  FA +
Sbjct: 124 ATAPLLFSGDTLFAAGCGRLFEGTPGQMHASLERLAALPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V  MRS+N  + PS+++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAERLAQVTLMRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|261211356|ref|ZP_05925644.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
 gi|260839311|gb|EEX65937.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
          Length = 252

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 137/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  +   +   L++    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSD-RDCAVVDPGNAEPVLAYLKQHDLNLKAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F +  + GP +E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPHTHVVGPAQEP--IPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTASNLSFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK +NPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNHPTLPTTLGREKWINPFLRTQEPSVIRSVANRVSTLDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|262369691|ref|ZP_06063019.1| Zn-dependent hydrolase [Acinetobacter johnsonii SH046]
 gi|262315759|gb|EEY96798.1| Zn-dependent hydrolase [Acinetobacter johnsonii SH046]
          Length = 243

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 123/221 (55%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  L+ +   +    +D  +  ++     E G  +  I+ TH H DH     +L    N
Sbjct: 16  NYIWLLEHSSSKQVVVVDPTEAGLVENYCTEHGLSIAQIWLTHWHKDHIGGVADLLASRN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP EE SKIP I H L D D F F    + ++A PGHT+GHI Y   +   L  GD
Sbjct: 76  IPVYGPREELSKIPFITHALMDDDYFSFHDLHVDVLAVPGHTLGHIVYFIESIQTLFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE ++ +M+ SL ++ +   +T +Y  HEYT +NA FA   +P N+ +Q+
Sbjct: 136 TLFAMGCGRVFEGTHEQMYHSLNRLAALPAETKVYCTHEYTLSNAKFANHVEPDNIAIQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
              +V++MR     T PS+I +E + NPFLR EN    K L
Sbjct: 196 RLDRVETMRYLGQCTLPSSIEIELETNPFLRTENFEEFKRL 236


>gi|330959399|gb|EGH59659.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 259

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 141/255 (55%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQRCAVVDPGDAQPVLDWLAQHPEYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + LK+     + GP  E+  IP  D  L+D D  +       + A PGHT+GHI ++  +
Sbjct: 66  VQLKQVTQARVHGPATEN--IPARDVALADHDRLNVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL+++  F D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLQRLAGFPDSTSIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENA 239
            +P N ++ +  ++V  +R++N  + PST+ LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNRDIAERLAEVTRLRAENRISLPSTLGLEKRTNPFLRTHETSVKEKADERNGAQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFACLRAWKDK 258


>gi|163801801|ref|ZP_02195698.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio sp. AND4]
 gi|159174309|gb|EDP59113.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio sp. AND4]
          Length = 252

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 139/251 (55%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   +  A +D  D   +   L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSD-KQCAVVDPGDAKPVLAYLQANELTLEAILITHHHNDHIGGVS 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           +L + F + ++ GP  ++  IP + + + +GD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  DLVRAFPHVSVVGP--KTEPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + +++   ++N+   +
Sbjct: 181 PDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIQSVTNRIKNSDPCS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALREWKNE 251


>gi|28870869|ref|NP_793488.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|81730266|sp|Q87YS8|GLO2_PSESM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|28854118|gb|AAO57183.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331019242|gb|EGH99298.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 259

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 138/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + LK+     + GP  ES  IP  D  L+D D          + A PGHT+GHI ++  +
Sbjct: 66  VELKQATRARVLGPAAES--IPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 DH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  FA +
Sbjct: 124 AAAPLLFSGDTLFAAGCGRLFEGTPGQMHASLERLAALPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V  MRS+N  + PS+++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAERLAQVTLMRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|89075028|ref|ZP_01161473.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium sp.
           SKA34]
 gi|89049267|gb|EAR54831.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium sp.
           SKA34]
          Length = 252

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 144/251 (57%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LIHN K      +D  D   + + + + G+ L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIHN-KDNHCVVVDPGDATPVLETIDKFGFTLDAILITHHHHDHIGGIS 64

Query: 67  NLKKFFNCT-IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            LK+ F  T + GP+ E   IPG+   + DGD  D       +++ PGHT+GH+ Y  + 
Sbjct: 65  ELKRRFPSTKVVGPVNEP--IPGLTQPVEDGDQVDIFGERFMVLSVPGHTLGHVAY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGR+FE + A+MF SL+KI +  D+T ++  HEYT +N  FAL  +
Sbjct: 121 DEKLFCGDTLFSAGCGRLFEGTPAQMFNSLQKIATLPDETEVFCAHEYTASNLAFALVAE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
             N  LQ+Y  KV  +R+    T PST+S EK++NPFLR +  S+++++     + S+L 
Sbjct: 181 QGNPHLQQYRDKVIRLRANGKSTLPSTLSQEKRINPFLRCDQPSIKRSVADKAYDNSDLE 240

Query: 244 VFTELRIRKNQ 254
            F  LR  K++
Sbjct: 241 TFAALRRWKDK 251


>gi|148979850|ref|ZP_01815728.1| putative hydroxyacylglutathione hydrolase GloB [Vibrionales
           bacterium SWAT-3]
 gi|145961542|gb|EDK26843.1| putative hydroxyacylglutathione hydrolase GloB [Vibrionales
           bacterium SWAT-3]
          Length = 252

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 132/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIENSDRR-CAVVDPGDAAPVLEYLAHHELTLDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F    + GP  E   IP + H + DGD  +       ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPGVDVVGPKNEP--IPTLTHPVDDGDQLELFGEAFLVLGLSGHTAGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  FAL+ +
Sbjct: 121 DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E    L+
Sbjct: 181 PDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQTDPLS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALRAWKNE 251


>gi|86146866|ref|ZP_01065185.1| Hydroxyacylglutathione hydrolase GloB [Vibrio sp. MED222]
 gi|85835318|gb|EAQ53457.1| Hydroxyacylglutathione hydrolase GloB [Vibrio sp. MED222]
          Length = 252

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 132/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDRR-CAVVDPGDAAPVLEYLAHHELTLDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F    + GP  E   IP + H + DGD  +       ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPGVDVVGPKNEP--IPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  FAL+ +
Sbjct: 121 DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E    L+
Sbjct: 181 PDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQTDPLS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALRAWKNE 251


>gi|84389769|ref|ZP_00991321.1| Hydroxyacylglutathione hydrolase GloB [Vibrio splendidus 12B01]
 gi|84376870|gb|EAP93744.1| Hydroxyacylglutathione hydrolase GloB [Vibrio splendidus 12B01]
          Length = 252

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 133/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDRR-CAVVDPGDAAPVLEYLAHHELTLDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F +  + GP  E   IP + H + DGD  +       ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPSIDVVGPRNEP--IPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  FAL+ +
Sbjct: 121 DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E    L+
Sbjct: 181 PDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQTDPLS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALRAWKNE 251


>gi|262170793|ref|ZP_06038471.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
 gi|261891869|gb|EEY37855.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
          Length = 303

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 135/250 (54%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D      +   L++    L  I  THHH DH     
Sbjct: 57  SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHDHIGGVA 115

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F +  + GP  E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 116 ELIHQFPHTHVVGPAHE--PIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIGY--VG 171

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE S  +MF SL K+ +  ++T IY  HEYT +N  FAL+ +
Sbjct: 172 DGKLFCGDVLFSAGCGRIFEGSMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAFALAVE 231

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +     L 
Sbjct: 232 PENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVSTLDPLT 291

Query: 244 VFTELRIRKN 253
           +FT LR  KN
Sbjct: 292 IFTALREWKN 301


>gi|258627372|ref|ZP_05722156.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM603]
 gi|258580410|gb|EEW05375.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM603]
          Length = 252

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 135/250 (54%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D      +   L++    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F +  + GP  E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPHTHVVGPAHE--PIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRIFE +  +MF SL K+ +  ++T IY  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRIFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVSTLDPLT 240

Query: 244 VFTELRIRKN 253
           +FT LR  KN
Sbjct: 241 IFTALREWKN 250


>gi|114563378|ref|YP_750891.1| hydroxyacylglutathione hydrolase [Shewanella frigidimarina NCIMB
           400]
 gi|114334671|gb|ABI72053.1| Hydroxyacylglutathione hydrolase [Shewanella frigidimarina NCIMB
           400]
          Length = 259

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 141/261 (54%), Gaps = 14/261 (5%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           LN+ AI  ++DN+  LIH         +D      +   L      L  I  THHH DHT
Sbjct: 2   LNVHAIPAFNDNYLWLIHQTSSLDAYVVDPGCGQSVIDYLATTELNLVGILITHHHSDHT 61

Query: 63  RANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI---KIIATPGHTIG 117
                L++ FN    ++GP  E  +I G+ H L+     +     +   ++IA PGHT+G
Sbjct: 62  GGIKQLQQHFNNSLIVYGPSNE--RIDGLTHPLTVTSDINIEIPHLGLTQVIAVPGHTLG 119

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y +++D   C GDTLFS GCGR+FE +  +M +SL  + +  D+T ++  HEYT++N
Sbjct: 120 HIAY-YIDDKLFC-GDTLFSGGCGRLFEGTPTQMLQSLTVLANLPDQTQVFCAHEYTQSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI----ENTSLRKN 233
             FAL   P+NL+L  Y  KV  +RSQN+ T PSTI+ EK +NPFLR        ++   
Sbjct: 178 LNFALHVTPNNLQLIDYAHKVNQLRSQNIPTIPSTIATEKAINPFLRCHINETQVAISTE 237

Query: 234 LNMENASNLAVFTELRIRKNQ 254
             + N  ++  FT LR  KNQ
Sbjct: 238 YKIVNIDDIQTFTLLREWKNQ 258


>gi|257095466|ref|YP_003169107.1| hydroxyacylglutathione hydrolase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047990|gb|ACV37178.1| hydroxyacylglutathione hydrolase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 253

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 131/253 (51%), Gaps = 11/253 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+   K    A +D  D   +  ++  +G  LT I  THHH DH    
Sbjct: 5   IRIPAFKDNYIWLLR--KGASAAVVDPGDARPVLAVIEREGLSLTTILVTHHHADHQGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHF 123
            +L       +FGP  ES  I GI   L  G+T      +   ++IA PGHT+GHI Y+ 
Sbjct: 63  ADLLARHPAEVFGPAAES--ITGIKRSLCGGETVSVAGCAADFQVIAVPGHTLGHIAYY- 119

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE + A+M ESL ++ +  D T +Y  HEYT+ N  FAL+
Sbjct: 120 -GSGCLFCGDTLFAGGCGRLFEGTAAQMLESLARLSALPDDTAVYCAHEYTQANLRFALA 178

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI---ENTSLRKNLNMENAS 240
            +P N  LQ+   +V   R+  L T PSTI++EK  NPFLR    E  +  +        
Sbjct: 179 VEPGNPRLQRRAEEVAVARAAGLATVPSTIAIEKASNPFLRCREPEVVAAAQRRVPGARD 238

Query: 241 NLAVFTELRIRKN 253
            LAVF  LR  KN
Sbjct: 239 ELAVFAALREWKN 251


>gi|91775834|ref|YP_545590.1| hydroxyacylglutathione hydrolase [Methylobacillus flagellatus KT]
 gi|122985520|sp|Q1H188|GLO2_METFK RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91709821|gb|ABE49749.1| Hydroxyacylglutathione hydrolase [Methylobacillus flagellatus KT]
          Length = 250

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 130/250 (52%), Gaps = 8/250 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+H H + L   +D  D + + ++L  +G  L  I  THHH DHT   
Sbjct: 5   IPILAFEDNYIWLLHQHGHALV--VDPGDAHPVLEILDARGLQLRAILVTHHHQDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHF 123
             L +  +  +F P +E    P   H ++ GD  D    +  + ++  PGHT+GH+ Y+ 
Sbjct: 63  EELIQATSAQVFAPAKEQFSFP--HHPVTAGDRLDIPGIALSLSVLDVPGHTVGHVAYY- 119

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             D  L  GDTLF  GCGR+FE +  +M+ SL+++      T +Y GHEYTE N  FALS
Sbjct: 120 -GDGMLFSGDTLFGAGCGRLFEGTPGQMYSSLQQLAQLPVNTRVYCGHEYTERNLAFALS 178

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +PH+  L        ++R+Q L + PS+++LE   NPFLR     +           ++
Sbjct: 179 LEPHHEALLSRREATAALRAQGLPSLPSSMALELATNPFLRCHEPGIIAASKSAATDPVS 238

Query: 244 VFTELRIRKN 253
           VF  +R  +N
Sbjct: 239 VFAAIREMRN 248


>gi|88813346|ref|ZP_01128584.1| Metallo-beta-lactamase superfamily protein [Nitrococcus mobilis
           Nb-231]
 gi|88789404|gb|EAR20533.1| Metallo-beta-lactamase superfamily protein [Nitrococcus mobilis
           Nb-231]
          Length = 257

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 10/259 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M      +  + DN+   +H+ + R    +D  D   + + L+++   LT I  THHH D
Sbjct: 1   MIDPAFPLRAFRDNYIWALHDAQKRRVCVVDPGDPDPVLRFLKQEKLELTGILATHHHAD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH--PIKIIATPGHTIGH 118
           H      L K     ++GP +E  +IP + H L +GD     +    ++++  PGHT GH
Sbjct: 61  HVGGIARLVKEHPVPVYGPAKE--QIPELTHPLGEGDKVRLEAQDLELEVLEVPGHTAGH 118

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y  +    L  GDTLF+ GCGRIFE +  +M+ SL K+    + T +Y  HEYT+NN 
Sbjct: 119 IAY--VGHQMLFCGDTLFAGGCGRIFEGTAEQMYASLCKLAELDNPTRVYCAHEYTQNNL 176

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA++ +P N  + +  + +++MR+ +  T PSTI +E + NPFLR +  +++++    +
Sbjct: 177 RFAITVEPDNTAVWERYTHIRTMRANDEITLPSTIGIELETNPFLRPDIATVKRSAEQHS 236

Query: 239 A----SNLAVFTELRIRKN 253
                S++ VF  +R  K+
Sbjct: 237 GRKLTSDVEVFAAVRAWKD 255


>gi|88703291|ref|ZP_01101007.1| hydroxyacylglutathione hydrolase [Congregibacter litoralis KT71]
 gi|88702005|gb|EAQ99108.1| hydroxyacylglutathione hydrolase [Congregibacter litoralis KT71]
          Length = 256

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 123/254 (48%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  L+ N        +D  D   +   LRE+   L  I  THHH DH    
Sbjct: 5   IGLPAFSDNYIWLLPNGDGS-ALVVDPGDAAPVEAALREQELSLAGILITHHHFDHVGGL 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+   C ++GP   +  I GID  L  GD    GS+   +I  PGHT+ HI Y    
Sbjct: 64  KALKEKHGCIVYGP--ANPAIEGIDRELVSGDHLSVGSYEFDVIGVPGHTLDHIAYFQEG 121

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGRIFE + A M ESL ++ +    T +Y  HEYT  N  FA + 
Sbjct: 122 ATPLLFCGDTLFAGGCGRIFEGTPAMMHESLSRLAALPANTAVYCAHEYTLANLSFARAA 181

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENAS 240
           DP N  L+   ++ + +R     T PSTISLE   NPFLR     L   L        A+
Sbjct: 182 DPGNEALKAREARARDLRDAGTPTVPSTISLEIATNPFLRSAAPELAVGLEAAGRESGAT 241

Query: 241 NLAVFTELRIRKNQ 254
            +  F ELR  K+Q
Sbjct: 242 PVERFAELRAWKDQ 255


>gi|307730499|ref|YP_003907723.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1003]
 gi|307585034|gb|ADN58432.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1003]
          Length = 263

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 141/260 (54%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ + ++ +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWVVSDGRHAVV--VDPGEAAPVRAYLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L       ++GP  E+  I  +   L +GD  +     ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQAVPVYGPAGEA--IEHVTQRLKNGDRVNIAEPALEFSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE + A+M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 AADLAGTPHVFC-GDTLFACGCGRLFEGTPAQMLASLDSLAALPGATQVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N +LQ +  K   +R++N  T P+TI+ E+ VNPFLR  +     +L++ L
Sbjct: 182 RFALACEPGNAQLQAWRDKASDLRARNQPTLPTTIAHERAVNPFLRAGDPAVQATLQEAL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           + + +  LA FT +R  KN+
Sbjct: 242 HEKVSDRLAAFTLMREWKNR 261


>gi|218710295|ref|YP_002417916.1| hydroxyacylglutathione hydrolase [Vibrio splendidus LGP32]
 gi|254798852|sp|B7VIP5|GLO2_VIBSL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218323314|emb|CAV19491.1| hydroxyacylglutathione hydrolase [Vibrio splendidus LGP32]
          Length = 252

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 132/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSDRR-CAVVDPGDAAPVLEYLAHHELTLDAILITHHHHDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F    + GP  E   IP + H + DGD  +       ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPGVDVVGPKNEP--IPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  FAL+ +
Sbjct: 121 DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P N  LQ+Y  +V  +R+QN  T P+ +  EK +NPFLR    S+ K+++   E    L+
Sbjct: 181 PDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFINPFLRYTEPSVVKSVSNRTEQTDPLS 240

Query: 244 VFTELRIRKNQ 254
           VFT LR  KN+
Sbjct: 241 VFTALRAWKNE 251


>gi|323497999|ref|ZP_08103008.1| hydroxyacylglutathione hydrolase [Vibrio sinaloensis DSM 21326]
 gi|323317044|gb|EGA70046.1| hydroxyacylglutathione hydrolase [Vibrio sinaloensis DSM 21326]
          Length = 252

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L++    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIKNSDQR-CAVVDPGDAAPVLEYLQQHDLSLEAILITHHHNDHIGGIA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F    + GP  E   +P + H +  GD  +       ++   GHT+GHI Y  + 
Sbjct: 65  ELVRQFPEVDVVGPANEP--VPTLTHPVEGGDQIELFGEIFFVLGLEGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LF+ GCGR+FE +  +M  SL K+ +  ++T IY  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFAAGCGRVFEGTMEQMHTSLSKLAALPEETEIYCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +LQ++  +V  +R+QN  T P+T+  EK +NPFLR +  ++ +++    +   +LA
Sbjct: 181 PDNEQLQQFRDEVIRLRAQNQPTLPTTLRREKWINPFLRTDQQTVIRSVATRTQQTDSLA 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|172036105|ref|YP_001802606.1| glyoxalase II [Cyanothece sp. ATCC 51142]
 gi|254798841|sp|B1WUT9|GLO2_CYAA5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|171697559|gb|ACB50540.1| glyoxalase II [Cyanothece sp. ATCC 51142]
          Length = 257

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 132/247 (53%), Gaps = 8/247 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKF 71
           DN+  L+H+      A +D      +   L + G  L  IFNTHHH DH   N  L ++F
Sbjct: 11  DNYIFLLHDANNNTAAVVDPAVAEPVLNCLDQLGAKLIAIFNTHHHADHVGGNKKLMEQF 70

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM---NDHF 128
            +  ++G  E+  +IPG    L +GDT +F     K+   PGHT GHI Y+F    N+  
Sbjct: 71  PDLCVYGSKEDQGRIPGQQVFLEEGDTVEFAGKTGKVYFVPGHTRGHIAYYFPPNENEEI 130

Query: 129 --LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDT+F+ GCGR+FE + A+M ES+ K+++  D T I+  HEYT NN  FA++ D 
Sbjct: 131 GDLFCGDTIFAGGCGRLFEGTPAQMVESIGKLRNLPDHTRIWCAHEYTLNNLKFAVTVDK 190

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ     V   R     T PS +  EKK NPFLR +  +L+    M + +   VF 
Sbjct: 191 DNSDLQIRYQDVIKARKNEEATVPSLLGEEKKTNPFLRWDQPALQMITGMNDPAR--VFG 248

Query: 247 ELRIRKN 253
           ++R  K+
Sbjct: 249 KIRGMKD 255


>gi|160875173|ref|YP_001554489.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS195]
 gi|226724024|sp|A9L0E9|GLO2_SHEB9 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160860695|gb|ABX49229.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS195]
 gi|315267367|gb|ADT94220.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS678]
          Length = 263

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/260 (35%), Positives = 137/260 (52%), Gaps = 17/260 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLVGILLTHHHNDHTGGVA 65

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGD----TFDFGSHPIKIIATPGHTIGHIC 120
            L+ +     T++GP  ++ KI GI H L        T D+ S  ++++  PGHT GHI 
Sbjct: 66  ELQAYSQDRLTVYGP--DNEKIEGITHPLHATAQPRFTLDYISGELQVLDVPGHTAGHIA 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y  + D   C GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +N  F
Sbjct: 124 Y-VIADALFC-GDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPAYTRVYCAHEYTLSNLKF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-------KN 233
           AL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +         +
Sbjct: 182 ALAVNPNNCALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVGSIKQHFSD 241

Query: 234 LNMENASNLAVFTELRIRKN 253
           L+  N   L  FT LR  K+
Sbjct: 242 LSHANLDELGGFTLLRQWKD 261


>gi|170732608|ref|YP_001764555.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia MC0-3]
 gi|254245768|ref|ZP_04939089.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia PC184]
 gi|124870544|gb|EAY62260.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia PC184]
 gi|169815850|gb|ACA90433.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia MC0-3]
          Length = 273

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 88/270 (32%), Positives = 139/270 (51%), Gaps = 26/270 (9%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLK----KFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+         T++GP  E+  +  +   LS GD  T D  +    ++  PGHT GHI
Sbjct: 65  EALQHSQPADVPLTVYGPAAEAIGV--VTQPLSGGDRVTLDAPAVAFDVLDVPGHTRGHI 122

Query: 120 CYHFMN-----------DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
            Y                H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++
Sbjct: 123 AYFQAAGQGAAGQGNAVPHVFC-GDTLFSCGCGRLFEGTPAQMLGSLDALAALPGDTRVH 181

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ 
Sbjct: 182 CAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSA 241

Query: 229 SLRKNLNME----NASNLAVFTELRIRKNQ 254
           ++   L  E        LA FT +R  KN+
Sbjct: 242 AIHATLEAELHETVTDRLAAFTLMREWKNR 271


>gi|170695451|ref|ZP_02886596.1| hydroxyacylglutathione hydrolase [Burkholderia graminis C4D1M]
 gi|170139642|gb|EDT07825.1| hydroxyacylglutathione hydrolase [Burkholderia graminis C4D1M]
          Length = 263

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 141/260 (54%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +  + +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWVVSDGHHAVV--VDPGEAAPVRAYLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L    +  ++GP  E+  I  +   L +GD     +  ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQDVPVYGPAGEA--IERVTQRLENGDRVTIAAPALELSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +   +T ++  HEYT +N 
Sbjct: 123 AADPGGTPHVFC-GDTLFACGCGRLFEGTPQQMLASLDSLAALPGETQVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N +LQ +  +   +R++NL T P+TI+ E+ VNPFLR  N     +L++ L
Sbjct: 182 RFALACEPGNADLQAWRDQAADLRARNLPTLPTTIAHERAVNPFLRAGNPAVQAALQEQL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           + + +  L  FT +R  KN+
Sbjct: 242 HEKVSDRLGAFTLMREWKNR 261


>gi|74317683|ref|YP_315423.1| hydroxyacylglutathione hydrolase [Thiobacillus denitrificans ATCC
           25259]
 gi|123611696|sp|Q3SIB0|GLO2_THIDA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|74057178|gb|AAZ97618.1| hydroxyacylglutathione hydrolase [Thiobacillus denitrificans ATCC
           25259]
          Length = 256

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 134/255 (52%), Gaps = 12/255 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  + H+ KY +  A+D  D  ++S  L  +G  L  +  THHH DHT  N
Sbjct: 5   IPLPAFEDNYIWVWHDAKYAV--AVDPGDPAVLSTYLDSRGLALAAVLVTHHHRDHTGGN 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHF 123
             L++ +NC I+ P  ++ +IP + H +  GD+         + ++ATPGHT+ H+ Y  
Sbjct: 63  TWLRQRYNCAIYAP--DNPRIPAVSHVVRGGDSVAVPELGLALAVLATPGHTLDHVSY-V 119

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            N H  C GDTLF  GCG++FE   A M  SL+ + +    T +   HEYT +N  FA +
Sbjct: 120 GNGHLFC-GDTLFGCGCGKLFEGDAAMMSASLDALAALPPTTRVCCAHEYTLSNIDFAKT 178

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK----NLNMENA 239
            D  N  L +     ++ R+QN  T PST++LE+  NPFLR  +  +R      L   + 
Sbjct: 179 IDGANPALLERERIDRAARAQNRPTLPSTLALERTTNPFLRFHDADMRAFAVGELGSPDP 238

Query: 240 SNLAVFTELRIRKNQ 254
               VF  +R  K++
Sbjct: 239 GPATVFGAIRAAKDR 253


>gi|30248164|ref|NP_840234.1| metallo-beta-lactamase superfamily protein [Nitrosomonas europaea
           ATCC 19718]
 gi|81584870|sp|Q82XW0|GLO2_NITEU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|30180049|emb|CAD84049.1| Metallo-beta-lactamase superfamily [Nitrosomonas europaea ATCC
           19718]
          Length = 262

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 139/252 (55%), Gaps = 12/252 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++HN ++ L   ID  D   +   LR++      I  THHH DHT     
Sbjct: 7   VRAFRDNYIWIVHNQQFALI--IDPGDATPVLTWLRQQKLQPIAILCTHHHHDHTGGISL 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHFMN 125
           L + F   ++GP  E  KIPG+ H L++GDT  F   S  + I+  PGHT GHI  H  N
Sbjct: 65  LVQKFEIPVYGPASE--KIPGMTHPLAEGDTLVFPELSLELSILDVPGHTAGHIACHGQN 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             F   GDTLF+ GCGRIFE +  +MF+SL+K+    D+T +Y  HEYT +N  FA + D
Sbjct: 123 RLF--CGDTLFACGCGRIFEGNAQQMFDSLQKLTDLPDETQVYCAHEYTLDNIRFARAID 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL--- 242
           P N EL +  S V+  R QN+ T PS+++ EK  NPFLR    ++ ++ +      L   
Sbjct: 181 PDNPELIELESNVEEKREQNMPTLPSSLAAEKATNPFLRCNQPAIIQSASRYAGRQLTDP 240

Query: 243 -AVFTELRIRKN 253
            +VF  +R  KN
Sbjct: 241 VSVFAAIRDWKN 252


>gi|220906664|ref|YP_002481975.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7425]
 gi|254798842|sp|B8HMJ9|GLO2_CYAP4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|219863275|gb|ACL43614.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7425]
          Length = 256

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 136/253 (53%), Gaps = 9/253 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+ + + R  A +D      + + LR   + L  IFNTHHH DH   N  
Sbjct: 6   LPVLSDNYIFLVLDPERRQAAVVDPAVAAPVLERLRSLQFQLVAIFNTHHHHDHVGGNQE 65

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF--- 123
           L + F    ++G  E+  +IPG    L  GD  +F     +++  PGHT  HI Y+F   
Sbjct: 66  LLQHFPTAVVYGGAEDRGRIPGQQVFLQPGDRVNFAQRTAEVLFVPGHTRAHIAYYFPPV 125

Query: 124 --MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
              +    C GDTLF+ GCGR+FE + A+M  SL +++   D T ++  HEYT  N  FA
Sbjct: 126 NHSSGELFC-GDTLFAGGCGRLFEGTPAQMVNSLNQLRQLPDNTRVWCAHEYTLKNLQFA 184

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ +P N+ELQ   ++V   R     T PS + LEK+ NPFLR +   +++++  ++   
Sbjct: 185 LTIEPENVELQTRLAQVYLARQHFQPTVPSELGLEKRTNPFLRWDVPQVQQSVKGQDG-- 242

Query: 242 LAVFTELRIRKNQ 254
           +  FT LR RK+Q
Sbjct: 243 IQTFTRLRGRKDQ 255


>gi|73541875|ref|YP_296395.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha JMP134]
 gi|123624617|sp|Q46Z82|GLO2_RALEJ RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|72119288|gb|AAZ61551.1| Hydroxyacylglutathione hydrolase [Ralstonia eutropha JMP134]
          Length = 266

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 134/262 (51%), Gaps = 21/262 (8%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IH+   R  A +D  +   + + L++KG  L  I  THHH DH      
Sbjct: 7   IPAFQDNYIWAIHDG--RNAAVVDPGEAAPVERFLKDKGLALGAIVITHHHGDHQGGVAE 64

Query: 68  LKKFFNCT-------IFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGH 118
           L   +  T       + GP  E  +I G    + +GDT    +  +  +++  PGHT GH
Sbjct: 65  LLSAYPTTHDGAPMPVIGPAGE--RIGGRTQAVREGDTVTLPAPALQFRVLDVPGHTAGH 122

Query: 119 ICYHF----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
           + Y      +     C GDTLF+ GCGR+FE + A+M  SL+K+ S   +T +Y  HEYT
Sbjct: 123 VAYAGDLPGVGPVVFC-GDTLFATGCGRLFEGTPAQMLASLDKLASLPGETRVYCAHEYT 181

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            +N  FA + +P N  L  + ++V+S+R     T PSTI LE++VNPFLR    ++R+ +
Sbjct: 182 RSNVRFARAVEPGNTALADWEARVESLREAGQPTVPSTIGLERQVNPFLRSREPTVREAV 241

Query: 235 NMEN---ASNLAVFTELRIRKN 253
             +    A +   F  LR  K+
Sbjct: 242 KAQGGSVAGDAEAFGALRGWKD 263


>gi|126728273|ref|ZP_01744089.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sagittula stellata E-37]
 gi|126711238|gb|EBA10288.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sagittula stellata E-37]
          Length = 253

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 130/249 (52%), Gaps = 2/249 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  ++        A IDAP+   +  +L  +GW    I  THHH DH    
Sbjct: 6   VTVPCLKDNYAYIVKGPDG--IALIDAPEAKPLINVLEHRGWTPDVIMITHHHHDHVGGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ + C + GP  E  K+P +D  L  G +        ++I  PGHT+GH+ YH+  
Sbjct: 64  DELREKYGCKVMGPAAEKDKLPELDMALEPGFSGGTDDGLCEVIPVPGHTLGHVAYHYPE 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L   D+L  +GCGR+FE +   M+ESL  + +   +T +  GHEY E+NA FA + +
Sbjct: 124 AKCLFSADSLMVMGCGRVFEGTPEMMWESLSTLAALDPQTIVCSGHEYGESNAAFAKTIE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L      +   R +   T    + +E + NPFLR    S++K L ME+AS+L VF
Sbjct: 184 PDNPGLISRAQMITVARGRGQPTAQVPLYIELQTNPFLRAGQASVKKALGMEDASDLEVF 243

Query: 246 TELRIRKNQ 254
           TE+R RK++
Sbjct: 244 TEIRARKDK 252


>gi|153000536|ref|YP_001366217.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS185]
 gi|226724023|sp|A6WMW5|GLO2_SHEB8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|151365154|gb|ABS08154.1| Hydroxyacylglutathione hydrolase [Shewanella baltica OS185]
          Length = 263

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 135/260 (51%), Gaps = 17/260 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANKLTLAGILLTHHHNDHTGGVA 65

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDT----FDFGSHPIKIIATPGHTIGHIC 120
            L+ +     +++GP  ++ KI GI H L          D+ S  ++++  PGHT GHI 
Sbjct: 66  ELQAYSQNRLSVYGP--DNEKIEGITHPLHATAQPRFILDYMSGELQVLDVPGHTAGHIA 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y  + D   C GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +N  F
Sbjct: 124 Y-VIADALFC-GDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLSNLKF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-------KN 233
           AL+ +P+N  LQ Y  +  ++R Q   T PSTI+LE+ +NPFLR  +T +         +
Sbjct: 182 ALAVNPNNRALQDYNERAIALRRQEKATIPSTIALERAINPFLRASDTEIVDSIKQHFSD 241

Query: 234 LNMENASNLAVFTELRIRKN 253
           LN  N   L  FT LR  K+
Sbjct: 242 LNHANLDELGGFTLLRQWKD 261


>gi|289627516|ref|ZP_06460470.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649933|ref|ZP_06481276.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868362|gb|EGH03071.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 259

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 135/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQATQARVLGPAAET--IPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|300312714|ref|YP_003776806.1| hydroxyacylglutathione hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300075499|gb|ADJ64898.1| hydroxyacylglutathione hydrolase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 264

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/263 (33%), Positives = 136/263 (51%), Gaps = 14/263 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  +IH+ +Y   A +D  D   +   L+ +G  L  I  THHH DH    
Sbjct: 4   LAVPAFDDNYLWIIHDGRY--AAVVDPGDAVPVLAALQAEGLTLAAILLTHHHADHVGGV 61

Query: 66  LNLKK------FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIG 117
           + L +      F    ++GP  E S+I G+   L   D  D     ++  +I  PGHT+G
Sbjct: 62  VELARQAASDTFPIIPVYGPAREQSRIKGMTVPLHGNDQVDIAVLGLRLEVIEVPGHTMG 121

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI YH      L  GDTLF+ GCGR+FE +  +M +SL ++ S   +T +Y  HEYT +N
Sbjct: 122 HIAYHAPEQAMLFCGDTLFAGGCGRLFEGTPQQMVDSLSRLASLPGQTAVYCAHEYTLSN 181

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SLRKN 233
             FA   +P N EL    ++ ++ R +   T P++I+LE++ NPFLR        SL+K 
Sbjct: 182 LKFAAEVEPGNAELHARITRERARRERGEPTVPTSIALERQTNPFLRATEKEILDSLQKA 241

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
             ++    ++ F  LR  KN  K
Sbjct: 242 GRLKELDEVSSFAALREWKNSYK 264


>gi|298486275|ref|ZP_07004338.1| Hydroxyacylglutathione hydrolase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159282|gb|EFI00340.1| Hydroxyacylglutathione hydrolase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 259

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 135/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQATRARVLGPAAET--IPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|71907227|ref|YP_284814.1| Beta-lactamase-like [Dechloromonas aromatica RCB]
 gi|123627642|sp|Q47FN7|GLO2_DECAR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71846848|gb|AAZ46344.1| Beta-lactamase-like protein [Dechloromonas aromatica RCB]
          Length = 265

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 129/263 (49%), Gaps = 23/263 (8%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+   K      +D  D   +   L   G  L  I  THHH DH      
Sbjct: 7   IPAFKDNYIWLLTRGKRAFV--VDPGDAAPVLARLEAGGLMLEGILITHHHADHQGGVAE 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +   ++ P  ES  I G    LS G++ D     + ++A PGHT+GH+ Y +    
Sbjct: 65  LKARWQAEVYAPGNES--ITGCSCPLSGGESIDVLGQKVTVMAVPGHTLGHLAY-YAPGA 121

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            LC GDTLF  GCGR+FE + A+M  SL+ I +    T IY  HEYTE N  FAL+ +P+
Sbjct: 122 LLC-GDTLFGAGCGRLFEGTPAQMSASLDSIAALPGDTLIYCAHEYTEMNLRFALAVEPN 180

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----------------- 230
           N  LQ   +KV ++R+  L + P  ++ EK  NPFLR    ++                 
Sbjct: 181 NQALQARVAKVAALRAAGLPSVPLILAEEKATNPFLRCHEAAVVEAGLQHAASCLLGHAA 240

Query: 231 RKNLNMENASNLAVFTELRIRKN 253
           ++  ++E+ S  A+F  +R  +N
Sbjct: 241 QQGADIEDRSKTAIFAAIRSWRN 263


>gi|313201262|ref|YP_004039920.1| hydroxyacylglutathione hydrolase [Methylovorus sp. MP688]
 gi|312440578|gb|ADQ84684.1| hydroxyacylglutathione hydrolase [Methylovorus sp. MP688]
          Length = 250

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 129/248 (52%), Gaps = 4/248 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  ++H H     A +D  D   + + L   G  L  I  THHH DH    
Sbjct: 5   IPIPAFSDNYIWMLHAHGQ--AAVVDPGDAEPVLQQLAASGLQLQTILITHHHNDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      ++ P  E+           D    DF    + ++  PGHT+GH+ Y+   
Sbjct: 63  ERLQHETGARVYAPARENYAFKHQPVHEGDQIELDFLPLTLTVLEVPGHTLGHVAYY--G 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE + A+M +SL K+ +   +T +Y  HEYTE+N  FA   D
Sbjct: 121 AKLLFCGDTLFSAGCGRLFEGTPAQMLDSLNKLAALPAETAVYCTHEYTEHNLKFARQLD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L    ++V  +R Q L + PST+++E++ NPFLR  + ++++   +  A+ LAVF
Sbjct: 181 PENAALLARQARVAQLRRQGLPSLPSTLAIERESNPFLRCASPAIQQASGIHEANPLAVF 240

Query: 246 TELRIRKN 253
           T +R  +N
Sbjct: 241 TAIREMRN 248


>gi|255261560|ref|ZP_05340902.1| hydroxyacylglutathione hydrolase [Thalassiobium sp. R2A62]
 gi|255103895|gb|EET46569.1| hydroxyacylglutathione hydrolase [Thalassiobium sp. R2A62]
          Length = 262

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 132/256 (51%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  +IH+     TA +D  D   I   L  +GW LT ++ THHH DH    
Sbjct: 6   VTLPCLEDNYAYIIHDPVSTATALVDVADHEPILAELDRRGWRLTDVWITHHHWDHVDGL 65

Query: 66  LNLKKFFNCTIFGPLEESS-----KIPG--IDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
             L          PL  ++     ++P   I   + +G    FG HP+++    GHTI H
Sbjct: 66  APLLDALAAKGIAPLVTAAAADMHRMPEGLITDTVEEGSNMRFGDHPVQVFDVSGHTINH 125

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I ++    +     D+L +LGCGR+FE + A+M++SL+K++    +T I  GHEYT +NA
Sbjct: 126 IAFYLAAANAAFTADSLMALGCGRLFEGTPAQMWKSLQKLRVLPPETVICSGHEYTASNA 185

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL+ +P N EL      V + R + + T PS +S E   NPFLR ++  L+  + M  
Sbjct: 186 KFALTIEPDNSELISRVRAVTAARDKGVPTVPSLLSDEINTNPFLRADHPDLQHAVGMAG 245

Query: 239 ASNLAVFTELRIRKNQ 254
           A+   VF  +R  K+Q
Sbjct: 246 ANASEVFAHVRRAKDQ 261


>gi|315497874|ref|YP_004086678.1| hydroxyacylglutathione hydrolase [Asticcacaulis excentricus CB 48]
 gi|315415886|gb|ADU12527.1| hydroxyacylglutathione hydrolase [Asticcacaulis excentricus CB 48]
          Length = 248

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 137/255 (53%), Gaps = 9/255 (3%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M++L I      +DN+  ++ +      A ID PD   ++  L  +GW L +I NTH H 
Sbjct: 1   MSALQIHQFPALNDNYGFVVRDQASGQVACIDTPDAERVTAALTAQGWGLDYILNTHWHP 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  LK  + C I+GP EE  K   +DH LS GD F  G     ++   GHT+GHI
Sbjct: 61  DHTGGNAALKDRYGCLIYGP-EEVRKAAPLDHVLSGGDRFALGQTVFDVLDLTGHTLGHI 119

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y   +++   VGDTLF+LGCGR+FE S ++M+ SL+ + +   +T +Y  HEYT +N  
Sbjct: 120 GYCAPSENVAFVGDTLFALGCGRLFEGSASDMWGSLQGLLALDPQTTLYCAHEYTMSNLM 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA S       L+   + +++ R++   T P  ++ E   NPF+      LR++     A
Sbjct: 180 FAESLGQFP-ALEARGADIRARRARGEPTVPMRLADEMTTNPFVVY---PLRES---GFA 232

Query: 240 SNLAVFTELRIRKNQ 254
           +  A F E+R  K++
Sbjct: 233 AQAAKFGEIRAAKDR 247


>gi|330889983|gb|EGH22644.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 259

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 134/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++   
Sbjct: 66  AELKQATRARVLGPAAET--IPARDIALVDHDLLTVLGLEFVVHAVPGHTLGHIAFYHEG 123

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT NN  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPKQMHDSLERLAKLPDSTLIYCAHEYTLNNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   R++N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVTRWRNENRISLPSNLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|127513042|ref|YP_001094239.1| hydroxyacylglutathione hydrolase [Shewanella loihica PV-4]
 gi|226724026|sp|A3QET2|GLO2_SHELP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|126638337|gb|ABO23980.1| Hydroxyacylglutathione hydrolase [Shewanella loihica PV-4]
          Length = 260

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 138/256 (53%), Gaps = 15/256 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTR--AN 65
           I  ++DN+  LIH         +D  D   +   L +    L  I  THHH DHT   A 
Sbjct: 7   IPAFNDNYIWLIHAKDSGGHYVVDPGDAKAVLDYLEQHQIVLDGILITHHHSDHTGGIAE 66

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIAT----PGHTIGHICY 121
           L        T++GP  ++  I GI+H +S G T       +   A     PGHT+GHI Y
Sbjct: 67  LQASHDHKLTVYGP--DNENIKGINHPIS-GQTESVKPEKLDSDAAVFHLPGHTLGHIAY 123

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
             ++DH  C GDTLFS GCGR+FE + A+M  SL+ +    + T +Y  HEYT+ N  FA
Sbjct: 124 -LIDDHLFC-GDTLFSAGCGRLFEGTPAQMHHSLQTLAQLDETTLVYPAHEYTQANLAFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ +  N  L  + +KVK +R QNL + PS+I LEK++NPFLR E  S+++NL+   A +
Sbjct: 182 LTVENDNEALIAHAAKVKQLRDQNLPSLPSSIGLEKQINPFLRPEQASIKQNLSCHFAQD 241

Query: 242 L----AVFTELRIRKN 253
           +      FT LR  K+
Sbjct: 242 VTDDGTSFTLLRQWKD 257


>gi|71738038|ref|YP_273947.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123637265|sp|Q48KX8|GLO2_PSE14 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71558591|gb|AAZ37802.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320325373|gb|EFW81440.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327642|gb|EFW83650.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 259

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 135/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLTEHPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQATRARVLGPAAET--IPARDVALVDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVIRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSSGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|330963308|gb|EGH63568.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 259

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 138/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + LK+     + GP  E  +IP  D  L+D D          + A PGHT+GHI ++  +
Sbjct: 66  VELKQATRARVLGPATE--RIPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 D--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  FA +
Sbjct: 124 ATAPLLFSGDTLFAAGCGRLFEGTPEQMHTSLERLAALPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V  +RS+N  + PS+++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAERLAQVTLLRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|16759247|ref|NP_454864.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142978|ref|NP_806320.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213021400|ref|ZP_03335847.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213162309|ref|ZP_03348019.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213419853|ref|ZP_03352919.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213428414|ref|ZP_03361164.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580945|ref|ZP_03362771.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612765|ref|ZP_03370591.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213852641|ref|ZP_03382173.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289804967|ref|ZP_06535596.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289828781|ref|ZP_06546540.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|81515710|sp|Q8Z983|GLO2_SALTI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|25311012|pir||AC0534 probable hydroxyacylglutathione hydrolase (EC 3.1.2.6) [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16501538|emb|CAD08715.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138610|gb|AAO70180.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 251

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 132/250 (52%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAAHKWMPEAIFLTHHHYDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|258621018|ref|ZP_05716052.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM573]
 gi|258586406|gb|EEW11121.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM573]
          Length = 252

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 134/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D      +   L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKLHDLNLKAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F +  + GP  E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPHTHVVGPAHE--PIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTSSNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVSTLDPLT 240

Query: 244 VFTELRIRKN 253
           +FT LR  KN
Sbjct: 241 IFTALREWKN 250


>gi|330975088|gb|EGH75154.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 259

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 137/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A++ ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALAAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQLTAARVLGPAAET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNVDIGERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|262372156|ref|ZP_06065435.1| hydroxyacylglutathione hydrolase [Acinetobacter junii SH205]
 gi|262312181|gb|EEY93266.1| hydroxyacylglutathione hydrolase [Acinetobacter junii SH205]
          Length = 243

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 120/216 (55%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  L+ + +      +D  +  ++          L  I+ TH H DHT     L    N
Sbjct: 16  NYIWLLEDTRTNEVIVVDPTEAKLVMDFCETHQLHLKQIWLTHWHPDHTNGVEGLLAEQN 75

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP +E SKIP + + L     F F    I++IATPGHT+GHI Y       L  GD
Sbjct: 76  ILVYGPRDELSKIPYLSNPLQHDYHFFFNDLKIEVIATPGHTLGHITYFIEEIDSLFCGD 135

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE +  +M+ SL ++ +   +T +Y  HEYT +NA FAL+ +PHN+ LQ+
Sbjct: 136 TLFAMGCGRLFEGTAEQMYHSLNRLAALPIQTKVYCTHEYTLSNAEFALTIEPHNVVLQE 195

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
              +VK +R  +  T PSTI LE + NPFLR EN  
Sbjct: 196 RFEQVKMLRESDQITLPSTIELELETNPFLRTENAE 231


>gi|330939727|gb|EGH43016.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 259

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQLTAARVLGPAAET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATPPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|330878787|gb|EGH12936.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 259

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 138/255 (54%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + LK+     + GP  ES  IP  D  L+D D          + A PGHT+GHI ++  +
Sbjct: 66  VELKQATRARVLGPATES--IPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 D--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  FA +
Sbjct: 124 ATAPLLFSGDTLFAAGCGRLFEGTPEQMHTSLERLAALPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V  +RS+N  + PS+++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAERLAQVTLLRSENRISLPSSLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|160872607|ref|ZP_02062739.1| hydroxyacylglutathione hydrolase [Rickettsiella grylli]
 gi|159121406|gb|EDP46744.1| hydroxyacylglutathione hydrolase [Rickettsiella grylli]
          Length = 257

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 137/261 (52%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   + I  + DN+   + N + +    +D  +   +   L++    L  +  THHH D
Sbjct: 1   MTIQLLPILAFKDNYIWCLINEETKHCLIVDPGEAKPVLAQLKQLNLTLDALLITHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP-IKIIATPGHTIGHI 119
           HT    ++   +   +FGP +E  KI G+ H +++ D  +    P  +I+A PGHT+GHI
Sbjct: 61  HTNGIRSILNHYPVPVFGPSKE--KIVGVTHPVNETDKIELTHWPSFEILAIPGHTLGHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+   +H L  GDTLF+ GCGR+FE +  +M  SLEK+    D+T IY GHEYT  N  
Sbjct: 119 AYY--GNHLLFCGDTLFTAGCGRLFEGTPDQMLNSLEKLAQLPDETQIYCGHEYTLANLN 176

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA + +P N  ++K   K + +R +NL   PS ++ E+  NPFLR  N  ++K +     
Sbjct: 177 FAQTIEPDNTHIKKRLEKTRELRQKNLPCVPSLLAEERLSNPFLRCNNPKIKKCIEKRTG 236

Query: 240 SNL----AVFTELRIRKNQSK 256
             L     +F  LR  KN  K
Sbjct: 237 KKLITPVEIFAYLRQWKNNFK 257


>gi|330897779|gb|EGH29198.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 259

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQLTAARVLGPAAET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|160395577|sp|Q21YF8|GLO2_RHOFD RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
          Length = 255

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 132/256 (51%), Gaps = 12/256 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++H+ ++ L   +D  D   + + L++ G  L  I  THHH DHT   
Sbjct: 4   IPLPAFTDNYIWMVHDERHALV--VDPGDAQPVLEALQQLGLQLETILVTHHHPDHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      +FGP  E    P I   L+            ++I  PGHT  HI Y F  
Sbjct: 62  AALRAATGAQVFGPAREPMPEPLIR--LTGDQQLQALGLNFQVIDVPGHTACHIAY-FCA 118

Query: 126 D----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLFS GCGR+FE S A+M  SL+ + +  D T +   HEYT +N  FA
Sbjct: 119 DVDGAPLLFCGDTLFSAGCGRLFEGSPAQMLASLDTLAALPDATRVCCAHEYTLSNLKFA 178

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS- 240
            + +P N  L  Y  K +++RSQ   T PS+I LE+++NPFLR    ++ + +   +AS 
Sbjct: 179 CAVEPVNQALTDYTVKAEALRSQQQPTLPSSILLERQINPFLRTRQATVTQAVQAFDASA 238

Query: 241 --NLAVFTELRIRKNQ 254
              +++F  LR  KNQ
Sbjct: 239 RDEVSIFAALRQWKNQ 254


>gi|330810143|ref|YP_004354605.1| Hydroxyacylglutathione hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378251|gb|AEA69601.1| Hydroxyacylglutathione hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 255

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 132/252 (52%), Gaps = 9/252 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +H  +  A +D  D   +   L    GW L+ I  THHH DH    
Sbjct: 6   ALPAFTDNYIWLLQDHATQRCAVVDPGDAAPVQAWLETHPGWVLSDILITHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK   N T++GP  E+  IP  D  L D DT         + A PGHT+GHI Y+   
Sbjct: 66  QALKNATNATVYGPASEN--IPARDKALHDNDTVSVLGWDFDVYAVPGHTLGHIAYYHHG 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE + A+M  SL ++ +  + T +Y  HEYT +N  FA + +
Sbjct: 124 --LLFCGDTLFAAGCGRLFEGTPAQMHHSLSRLAALPEDTLVYCTHEYTLSNLKFAAAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENASN 241
           P N ++     KV   RS+ + T PST++LEK  NPFLR   TS+++  +      N + 
Sbjct: 182 PGNPDVAARLEKVSRQRSEGIMTLPSTLALEKLTNPFLRTTETSVKQKADERNGQRNQTP 241

Query: 242 LAVFTELRIRKN 253
             VF  LR  K+
Sbjct: 242 SEVFAALRAWKD 253


>gi|330952811|gb|EGH53071.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae Cit 7]
          Length = 258

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQSTAARVLGPAAET--IPARDVALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATPPLLFSGDTLFAAGCGRLFEGTPQQMHDSLSRLADLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|296532382|ref|ZP_06895113.1| hydroxyacylglutathione hydrolase [Roseomonas cervicalis ATCC 49957]
 gi|296267293|gb|EFH13187.1| hydroxyacylglutathione hydrolase [Roseomonas cervicalis ATCC 49957]
          Length = 243

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 120/223 (53%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+    DN+  ++ +      A  D  +   + + L   G     I  THHH DH     
Sbjct: 7   AVPCLSDNYAWMLRDQATGTVAICDPGEAGPVIEALEAAGGRCDIILLTHHHPDHVDGVE 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            ++  F   + G   ++ ++P +D  ++ GDT   G+    +I +PGHTIGH+ +HF   
Sbjct: 67  EVRARFGARVIGAAADAHRLPKLDQAVAPGDTVAIGATTGTVIDSPGHTIGHVAFHFPEG 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+ E +  +MF +L  +K   D+T +  GHEYTE+NA FA++ +P
Sbjct: 127 AVLLCGDTLFSLGCGRLLEGTAEDMFRALSLLKPLPDETLVCCGHEYTESNARFAVTVEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
            N  L++  ++V++ R+    T P T+  EK+ NPFLR    S
Sbjct: 187 DNAALRERAAEVQAARAAGQPTLPVTLGREKETNPFLRASTAS 229


>gi|56750161|ref|YP_170862.1| hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 6301]
 gi|56685120|dbj|BAD78342.1| hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 6301]
          Length = 223

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 118/220 (53%), Gaps = 9/220 (4%)

Query: 42  LREKGWFLTHIFNTHHHIDHTRANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD 100
           L+ +G  LT I NTHHH DH   N  L ++F    +     +  +IPG    L  GD   
Sbjct: 5   LQAEGLTLTAILNTHHHGDHVGGNRRLLRQFPEAAVSASAVDRDRIPGQTVLLEAGDRLQ 64

Query: 101 FGSHPIKIIATPGHTIGHICYHFMN------DHFLCVGDTLFSLGCGRIFEDSYAEMFES 154
                 +++  PGHT GHI Y+F           L  GDTLF+ GCGR+FE + A+M +S
Sbjct: 65  ICGQTAEVLFVPGHTRGHIAYYFPEVAEGNPRGALFCGDTLFAGGCGRLFEGTPAQMLDS 124

Query: 155 LEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTIS 214
           L++++S  D T IY  HEYT NN  FAL+ +P N +LQ+    V   R Q   T PS + 
Sbjct: 125 LQQLRSLPDDTAIYCAHEYTLNNLRFALTVEPDNFDLQQRYQAVAIARQQGQATIPSRLD 184

Query: 215 LEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKNQ 254
           +EK  NPFLR +  +L+  ++ ++   +     LR RK+Q
Sbjct: 185 IEKATNPFLRWDQAALQAAVSSQDP--VQTLARLRSRKDQ 222


>gi|71279881|ref|YP_268729.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
 gi|71145621|gb|AAZ26094.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
          Length = 265

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 137/260 (52%), Gaps = 19/260 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+   I +      A +D  D  +  K L+E    L+ I  THHH DH     
Sbjct: 10  AINAFNDNYIWAISSQNNDKIALVDPGDAVVCIKYLQENNLALSAILITHHHSDHVGGIE 69

Query: 67  NL-----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
            L      K +  T++GP  E  KI  +D  L + DT D      +  ++  PGHT GHI
Sbjct: 70  KLLEYSKDKAWPVTVYGPATE--KIAQLDITLKENDTVDLTELDCQFTVLDLPGHTKGHI 127

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+  ND  +  GDTLFS GCGR+FE +  +M  SL K+ + +  T IY  HEYT+ N  
Sbjct: 128 AYY--NDKMVFCGDTLFSGGCGRLFEGTPQQMHHSLTKLANLATDTLIYCAHEYTQANLA 185

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR------KN 233
           FAL+ +P+N +L  Y  +VK  R QN  T P+ I+LE ++NPFLR    S++       N
Sbjct: 186 FALAVEPNNTDLHNYAEQVKVKRQQNQATIPTNIALELQINPFLRCHEESIKLAAQTYSN 245

Query: 234 LNMENASNLAVFTELRIRKN 253
            N  N S   VF+ +R  K+
Sbjct: 246 QNQPNDSE--VFSAIRAWKD 263


>gi|329900788|ref|ZP_08272592.1| Hydroxyacylglutathione hydrolase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549377|gb|EGF33945.1| Hydroxyacylglutathione hydrolase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 259

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 135/260 (51%), Gaps = 11/260 (4%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L +  I  + DN+  L+H+  +   A +D  D   I   L      L  I  THHH 
Sbjct: 1   MATLQVLTIPAFDDNYLWLVHDGVH--AAVVDPGDAGPILAALALHQLSLVAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIG 117
           DH      L +  +  ++GP  E  KIP I H L  GDT         + ++  PGHT G
Sbjct: 59  DHVGGVPELLQHASVPVYGPRHE--KIPTITHPLVQGDTVVVPELQWQLGVLDVPGHTSG 116

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y    + +L  GDTLF+ GCGR+FE +  +M  SL+K+ +   +T ++  HEYT  N
Sbjct: 117 HIAYFAAAEEWLFCGDTLFAGGCGRLFEGTPEQMDASLQKLAALPGRTSVFCAHEYTMAN 176

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-- 235
             FA + +P N+ LQ+   + +  R +++ T PSTI+LE++ NPFLR     +R +L   
Sbjct: 177 LRFAQAVEPGNVALQERIVREQDKRDRHIPTVPSTIALERETNPFLRWREADIRHSLQQA 236

Query: 236 --MENASNLAVFTELRIRKN 253
             + + + +A F  LR  KN
Sbjct: 237 GKLGDDTGIAGFAALRAWKN 256


>gi|186475635|ref|YP_001857105.1| hydroxyacylglutathione hydrolase [Burkholderia phymatum STM815]
 gi|184192094|gb|ACC70059.1| hydroxyacylglutathione hydrolase [Burkholderia phymatum STM815]
          Length = 267

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 144/270 (53%), Gaps = 21/270 (7%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M SL  + +  + DN+  ++ +  + +   +D  D   +   L ++GW L+ I  THHH 
Sbjct: 1   MNSLEYVPVPAFDDNYIWVVSDGHHAVV--VDPGDAAPVKAYLAKRGWRLSAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPG 113
           DH     +L    + +    ++GP  E+  IP +   L  GDT    +  +   I+  PG
Sbjct: 59  DHVGGVADLLNGQDASQALPVYGPAGEA--IPWLTERLVQGDTVHIAAPSLTFTILDVPG 116

Query: 114 HTIGHICYHFMND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
           HT GHI Y    D     H  C GDTLF+ GCGR+FE + A+M ESL+ + +   +T ++
Sbjct: 117 HTRGHIAYFQAADSRGTPHVFC-GDTLFACGCGRLFEGTPAQMLESLDALAALPGETEVH 175

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L+ +  +  ++R++++ T P+TI+ E+ VNPFLR    
Sbjct: 176 CAHEYTLSNIRFALACEPDNPVLRAWRDEAAALRARHMPTLPTTIAHERAVNPFLRAGEA 235

Query: 229 S----LRKNLNMENASNLAVFTELRIRKNQ 254
           S    L + L+      LA FT +R  KN+
Sbjct: 236 SVQSTLAEQLHESVPDRLAAFTLMREWKNR 265


>gi|161525203|ref|YP_001580215.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|189350058|ref|YP_001945686.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|160342632|gb|ABX15718.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|189334080|dbj|BAG43150.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
          Length = 268

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 141/265 (53%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAEPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP +E+  +  + H L+ G   T D  +    ++A PGHT GHI
Sbjct: 65  AALQDSQPADVPLPVYGPADEAIGV--VTHPLAGGARVTLDAPAATFDVLAVPGHTRGHI 122

Query: 120 CY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y      H    H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPHTPVPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPFLR +  ++   
Sbjct: 182 TLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFLRADAAAIHAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E        LA FT +R  KN+
Sbjct: 242 LEAELHESVPDRLAAFTLMREWKNR 266


>gi|262166315|ref|ZP_06034052.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
 gi|262026031|gb|EEY44699.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
          Length = 252

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 134/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D      +   L+     L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIQNSD-RDCAVVDPGIAEPVLAYLKLHDLNLKAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F +  + GP  E   IP + H + DGD  +       ++  PGHT+GHI Y  + 
Sbjct: 65  ELVHQFPHTHVVGPAHEP--IPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVSTLDPLT 240

Query: 244 VFTELRIRKN 253
           +FT LR  KN
Sbjct: 241 IFTALREWKN 250


>gi|332019079|gb|EGI59609.1| Hydroxyacylglutathione hydrolase, mitochondrial [Acromyrmex
           echinatior]
          Length = 299

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 137/249 (55%), Gaps = 9/249 (3%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKK- 70
            DN+  LI + + +  A +D  D   ++  +++    LT +  THHH DH   N  L K 
Sbjct: 55  QDNYMYLIIDEETQEAAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWDHAGGNAKLSKS 114

Query: 71  FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND--HF 128
           F +  I+G      +I  I+  +   DTF+ G+  +K +ATP HT GHICY+   +  H 
Sbjct: 115 FADLVIYG---GDDRIEAINRKIMHNDTFNIGNLSVKCLATPCHTRGHICYYVTGEGQHS 171

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
           +  GDTLF+ GCG+ FE +  +M+++L E + S  ++T +Y GHEYT NN  F L  +P 
Sbjct: 172 VFTGDTLFAGGCGKFFEGTADQMYKALIEILGSLPEETKVYCGHEYTVNNLKFGLHVEPE 231

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N+ +Q+   +V   R+ NL T PSTI  EK  NPF+R+   S+ K++   +   +   + 
Sbjct: 232 NVAIQQKLDQVHIQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHVRQNDP--IQTMSH 289

Query: 248 LRIRKNQSK 256
           LR  K+  K
Sbjct: 290 LRREKDNFK 298


>gi|119503280|ref|ZP_01625364.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2080]
 gi|119460926|gb|EAW42017.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2080]
          Length = 255

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 132/250 (52%), Gaps = 10/250 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+H+    +   +D  D  ++   L ++   L  I  THHH DH      
Sbjct: 10  IPAFSDNYIWLLHDDTNAVV--VDPGDAQVVLAALSKRNLSLQSILITHHHFDHVGGIAA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L +  +C ++GP   + KI  + H + +GDT      P+ ++  PGHT+ HI Y  + + 
Sbjct: 68  LTEATHCEVWGP--TNPKITPVTHRVKEGDTLQVLGEPMHVLEVPGHTLDHIAY--LGEG 123

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF+ GCGR+FE ++  M  SL K++    +T +Y  HEYT  N  FAL+ DPH
Sbjct: 124 VLFCGDTLFAGGCGRVFEGTHPMMRSSLAKLRGLDPETKVYCAHEYTIANLQFALAADPH 183

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMENASNLA 243
           N  L +      S+R +N+ T PS ++ E   NPFLR +  S+ +NL     +++  +  
Sbjct: 184 NATLAERMQLCSSLRERNIPTVPSLLADEIATNPFLRWDAPSVVENLAAASRLKSPQSDD 243

Query: 244 VFTELRIRKN 253
           VF  LR  K+
Sbjct: 244 VFAGLRQWKD 253


>gi|117920812|ref|YP_870004.1| beta-lactamase domain-containing protein [Shewanella sp. ANA-3]
 gi|226724029|sp|A0KXS9|GLO2_SHESA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|117613144|gb|ABK48598.1| beta-lactamase domain protein [Shewanella sp. ANA-3]
          Length = 267

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 138/264 (52%), Gaps = 21/264 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+  ++     +    +D  D  ++   L  +   L  I  THHH DHT    
Sbjct: 6   AINAFNDNYIWVLRQDSQQAVYVVDPGDANVVLDYLHAQRLSLAGILITHHHRDHTGGIA 65

Query: 67  NLKKFFNCT------IFGPLEESSKIPGIDHG----LSDGDTFDFGSHPIKIIATPGHTI 116
            L      T      ++GP  +S  I GI+      LSD  T  F   P++I++ PGHT 
Sbjct: 66  ALTDHVKQTTGHDLAVYGP--QSEDIQGINQPIEPTLSDSLTLPFIDAPVRILSVPGHTA 123

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y  ++D   C GDTLFS GCGR+FE + ++M++SL  + +  D+T +Y  HEYT +
Sbjct: 124 GHIAY-LVDDALFC-GDTLFSAGCGRLFEGTPSQMWQSLSLLAALPDETRVYCAHEYTLS 181

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-- 234
           N  FA + D  N  L  Y  +  ++R+Q   T PSTI LE+ +NPFLR  + ++  ++  
Sbjct: 182 NLKFAQTVDTDNEALNAYVEEASTLRAQGKATIPSTIGLERAINPFLRPLSPTIVNSIKN 241

Query: 235 -----NMENASNLAVFTELRIRKN 253
                ++  A  L  FT LR  K+
Sbjct: 242 QFCDQDLTKADELTCFTLLRQWKD 265


>gi|217970692|ref|YP_002355926.1| hydroxyacylglutathione hydrolase [Thauera sp. MZ1T]
 gi|217508019|gb|ACK55030.1| hydroxyacylglutathione hydrolase [Thauera sp. MZ1T]
          Length = 257

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 133/257 (51%), Gaps = 12/257 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  L+H+ ++ L   +D  D   + + LRE G  L  I  THHH DHT   
Sbjct: 4   IPVPAFRDNYIWLVHDGRHALV--VDPGDATPVEEALREHGLVLGAILVTHHHPDHTGGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGHICYHF 123
             L       ++GP  ES  I G+ H +SDGD     +  I  +++  PGHT GH+ Y  
Sbjct: 62  AALVASHRVPVYGPARES--IAGVVHAVSDGDEIHLPAPAIALRVLDVPGHTAGHVAYVG 119

Query: 124 MN--DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           M+     +  GDTLFS GCGR+FE +  ++  SL ++ +    T ++  HEYT +N  FA
Sbjct: 120 MDIEPGLVFCGDTLFSAGCGRLFEGTPTQLEHSLARLAALPPDTRVFCTHEYTLSNLAFA 179

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            + +P N+E   + +  +++R++   T PST+S E  +NPFLR +   + + +     S 
Sbjct: 180 RAAEPENVERDAWAAHCETLRARGEPTLPSTVSRELAINPFLRCDQPGVIEAVAAHTGSR 239

Query: 242 ----LAVFTELRIRKNQ 254
               L     LR  K++
Sbjct: 240 PQDALECLAALRAWKDR 256


>gi|330503131|ref|YP_004380000.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina NK-01]
 gi|328917417|gb|AEB58248.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina NK-01]
          Length = 257

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 128/252 (50%), Gaps = 7/252 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDTDTRRCAVVDPGDAAPVQAWLEAHPQWQLSDILITHHHFDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK      + GP  E  KIP  D  L+D D         +++A PGHT+GHI Y+   
Sbjct: 66  EKLKSATGARVAGPAAE--KIPARDLDLNDNDEIVVLGLRFQVMAVPGHTLGHIAYYDGE 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            + L  GDTLF+ GCGR+FE +  +M +SL ++ +   +T +Y  HEYT +N  FA + +
Sbjct: 124 QNLLFCGDTLFAGGCGRLFEGTPQQMHQSLSRLAALPARTKVYCTHEYTLSNLRFAHAVE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKNLNMENASN 241
           P NL L +  ++V   R +   + PS I LE   NPFLR    S+    +   N +++  
Sbjct: 184 PDNLRLSERLAEVTRWREEGRISLPSNIELELATNPFLRTREPSIIAAAKGRENGQSSEP 243

Query: 242 LAVFTELRIRKN 253
            A+F  LR  K+
Sbjct: 244 SAIFASLRTWKD 255


>gi|260775263|ref|ZP_05884160.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608444|gb|EEX34609.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 252

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 136/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  LI N   R  A +D  D   + + L++    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLIKNSDQR-CAVVDPGDAAPVLEYLKQHELSLEAILITHHHNDHIGGVP 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L ++F    + GP  E   +P + H +  G+  +       ++   GHT GHI Y  + 
Sbjct: 65  ELVRQFPGVDVVGPANEP--VPTLTHAVEAGEQIELFGEIFFVLGLEGHTRGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T +Y  HEYT +N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMHTSLNKLVALPEETEVYCAHEYTASNVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N  LQ+Y  +V  +R+QN  T P+TI  EK +NPFLR +  S+ +++    +   +LA
Sbjct: 181 PDNELLQQYRDEVNRLRAQNKPTLPTTIRKEKWINPFLRTDQQSVIRSVANRTQQTDSLA 240

Query: 244 VFTELRIRKNQ 254
           +F+ LR  KN+
Sbjct: 241 IFSALREWKNE 251


>gi|254429099|ref|ZP_05042806.1| metallo-beta-lactamase superfamily protein [Alcanivorax sp. DG881]
 gi|196195268|gb|EDX90227.1| metallo-beta-lactamase superfamily protein [Alcanivorax sp. DG881]
          Length = 257

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 131/259 (50%), Gaps = 10/259 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT+  IAI  ++DN+    H     +   +D  D   + + L E G  L+ +  THHH D
Sbjct: 1   MTASPIAIPAFNDNYIWAFHQQDQCVV--VDPGDAAPVERYLSENGLTLSALLITHHHPD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGH 118
           H      L +  +  ++GP  ES  IP + H L DGDT       +   ++A PGHT+GH
Sbjct: 59  HVGGIAALIRDRDIPVYGPAAES--IPAMSHPLRDGDTLTPAGTDLSFSVMAVPGHTLGH 116

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I +      +L  GDTLF+ GCGR+FE +  +M  SL ++ +  D T ++  HEYT+ N 
Sbjct: 117 IAFINAAQGWLFCGDTLFAGGCGRLFEGTPEQMLHSLRRLAALPDTTQVFCAHEYTQANL 176

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA +  P +  +Q     V  +R +   + PST++ EK  NPFLR ++  L+ +     
Sbjct: 177 TFAAAVTPEDPAVQARLQAVIDLRQKGKISLPSTLAEEKATNPFLRSDDKDLKDSCQRHE 236

Query: 239 A----SNLAVFTELRIRKN 253
                S++  F  LR  K+
Sbjct: 237 PGCGDSDMQCFAALRRWKD 255


>gi|257483799|ref|ZP_05637840.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331012691|gb|EGH92747.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 259

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 134/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + L  I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLADILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQATRARVLGPAAET--IPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|170722633|ref|YP_001750321.1| hydroxyacylglutathione hydrolase [Pseudomonas putida W619]
 gi|226724010|sp|B1JBN3|GLO2_PSEPW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169760636|gb|ACA73952.1| hydroxyacylglutathione hydrolase [Pseudomonas putida W619]
          Length = 259

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 130/256 (50%), Gaps = 13/256 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   +   L     W L  I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAAPVEAWLAANPDWVLEDILVTHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LKK     + GP  E  +IP  D  L +GD         +++A PGHT+GHI   F +
Sbjct: 66  ERLKKLTGARVSGPANE--RIPCRDLALDEGDEVTAVGVTFQVLAVPGHTLGHIA--FFS 121

Query: 126 DH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           D      L  GDTLF+ GCGR+FE +  +M  +L ++ S  ++T +Y  HEYT +N  FA
Sbjct: 122 DQPATPVLFSGDTLFAAGCGRMFEGTPEQMQPALARLASLPERTEVYCAHEYTLSNLRFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----E 237
            + +P N  + +    V  +R+ N  T PSTI LE+  NPFLR   T +++  +      
Sbjct: 182 KAVEPQNPHVLQRFDDVTRLRADNRITLPSTIGLERLTNPFLRTSATLVKQKADEWKGHS 241

Query: 238 NASNLAVFTELRIRKN 253
           N +++AVF  LR  K+
Sbjct: 242 NTTHVAVFAALRSWKD 257


>gi|50085536|ref|YP_047046.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter sp.
           ADP1]
 gi|49531512|emb|CAG69224.1| putative hydroxyacylglutathione hydrolase (GloB) [Acinetobacter sp.
           ADP1]
          Length = 244

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 125/215 (58%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+  ++ +   +    +D  ++ ++ +   +    +  I+ TH H DH     +L    +
Sbjct: 17  NYIWILKDSHTQEIIVVDPTESSLVQQYCEKHQVKIAQIWLTHWHKDHIGGVPDLIDGSH 76

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
             ++GP EE SKIP I H L   + F F    ++++ATPGHT+GH+ Y       L  GD
Sbjct: 77  IPVYGPREELSKIPLITHPLQHENHFKFNHLNVEVLATPGHTLGHVVYFIEETGSLFCGD 136

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF++GCGR+FE S+ +M+ SL ++ +    T +Y  HEYT  NA FA++ +P NL L++
Sbjct: 137 TLFAMGCGRVFEGSFEQMYHSLNRLAALPTTTKVYCTHEYTLANAEFAVTVEPDNLALKE 196

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
              +V+S+RS++  T PSTI+LE   NPFLR E+ 
Sbjct: 197 RLKEVQSLRSRHQITLPSTIALELATNPFLRTESV 231


>gi|152981854|ref|YP_001352899.1| hydroxyacylglutathione hydrolase [Janthinobacterium sp. Marseille]
 gi|151281931|gb|ABR90341.1| hydroxyacylglutathione hydrolase [Janthinobacterium sp. Marseille]
          Length = 258

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 128/255 (50%), Gaps = 12/255 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  ++DN+  +IH+  +   A +D  D   I   L      L  I  THHH DH    
Sbjct: 7   LTVPAFNDNYLWIIHDGVH--AAVVDPGDAKPILAALEAHKLSLVAILLTHHHSDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF---DFGSHPIKIIATPGHTIGHICYH 122
             L + F   +F P ++   I  +   L +GD     + G   + ++  PGHT+GHI Y 
Sbjct: 65  STLLQHFKVPVFAPRKDP--IANVTQPLDEGDVVTIPELGLE-LSVLHVPGHTLGHIAYV 121

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                +L  GDTLF+ GCGR+FE +  +M  SL+K+ +  D T +Y  HEYT +N  FAL
Sbjct: 122 AKEQGWLFCGDTLFAGGCGRLFEGTPTQMLASLDKLAALPDDTKVYCAHEYTISNLRFAL 181

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME----N 238
           + +P N  L       ++ R QN+ T PS I LEK  NPFLR    ++ K +  E    N
Sbjct: 182 AAEPANTALASRFEAEQAKRKQNIPTVPSNIGLEKSTNPFLRAREPAIAKQMVAEGRAKN 241

Query: 239 ASNLAVFTELRIRKN 253
           A  + VF  LR  KN
Sbjct: 242 ADPVTVFAALREWKN 256


>gi|253999160|ref|YP_003051223.1| hydroxyacylglutathione hydrolase [Methylovorus sp. SIP3-4]
 gi|253985839|gb|ACT50696.1| hydroxyacylglutathione hydrolase [Methylovorus sp. SIP3-4]
          Length = 250

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 131/250 (52%), Gaps = 8/250 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  ++H H     A +D  D   + + L   G  L  I  THHH DH    
Sbjct: 5   IPIQAFSDNYIWMLHAHGQ--AAVVDPGDAEPVLQQLAASGLQLQTILITHHHNDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDT--FDFGSHPIKIIATPGHTIGHICYHF 123
             L+      ++ P  E+         + +GD    DF    + ++  PGHT+GH+ Y+ 
Sbjct: 63  ERLQHETGARVYAPARENYAF--THQPVHEGDQIELDFLPLSLTVLEVPGHTLGHVAYY- 119

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLFS GCGR+FE + A+M +SL K+ +   +T +Y  HEYTE+N  FA  
Sbjct: 120 -GAKLLFCGDTLFSAGCGRLFEGTPAQMLDSLNKLAALPAETAVYCTHEYTEHNLKFARQ 178

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            DP N  L    ++V  +R Q L + PST+++E++ NPFLR  + ++++   +  A+ L 
Sbjct: 179 LDPTNTALLARQAQVAQLRQQGLPSLPSTLAIERESNPFLRCASPAIQQASGIHEANPLV 238

Query: 244 VFTELRIRKN 253
           VFT +R  +N
Sbjct: 239 VFTAIREMRN 248


>gi|209517194|ref|ZP_03266039.1| hydroxyacylglutathione hydrolase [Burkholderia sp. H160]
 gi|209502330|gb|EEA02341.1| hydroxyacylglutathione hydrolase [Burkholderia sp. H160]
          Length = 263

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 136/260 (52%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  +I +  + +   +D      +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWVIADGHHAVV--VDPGAAAPVRACLAQRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L    +  ++GP  E+  I  +   L  GD     +  ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQDVPVYGPAGEA--IAHLTRRLKSGDHVTIAAPALEFSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 TADSRGTPHVFC-GDTLFACGCGRLFEGTPQQMLTSLDALAALPGATEVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME- 237
            FAL+C+PHN ELQ +  K   +R+++  T P+TI+ E+ VNPFLR    S++ NL  + 
Sbjct: 182 RFALACEPHNAELQAWRDKANELRARHQPTLPTTIAHERAVNPFLRAGEPSVQSNLEAQL 241

Query: 238 ---NASNLAVFTELRIRKNQ 254
               +  L  FT +R  KN+
Sbjct: 242 HETVSDRLTAFTLMREWKNR 261


>gi|66045006|ref|YP_234847.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           B728a]
 gi|75502661|sp|Q4ZVL3|GLO2_PSEU2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|63255713|gb|AAY36809.1| Hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 259

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQSTAARVLGPAAET--IPARDIALVDNDRMTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++      + +N 
Sbjct: 184 VEPANVDIAERLAEVTRWRSENRISLPSNMALEKRTNPFLRTGETSVKEKADERSDAQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|323181624|gb|EFZ67039.1| hydroxyacylglutathione hydrolase [Escherichia coli 1357]
          Length = 251

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+ I + N +      +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNY-IWVLNDEAGCCLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHNDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|289679438|ref|ZP_06500328.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           FF5]
          Length = 259

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 135/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQLTAARVLGPAAET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+ +  +     +N 
Sbjct: 184 VEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVNEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|307179408|gb|EFN67738.1| Hydroxyacylglutathione hydrolase [Camponotus floridanus]
          Length = 302

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 134/250 (53%), Gaps = 10/250 (4%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI +   +  A +D  D   ++  +++    LT +  THHH DH   N  L K 
Sbjct: 57  QDNYMYLIIDEATQEAAVVDPVDPETVAAAVQQNNVKLTKVLTTHHHWDHAGGNAKLLKS 116

Query: 72  FN-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF-- 128
           FN  TI+G      +I  I+H ++  DTF+ G+  +K +ATP HT GHICY+   +    
Sbjct: 117 FNDLTIYG---GDDRIEAINHKITHNDTFNIGNLSVKCLATPCHTRGHICYYVTGEEHPP 173

Query: 129 -LCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +  GDTLF+ GCGR FE +  +M+++L E + S  ++T +Y GHEYT NN  F L  +P
Sbjct: 174 SVFTGDTLFAGGCGRFFEGTADQMYKALIEILGSLPEETKVYCGHEYTANNLKFGLHVEP 233

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  +Q+        R+ NL T PSTI  EK  NPF+R+   ++ K+    +   +   +
Sbjct: 234 ENKAIQQKLDWSHEQRANNLPTVPSTIKDEKLTNPFMRVHEPTVMKHAQQNDP--IQTMS 291

Query: 247 ELRIRKNQSK 256
            LR  K+  K
Sbjct: 292 YLRREKDNFK 301


>gi|260767802|ref|ZP_05876737.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
 gi|260617311|gb|EEX42495.1| hydroxyacylglutathione hydrolase [Vibrio furnissii CIP 102972]
          Length = 226

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 123/228 (53%), Gaps = 7/228 (3%)

Query: 30  IDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKFFNCTIFGPLEESSKIPG 88
           +D  D   +   L +    L  I  THHH DH      L +++ N  + GP +E   IP 
Sbjct: 2   VDPGDAAPVLAYLSQHDLTLEAILITHHHHDHIGGVPELVRQYPNVDVVGPSQE--PIPT 59

Query: 89  IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSY 148
           + H +  GD  +       ++  PGHT+GHI Y  + D  L  GD LFS GCGR+FE + 
Sbjct: 60  LTHPVDAGDQIELFDERFMVLGLPGHTLGHIGY--VGDGKLFCGDVLFSAGCGRVFEGTM 117

Query: 149 AEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT 208
            +MF SL K+ +  ++T +Y  HEYT +N  FA++ +P N +LQ Y  +V  +R Q   T
Sbjct: 118 EQMFTSLSKLVALPEETEVYCAHEYTASNVAFAMAVEPDNEQLQIYRDEVIRLRGQGYAT 177

Query: 209 NPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLAVFTELRIRKNQ 254
            PST+  EK +NPFLR +  S+ K++         L++FT LR  KN+
Sbjct: 178 LPSTVRREKWINPFLRTQEPSVMKSVANRTPQTDALSIFTALREWKNE 225


>gi|330972575|gb|EGH72641.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 259

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELQQSTAARVLGPAAET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPANVDIAERLAEVTRWRSENRISLPSNMALEKRTNPFLRTGETSVKEKADERSGAQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|78065900|ref|YP_368669.1| hydroxyacylglutathione hydrolase [Burkholderia sp. 383]
 gi|77966645|gb|ABB08025.1| Hydroxyacylglutathione hydrolase [Burkholderia sp. 383]
          Length = 268

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 140/265 (52%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+         T++GP  E+  +  +   LS GD  T D  +    ++  PGHT GHI
Sbjct: 65  AALRDSQPDDAPLTVYGPAAEAIGV--VTRPLSGGDRVTLDAPAATFDVLDVPGHTRGHI 122

Query: 120 CYHFMND------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    TH++  HEY
Sbjct: 123 AYFQAAGQGNAAPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTHVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ ++R  
Sbjct: 182 TLSNIRFALACEPGNTALATWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSDAIRAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E        L  FT +R  KN+
Sbjct: 242 LEAELHETVPDRLTAFTLMREWKNR 266


>gi|121604583|ref|YP_981912.1| hydroxyacylglutathione hydrolase [Polaromonas naphthalenivorans
           CJ2]
 gi|120593552|gb|ABM36991.1| Hydroxyacylglutathione hydrolase [Polaromonas naphthalenivorans
           CJ2]
          Length = 256

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 131/255 (51%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           IS + DN+  L+H+ K  L   +D  D   + + L +    L  I  THHH DHT     
Sbjct: 6   ISAFADNYLWLLHDGKRALV--VDPGDAEPVLRALEQSALQLESILVTHHHADHTGGVDA 63

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L+K     ++GP  E  +IP     L +GD+        +++  PGHT GHI ++  +  
Sbjct: 64  LRKATGAKVYGPANE--RIPAPFEPLHEGDSVHTLGLDFQVLDVPGHTAGHIAFYTPDMD 121

Query: 126 -DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFS GCGR+FE + A+M  SL+K+ + S  T +   HEYT +N  FAL+ 
Sbjct: 122 GRPLLFCGDTLFSGGCGRLFEGTPAQMLASLDKLAALSGATRVCCAHEYTLDNLRFALAV 181

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS---N 241
           +P N +L  Y      +R+Q   T PS+I  E  +NPFLR    SL       +AS   +
Sbjct: 182 EPDNTDLAAYQQHCLRLRAQGQPTLPSSIQQEILINPFLRTRRASLVSAARHFDASVHDD 241

Query: 242 LAVFTELRIRKNQSK 256
            +VF  LR  KNQ K
Sbjct: 242 TSVFAALRQWKNQFK 256


>gi|58038755|ref|YP_190719.1| hydroxyacylglutathione hydrolase [Gluconobacter oxydans 621H]
 gi|58001169|gb|AAW60063.1| Hydroxyacylglutathione hydrolase [Gluconobacter oxydans 621H]
          Length = 259

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 111/205 (54%), Gaps = 14/205 (6%)

Query: 49  LTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKI 108
           L  I  THHH DHT     L++ +   ++GP ++   +P +DH + DGD+   GS  I++
Sbjct: 67  LDMILLTHHHADHTAGTDALRERYGAKVYGPRQKREWLPRLDHDVEDGDSLSLGSAQIRV 126

Query: 109 IATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
           ++TPGH +GH+ Y       L  GD LFSLGCGR+ E +  E+F+SL +  S  D+T + 
Sbjct: 127 LSTPGHAVGHVSYVVPEVPALFCGDVLFSLGCGRLLEGTAQELFDSLHRYDSLPDQTLVC 186

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
            GHEYT +N  FAL  DP N  L+    +++ +      T P ++ +E++ NPFL     
Sbjct: 187 AGHEYTRSNLAFALHVDPDNAALKARAGEIEQLLEAGRPTLPVSLGVERRTNPFLL---- 242

Query: 229 SLRKNLNMENASNLAVFTELRIRKN 253
                     A ++A F  LR  K+
Sbjct: 243 ----------APDVATFARLRREKD 257


>gi|254282523|ref|ZP_04957491.1| hydroxyacylglutathione hydrolase [gamma proteobacterium NOR51-B]
 gi|219678726|gb|EED35075.1| hydroxyacylglutathione hydrolase [gamma proteobacterium NOR51-B]
          Length = 257

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 122/233 (52%), Gaps = 6/233 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+ + ++R    +D  D   +  +L E+G  L  I  THHH DH    L 
Sbjct: 8   IPAFQDNYIWLLEDTQHR-AVVVDPGDAEPVQAVLAERGLDLHAILITHHHPDHVGGVLT 66

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY--HFMN 125
           LK    C ++GP   + +I GIDH L DGD  D      +++   GHT+ HI Y  H   
Sbjct: 67  LKTATGCKVYGP--RNPEIEGIDHPLKDGDQIDVLGESFEVLEVGGHTLDHIAYLSHTSE 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
               C GDTLF  GCGR+FE +   M++SL ++ +   +T +Y  HEYT  N  FA + +
Sbjct: 125 PALFC-GDTLFVAGCGRMFEGTPPLMYQSLARLAALPPQTAVYCAHEYTLANLAFARAAE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           P N  +      ++++R+    T PS+I+ E K NPFLR    ++ + L  E+
Sbjct: 184 PGNSAITARIEDLETVRAAGEPTVPSSIAWELKTNPFLRCGEPTIVEQLQRED 236


>gi|221201958|ref|ZP_03574994.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2M]
 gi|221204912|ref|ZP_03577929.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2]
 gi|221213889|ref|ZP_03586862.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD1]
 gi|221166066|gb|EED98539.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD1]
 gi|221175769|gb|EEE08199.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2]
 gi|221178041|gb|EEE10452.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2M]
          Length = 268

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 140/265 (52%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAEPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP +E+  +  + H L+ G   T D  +    ++A PGHT GHI
Sbjct: 65  AALQDSQPADVPLPVYGPADEAIGV--VAHPLAGGARVTLDAPAATFDVLAVPGHTRGHI 122

Query: 120 CY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y      H    H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPHTPVPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPFLR +  ++   
Sbjct: 182 TLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFLRADAAAIHAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E        L  FT +R  KN+
Sbjct: 242 LEAELHESVPDRLTAFTLMREWKNR 266


>gi|119898348|ref|YP_933561.1| hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
 gi|119670761|emb|CAL94674.1| probable hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
          Length = 253

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/254 (33%), Positives = 127/254 (50%), Gaps = 12/254 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++H+    +   +D  D   +   L E+G  L  +  THHH DH    
Sbjct: 4   IPLPAFRDNYIWVLHDDHRAVV--VDPGDAAPVLGFLAERGLALEAVLVTHHHPDHVDGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGS--HPIKIIATPGHTIGHICYHF 123
             +       ++GP  E+  I G+   L +GDT         + ++  PGHT GHI YH 
Sbjct: 62  AGIVSRHPAPVYGPAAEA--IAGVTVRLREGDTVLLPGLRMQLGVLDVPGHTAGHIAYH- 118

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
               +L  GDTLFS GCGR+FE + A+M  SL+K+ +  D T +Y  HEYT +N  FA +
Sbjct: 119 -GKGYLFCGDTLFSAGCGRLFEGTAAQMAASLDKLAALPDDTVVYCTHEYTLSNLAFAAA 177

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-- 241
            +P N+E   Y    +++R Q L T P++I  EK +NPFLR     +   +     +   
Sbjct: 178 AEPVNIERDNYRKACEALRQQGLPTLPTSIGREKAINPFLRTRQPGVVAGVAAHTGTTPD 237

Query: 242 --LAVFTELRIRKN 253
             LA F  LR  KN
Sbjct: 238 TPLACFAALREWKN 251


>gi|325983348|ref|YP_004295750.1| hydroxyacylglutathione hydrolase [Nitrosomonas sp. AL212]
 gi|325532867|gb|ADZ27588.1| hydroxyacylglutathione hydrolase [Nitrosomonas sp. AL212]
          Length = 257

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 140/262 (53%), Gaps = 18/262 (6%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYI-ISKMLREKGWFLTHIFNTHHHIDH 61
           LNI  +  + DN+  + HN  Y   AAI  P T + + + LR K      I  THHH DH
Sbjct: 2   LNIYPVHAFKDNYIWIAHNRNY---AAIIDPGTAVPVMEYLRLKKLQPRAILITHHHSDH 58

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHI 119
                 L ++F+  ++GP  ES  I  I + +   D       S  + ++ TPGHT GHI
Sbjct: 59  IGGVAELLQWFDIPVYGPGNES--IAAITNPVQQNDIVSLPEISLNLTVLDTPGHTRGHI 116

Query: 120 CYHFMND-HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+  +  H +  GDTLFS GCGRIFE S  +++ SL+KI    D T IY  HEYT  N 
Sbjct: 117 AYYGSDPWHMIFCGDTLFSCGCGRIFEGSATQLYHSLQKISQLPDATLIYCTHEYTLGNI 176

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--- 235
            FA + DP N +L ++    + +R +N+ T P+T+SLEK +NPFLR E+  +  +     
Sbjct: 177 AFAKAVDPQNRKLNEFAITAQELRHKNIPTIPTTLSLEKAINPFLRCEHQPIINSAQNYA 236

Query: 236 ---MENASNLAVFTELRIRKNQ 254
              M+N  N  VF  +R  KN+
Sbjct: 237 AQPMQNPEN--VFEVIREWKNK 256


>gi|302187970|ref|ZP_07264643.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           642]
          Length = 259

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   ++  + +   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQSTAARVLGPATET--IPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAFYHAD 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFACLRAWKDK 258


>gi|88857810|ref|ZP_01132452.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
 gi|88819427|gb|EAR29240.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
          Length = 261

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 135/249 (54%), Gaps = 12/249 (4%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           MT L +  I  + DN+   I N + +    +D  D   +   + E    L+ I  THHH 
Sbjct: 1   MTMLQVKPIKAFKDNYIWAIINTENQHCVVVDPGDAEPVIAFISEHQLTLSAILITHHHW 60

Query: 60  DHTRANLNLKKF-FNCTIFGPLEESSKIPGIDHGLSDGDT-----FDFGSHPIKIIATPG 113
           DHT     L     +  ++GP  ++S   GI   LS         FD   H   I+ATPG
Sbjct: 61  DHTNGVEKLCSLQASLPVYGP--KNSPFAGITEPLSANTVCQLTDFDLSFH---ILATPG 115

Query: 114 HTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           HT+ HICY+     +L  GDTLFS GCGR+FE +  +MF+S+ K+    DKT +Y  HEY
Sbjct: 116 HTLDHICYYEPQQDWLFCGDTLFSGGCGRLFEGTADQMFQSMVKLSQLPDKTAVYCTHEY 175

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T++N  FAL  +P NL+L ++  KV ++R  N  + PS+I LEKK+NPF+R     + ++
Sbjct: 176 TQSNLIFALVIEPQNLDLLQHHKKVDALRLANKASLPSSIGLEKKINPFMRSTEQHITEH 235

Query: 234 LNMENASNL 242
           + +E+   L
Sbjct: 236 VPIEHQQAL 244


>gi|238026774|ref|YP_002911005.1| hydroxyacylglutathione hydrolase [Burkholderia glumae BGR1]
 gi|237875968|gb|ACR28301.1| Hydroxyacylglutathione hydrolase [Burkholderia glumae BGR1]
          Length = 268

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 134/265 (50%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +    +  A+D  D   + + L  +GW L  I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGSDAV--AVDPGDAAPVRRYLDARGWRLAAILLTHHHADHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     ++GP  E+  I  +   L+ G     G   ++  ++  PGHT GHI
Sbjct: 65  SALVGEREQIMPVPVYGPAGEA--IAQVTQPLAGGARVRIGKPALEFEVLDVPGHTRGHI 122

Query: 120 CYHFMND------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE +  +M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQAAGAGHPAPHLFC-GDTLFSCGCGRLFEGTPEQMLNSLDALAALPGDTQVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  + ++ R++   T P+TI+ E+ VNPFLR ++ ++   
Sbjct: 182 TLSNIRFALACEPDNAALAAWRDRAEACRARGEPTLPTTIAHERAVNPFLRADSAAIAAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E     AS LA FT LR  KN+
Sbjct: 242 LEAELHEAPASRLAAFTLLREWKNR 266


>gi|146292876|ref|YP_001183300.1| hydroxyacylglutathione hydrolase [Shewanella putrefaciens CN-32]
 gi|226724028|sp|A4Y6B8|GLO2_SHEPC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145564566|gb|ABP75501.1| Hydroxyacylglutathione hydrolase [Shewanella putrefaciens CN-32]
          Length = 267

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 134/263 (50%), Gaps = 19/263 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLVSHQLALAGILLTHHHQDHTGGVG 65

Query: 67  NLKKFFNCT------IFGPLEES---SKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
            LK++   T      ++GP +E+     +P ++  +    T  F +  I+++  PGHT G
Sbjct: 66  ELKRYVEQTSSQTLQVYGPQKENIAHVNVP-LNPEMRTELTLPFLNAQIQVLNVPGHTAG 124

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y F+ D   C GDTLFS GCGR+FE +  +M  SL  +      T ++  HEYT +N
Sbjct: 125 HIAY-FIEDALFC-GDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHEYTLSN 182

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  ++   
Sbjct: 183 LKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIIDSIKQH 242

Query: 238 -------NASNLAVFTELRIRKN 253
                      L  FT LR  K+
Sbjct: 243 FDDPDPIKLDELTCFTRLRQWKD 265


>gi|255577183|ref|XP_002529474.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
 gi|223531032|gb|EEF32884.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
          Length = 291

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 122/209 (58%), Gaps = 1/209 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   I   L +K   LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLRDNYAYLLHDMDTGTVGVVDPSEAVPIIDALTKKNRNLTYILNTHHHHD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + GP  +  +IPGID  L+DGD + F  H + ++ TPGHT GHI 
Sbjct: 133 HTGGNEELKARYGAKVIGPGTDRDRIPGIDIVLNDGDKWMFAGHEVLVMETPGHTRGHIS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D T+IY GHEYT +N+ F
Sbjct: 193 FYFPGSGSIFTGDTLFSLSCGKLFEGTPEQMHSSLGKIMSLPDDTNIYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTN 209
           ALS +P+N  L+ Y + V  +RS++L T 
Sbjct: 253 ALSIEPNNEALRSYAAHVTHLRSKSLPTG 281


>gi|183601081|ref|ZP_02962574.1| hypothetical protein PROSTU_04706 [Providencia stuartii ATCC 25827]
 gi|188019422|gb|EDU57462.1| hypothetical protein PROSTU_04706 [Providencia stuartii ATCC 25827]
          Length = 251

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 139/251 (55%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +   +DN+  ++ ++  +    +D  ++  + ++L +K    T I  THHH DHT   
Sbjct: 4   IRVPALNDNYIWILSDNNQQCII-VDPAESEPVLEILTQKKLTPTAILLTHHHNDHTGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              LK F N  +FGP E  +++ G    +  GD+         +I  PGHT+GHI   F 
Sbjct: 63  KGILKNFSNLPVFGPQE--TQVKGATQIVEQGDSVKINDFNFDVIGLPGHTLGHIA--FY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGRIFE +  +M++S++KI +  D T I   HEYT++N  FA   
Sbjct: 119 QAPYLFCGDTLFSAGCGRIFEGTPEQMYQSIQKIAALPDDTLICCAHEYTQSNLKFAHHI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK--NLNMENASNL 242
            P N ++ +Y  +V + R++N  T P+T+  E+KVN FL+ +N  L++  N+N  N    
Sbjct: 179 WPENTQISQYQEEVAAKRNKNQPTVPTTLKTERKVNIFLQCDNAQLQRKLNINQANPPLR 238

Query: 243 AVFTELRIRKN 253
           AVFT LR  K+
Sbjct: 239 AVFTVLRQLKD 249


>gi|262404572|ref|ZP_06081127.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
 gi|262349604|gb|EEY98742.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
          Length = 252

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 132/251 (52%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  L+ N   R  A +D      +   L++    L  I  THHH DH     
Sbjct: 6   SIPAFNDNYIWLLQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHDHIGGVA 64

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +F    + GP +E   IP + H + DGD  +       ++   GHT+GHI Y  + 
Sbjct: 65  ELVHQFPEIHVVGPAQEP--IPTLTHPVEDGDQIELFDERFLVLGLSGHTLGHIGY--VG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GD LFS GCGR+FE +  +MF SL K+ +   +T +Y  HEYT  N  FAL+ +
Sbjct: 121 DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLTLPQETLVYSAHEYTAANVAFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N +L  Y  +V  +R+QN  T P+T+  EK +NPFLR +  S+ +++   +     L 
Sbjct: 181 PENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWINPFLRTQEPSVIRSVANQVSTQDPLT 240

Query: 244 VFTELRIRKNQ 254
           +FT LR  KN+
Sbjct: 241 IFTALREWKNE 251


>gi|330985653|gb|EGH83756.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 259

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 134/255 (52%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLTDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E+  IP  D  L D D          + A PGHT+GHI ++  +
Sbjct: 66  AELKQATRARVLGPAAET--IPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAFYHED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  FA +
Sbjct: 124 ATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLRFAQA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N ++ +  ++V   RS+N  +  S ++LEK+ NPFLR   TS+++  +     +N 
Sbjct: 184 VEPDNQDIAQRLAEVTRWRSENRISLTSNLALEKRTNPFLRTRETSVKEKADERSGGQNT 243

Query: 240 SNLAVFTELRIRKNQ 254
           S  AVF  LR  K++
Sbjct: 244 SQSAVFASLRAWKDK 258


>gi|254252711|ref|ZP_04946029.1| Hydroxyacylglutathione hydrolase [Burkholderia dolosa AUO158]
 gi|124895320|gb|EAY69200.1| Hydroxyacylglutathione hydrolase [Burkholderia dolosa AUO158]
          Length = 268

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 139/264 (52%), Gaps = 19/264 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLDERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L          T++GP  E+  +  + H L+ GD     +  +   ++  PGHT GHI
Sbjct: 65  AALLDGRSDDAPVTVYGPAAEAIGV--VTHALAGGDRVSVAAPAVAFDVLDVPGHTRGHI 122

Query: 120 CYHFMNDHFLCV-----GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y     H   V     GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEYT
Sbjct: 123 AYFQHAGHGAAVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEYT 182

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPF+R ++ ++R  L
Sbjct: 183 LSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFMRSDSDAIRATL 242

Query: 235 NME----NASNLAVFTELRIRKNQ 254
             E        L  FT +R  KN+
Sbjct: 243 EAELHETVPDRLTAFTLMREWKNR 266


>gi|121607585|ref|YP_995392.1| hydroxyacylglutathione hydrolase [Verminephrobacter eiseniae
           EF01-2]
 gi|121552225|gb|ABM56374.1| Hydroxyacylglutathione hydrolase [Verminephrobacter eiseniae
           EF01-2]
          Length = 258

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 128/256 (50%), Gaps = 12/256 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  ++H+    +   +D      ++  LR  G  L  I  THHH DH    
Sbjct: 4   LALPAFADNYLWMLHDGHRAIV--VDPGQAAPVADALRRLGLQLQAILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI---CYH 122
             L+     ++ GP  ES   P +   L+ GDT D     +++I  PGHT GHI   C  
Sbjct: 62  EALRNATGASVHGPARESVPEPLVR--LAQGDTVDVLGLRLEVIDVPGHTAGHIAYYCPQ 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +    T +   HEYT +N  FA 
Sbjct: 120 MDGAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDRLAALPGNTLVCCAHEYTLSNLKFAT 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P N  L+ Y     ++R+QN  T PS + LE+++NPFLR+   ++ +     +A   
Sbjct: 180 AVEPDNAALRDYSRHCAALRAQNRPTLPSRMELEREINPFLRVRQAAVIRAAQGHDAQVQ 239

Query: 243 A-----VFTELRIRKN 253
           A     V   LR  KN
Sbjct: 240 ADDAVTVLAALRQWKN 255


>gi|206580021|ref|YP_002240305.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae 342]
 gi|226724001|sp|B5Y1G4|GLO2_KLEP3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|206569079|gb|ACI10855.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae 342]
          Length = 251

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 87/251 (34%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++  +  R    +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVLSENNGRCII-VDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ KF +  ++GP E   K  G+   L DGD      H   I +TPGHT+GHICY+  
Sbjct: 63  KQLREKFPSIVVYGPAETQDK--GVTQVLGDGDRLSILGHDFSIFSTPGHTLGHICYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++ +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS 
Sbjct: 119 SEPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNL 242
            P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++
Sbjct: 179 LPDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINQETNLQHSV 238

Query: 243 AVFTELRIRKN 253
           A F  LR +K+
Sbjct: 239 ARFAWLRSKKD 249


>gi|251788638|ref|YP_003003359.1| hydroxyacylglutathione hydrolase [Dickeya zeae Ech1591]
 gi|247537259|gb|ACT05880.1| hydroxyacylglutathione hydrolase [Dickeya zeae Ech1591]
          Length = 251

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 133/251 (52%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  ++DN+  L+ N K +    +D  D + + + L + G F   I  THHH DHT   
Sbjct: 4   ISVPAFNDNYIWLLANDK-KQCVIVDPGDAHPVLQALDKHGLFPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L   +    I+GPLE  +K  G  H +  GDT         I   PGHT GHI Y+  
Sbjct: 63  RQLADHYPGIQIYGPLE--TKRCGATHTVQAGDTITAAGSEFSIFFVPGHTAGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGRIFE +  +MFESL K+    DKT I   HEYT +N  FA   
Sbjct: 119 SSPYLFCGDTLFSAGCGRIFEGTAQQMFESLSKLADLPDKTQICCAHEYTLSNLEFAHHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NL 242
            P + ++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L++   +  + 
Sbjct: 179 WPEDADIHDYLLKIRQLREKGESSLPSTLGRERRINIFLRCHDFDLKRKLSINTGTQGDW 238

Query: 243 AVFTELRIRKN 253
            +F  LR  K+
Sbjct: 239 QIFVHLRAMKD 249


>gi|293603365|ref|ZP_06685793.1| hydroxyacylglutathione hydrolase [Achromobacter piechaudii ATCC
           43553]
 gi|292818275|gb|EFF77328.1| hydroxyacylglutathione hydrolase [Achromobacter piechaudii ATCC
           43553]
          Length = 273

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 134/261 (51%), Gaps = 15/261 (5%)

Query: 6   IAISLYHDNF-CILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRA 64
           + +  + DN+   ++H       A +D  +   + + L ++G  L  I  THHH DH   
Sbjct: 18  LPLPAFTDNYIWAIVHGEN---AAVVDPGEAGPVLRWLEQEGLRLRAILLTHHHGDHVGG 74

Query: 65  NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHICYH 122
            L L +  + T++GP  ES  +P  D  L++GD  T       ++++  PGHT GHI Y 
Sbjct: 75  VLELSRIADLTVYGPARES--LPRCDVPLTEGDRVTLPELDLDLRVLDVPGHTAGHIAYT 132

Query: 123 FMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                 +  L  GDTLF+ GCGR+FE + A+MF+SLEK       T ++  HEYT  N  
Sbjct: 133 GRAAGIEPVLFCGDTLFAGGCGRLFEGTPAQMFDSLEKFSVLPPDTQVFCAHEYTLANLR 192

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           +AL+ +P N  L ++  + + +R++ L T PSTI  E+  NPFLR +   + +       
Sbjct: 193 WALAVEPANRTLHQWYQRAQQLRAEGLPTLPSTIGQERATNPFLRTQQVDVIRAAASWAG 252

Query: 240 SN----LAVFTELRIRKNQSK 256
           +N    + VF  LR  KN  K
Sbjct: 253 NNQPAPVEVFASLREWKNDFK 273


>gi|261856166|ref|YP_003263449.1| hydroxyacylglutathione hydrolase [Halothiobacillus neapolitanus c2]
 gi|261836635|gb|ACX96402.1| hydroxyacylglutathione hydrolase [Halothiobacillus neapolitanus c2]
          Length = 266

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 138/254 (54%), Gaps = 12/254 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI +  DN+  LI   + +  A +D  +   +   +  +   L  I  THHH DH +   
Sbjct: 5   AIPVLSDNYVWLIEGDQGQ-CAVVDPGEAAPVLAEIERRDLTLKAILLTHHHADHCQGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIA--TPGHTIGHICYHFM 124
            L+  F   ++GP  E+     + H L++ +TFD   H  +  A  TPGHT+GHI    +
Sbjct: 64  GLRARFPVPVYGPALEAKTW--VTHPLANLETFDL-PHIGRFQAWHTPGHTLGHIS--LI 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++    VGDTLFS GCGR+FE S  +M  SL+++ S  D T IY GHEYT ++  FA   
Sbjct: 119 SNGAAFVGDTLFSAGCGRLFEGSPEQMLASLDRLSSLPDATMIYCGHEYTADSLRFAHFA 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENAS 240
           +P+N  + +   +V   R+  L + P+++SLEK++NPFLRI   SLR    K+   E+ S
Sbjct: 179 EPNNESIIQRIREVNEARAAGLPSVPTSMSLEKQINPFLRIREPSLRAAILKHARSESLS 238

Query: 241 NLAVFTELRIRKNQ 254
           +   F  LR  K++
Sbjct: 239 DADAFWTLRCWKDE 252


>gi|124267715|ref|YP_001021719.1| hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
 gi|124260490|gb|ABM95484.1| Hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
          Length = 259

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 133/258 (51%), Gaps = 13/258 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+  ++H+    +   +D  +   +++ L E+   L  I  THHH DH    
Sbjct: 4   IAVPAFTDNYIWMLHDGVSAIV--VDPGEAAPVTRALDERSLKLAAIVVTHHHGDHVGGV 61

Query: 66  LNLKKFF---NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             L+         ++GP  E    P +   L DGD  +      ++I  PGHT GHI Y 
Sbjct: 62  DALRARLPDGRGPVYGPAREDIPQPFLP--LRDGDAIELFGTRFEVIDVPGHTAGHIAYF 119

Query: 123 FM---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLFS GCGR+FE + A+M  SL ++ +    T +   HEYT  N  
Sbjct: 120 GQPAGEAPILFCGDTLFSGGCGRLFEGTPAQMHASLSRLAALPGDTRVCCAHEYTLGNLK 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA + +P N +L  Y ++ +S+R ++L T PST++ E++VNPFLR+ +T +R +     A
Sbjct: 180 FACAVEPGNADLIDYVAQCESLRQRDLPTLPSTVARERQVNPFLRVTSTQVRTSARAHGA 239

Query: 240 SN---LAVFTELRIRKNQ 254
           +    ++V   LR  KN+
Sbjct: 240 AGDDAVSVLAALRQWKNE 257


>gi|29653665|ref|NP_819357.1| hydroxyacylglutathione hydrolase [Coxiella burnetii RSA 493]
 gi|29540927|gb|AAO89871.1| hydroxyacylglutathione hydrolase [Coxiella burnetii RSA 493]
          Length = 257

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 135/255 (52%), Gaps = 10/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH DHT   
Sbjct: 6   LAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWDHTNGI 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD--FGSHPIKIIATPGHTIGHICYHF 123
             + +     ++G +E  S IP  DH + DG TF   +      ++A PGHT+ H+ Y+ 
Sbjct: 66  QGILQKHPAPVYGSVE--SAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVAYY- 122

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  FA +
Sbjct: 123 -ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLGPTTRVYCGHEYTVKNLEFAET 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENA 239
            +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +        A
Sbjct: 182 VEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGYPLA 241

Query: 240 SNLAVFTELRIRKNQ 254
             +AVF+ LR  K++
Sbjct: 242 DTVAVFSALRRWKDE 256


>gi|120599053|ref|YP_963627.1| hydroxyacylglutathione hydrolase [Shewanella sp. W3-18-1]
 gi|226724030|sp|A1RK78|GLO2_SHESW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|120559146|gb|ABM25073.1| Hydroxyacylglutathione hydrolase [Shewanella sp. W3-18-1]
          Length = 267

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 89/263 (33%), Positives = 133/263 (50%), Gaps = 19/263 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLVSHQLALAGILLTHHHQDHTGGVG 65

Query: 67  NLKKFFNCT------IFGPLEES---SKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
            LK++   T      ++GP +E+     +P ++  +    T  F +  I+++  PGHT G
Sbjct: 66  ELKRYVEQTSSQTLQVYGPQKENIAHVNVP-LNPEMRTELTLPFLNAQIQVLNVPGHTAG 124

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y  + D   C GDTLFS GCGR+FE +  +M  SL  +      T ++  HEYT +N
Sbjct: 125 HIAY-VIEDALFC-GDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHEYTLSN 182

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  ++   
Sbjct: 183 LKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIIDSIKQH 242

Query: 238 -------NASNLAVFTELRIRKN 253
                      L  FT LR  K+
Sbjct: 243 FDDPDPIKLDELTCFTRLRQWKD 265


>gi|288937010|ref|YP_003441069.1| hydroxyacylglutathione hydrolase [Klebsiella variicola At-22]
 gi|290509926|ref|ZP_06549296.1| hydroxyacylglutathione hydrolase [Klebsiella sp. 1_1_55]
 gi|288891719|gb|ADC60037.1| hydroxyacylglutathione hydrolase [Klebsiella variicola At-22]
 gi|289776642|gb|EFD84640.1| hydroxyacylglutathione hydrolase [Klebsiella sp. 1_1_55]
          Length = 251

 Score =  151 bits (381), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++  +  R    +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVLSENNGRCII-VDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ KF +  ++GP E   K  G+   + DGD      H   I +TPGHT+GHICY+  
Sbjct: 63  KQLREKFPSIVVYGPAETQDK--GVTQVVGDGDRLSILGHDFSIFSTPGHTLGHICYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++ +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS 
Sbjct: 119 SEPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNL 242
            P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++
Sbjct: 179 LPDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINQETNLQHSV 238

Query: 243 AVFTELRIRKN 253
           A F  LR +K+
Sbjct: 239 ARFAWLRSKKD 249


>gi|153208786|ref|ZP_01947018.1| metallo-beta-lactamase family protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165920929|ref|ZP_02219599.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 334]
 gi|212218149|ref|YP_002304936.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuK_Q154]
 gi|120575748|gb|EAX32372.1| metallo-beta-lactamase family protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165916777|gb|EDR35381.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 334]
 gi|212012411|gb|ACJ19791.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuK_Q154]
          Length = 257

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 134/255 (52%), Gaps = 10/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH DHT   
Sbjct: 6   LAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWDHTNGI 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD--FGSHPIKIIATPGHTIGHICYHF 123
             + +     ++G +E  S IP  DH + DG TF   +      ++A PGHT+ H+ Y+ 
Sbjct: 66  QGILQKHPAPVYGSVE--SAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVAYY- 122

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  FA +
Sbjct: 123 -ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLDPTTRVYCGHEYTGKNLEFAET 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENA 239
            +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +        A
Sbjct: 182 VEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGYPLA 241

Query: 240 SNLAVFTELRIRKNQ 254
             +AVF  LR  K++
Sbjct: 242 DTVAVFAALRRWKDE 256


>gi|117924955|ref|YP_865572.1| hydroxyacylglutathione hydrolase [Magnetococcus sp. MC-1]
 gi|117608711|gb|ABK44166.1| Hydroxyacylglutathione hydrolase [Magnetococcus sp. MC-1]
          Length = 254

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 124/246 (50%), Gaps = 3/246 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+ I     +    A +D      ++  L++ G  L+HI  THHH DH      
Sbjct: 10  LPAWEDNY-IWCFPTEPGAVAVVDPGQAEPVTDYLQQHGLRLSHILLTHHHGDHIDGVAP 68

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L++  +  + G   ++ ++P +D  L  G TF  G H +    TPGHT GH+CYH  +  
Sbjct: 69  LQRKHHARVLGSALDAHRLPPLDEALRGGQTFCLGPHQVDTYHTPGHTSGHLCYHIADCL 128

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
           F   GDTLFS GCGR+FE +  +M++SL  +++  + T +   HEYT  N  FA S    
Sbjct: 129 F--AGDTLFSYGCGRLFEGTPQQMWQSLLILRALPETTRLCCAHEYTLTNLRFARSLPGQ 186

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
              L     + +  R     T PS ++ EK+ NPFLR ++T  R  +  + AS  A F  
Sbjct: 187 QEPLAAPWQRAQQTRQLGKPTLPSRLAEEKQYNPFLRCDDTQFRTAVGQQAASAEACFAY 246

Query: 248 LRIRKN 253
           +R  +N
Sbjct: 247 IRQLRN 252


>gi|319426194|gb|ADV54268.1| hydroxyacylglutathione hydrolase [Shewanella putrefaciens 200]
          Length = 267

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/263 (33%), Positives = 133/263 (50%), Gaps = 19/263 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLISHQLALAGILLTHHHQDHTGGVG 65

Query: 67  NLKKFFNCT------IFGPLEES---SKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
            LK++   T      ++GP +E+     +P ++  +    T  F +  I+++  PGHT G
Sbjct: 66  ELKRYVEQTSSQTLQVYGPQKENIAHVNVP-LNPEMRTELTLPFLNAQIQVLNVPGHTAG 124

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y  + D   C GDTLFS GCGR+FE +  +M  SL  +      T ++  HEYT +N
Sbjct: 125 HIAY-VIEDALFC-GDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHEYTLSN 182

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  ++   
Sbjct: 183 LKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIIDSIKQH 242

Query: 238 -------NASNLAVFTELRIRKN 253
                      L  FT LR  K+
Sbjct: 243 FDDPDPIKLDELTCFTRLRQWKD 265


>gi|170697942|ref|ZP_02889025.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria IOP40-10]
 gi|170137108|gb|EDT05353.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria IOP40-10]
          Length = 268

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 139/265 (52%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP  E+  +  +   L+ GD  T D  +    ++  PGHT GHI
Sbjct: 65  AALRDSQPDDAPLVVYGPAAEAIGV--VTRPLAGGDRVTLDAPALAFDVLDVPGHTRGHI 122

Query: 120 CY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQRAGQGAATPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R +++++   
Sbjct: 182 TLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSSAIHAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E        LA FT +R  KN+
Sbjct: 242 LEAELHETVPDRLAAFTLMREWKNR 266


>gi|82702748|ref|YP_412314.1| hydroxyacylglutathione hydrolase [Nitrosospira multiformis ATCC
           25196]
 gi|82410813|gb|ABB74922.1| Hydroxyacylglutathione hydrolase [Nitrosospira multiformis ATCC
           25196]
          Length = 264

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 135/266 (50%), Gaps = 29/266 (10%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  LI +H +   A ID  D   +   L  +   L  I NTHHH DH   N
Sbjct: 8   VPIHAFKDNYIWLIRDHYH--AAVIDPGDASPVLDYLSREKLKLIAILNTHHHPDHVGGN 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG---------SHPIKIIATPGHTI 116
             L + F   +FGP +ES  IP + H L +    +           S   +++  PGHT 
Sbjct: 66  AELLREFAVPVFGPAKES--IPTLTHRLKECSDIENEEGCVYLPEFSLSFRVLDIPGHTS 123

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y+  N   L  GDTLF  GCGR+FE +  +M +SL+K+      T IY GHEYT +
Sbjct: 124 GHIAYYGAN--MLFCGDTLFGCGCGRLFEGTAQQMVDSLKKLADLPKDTLIYCGHEYTLS 181

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P N  L K   + + +R++ L T PSTI+LEK  NPFLR     +     +
Sbjct: 182 NIRFARTVEPGNQALAKREVEAEKLRNEGLPTLPSTIALEKATNPFLRCTEAEV-----I 236

Query: 237 ENASN---------LAVFTELRIRKN 253
           E+ASN         ++VF  +R  KN
Sbjct: 237 ESASNHAGKPLNDRVSVFAAIREWKN 262


>gi|94984097|gb|ABF50677.1| glyoxalase II [Arachis hypogaea]
          Length = 169

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 100/158 (63%)

Query: 28  AAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIP 87
             +D  +   I   L ++   LT+I NTHHH DHT  NL LK  +   + G  ++  +IP
Sbjct: 11  GVVDPSEATPIINALEKRNQNLTYILNTHHHYDHTGGNLELKAKYGAKVIGSAKDRDRIP 70

Query: 88  GIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDS 147
           GID  LS+GDT+ F  H + ++ TPGHT GH+CYHF     +  GDTLFSL CG++FE +
Sbjct: 71  GIDITLSEGDTWMFAGHQVLVMETPGHTSGHVCYHFPGSGAIFTGDTLFSLSCGKLFEGT 130

Query: 148 YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +M+ SL+KI +  D+T +Y GHEYT +N+ FA++ +
Sbjct: 131 PQQMYSSLQKIIALPDETRVYCGHEYTLSNSKFAITSE 168


>gi|33594120|ref|NP_881764.1| hydroxyacylglutathione hydrolase [Bordetella pertussis Tohama I]
 gi|33603255|ref|NP_890815.1| hydroxyacylglutathione hydrolase [Bordetella bronchiseptica RB50]
 gi|33564194|emb|CAE43479.1| probable hydroxyacylglutathione hydrolase [Bordetella pertussis
           Tohama I]
 gi|33577379|emb|CAE34644.1| probable hydroxyacylglutathione hydrolase [Bordetella
           bronchiseptica RB50]
 gi|332383536|gb|AEE68383.1| hydroxyacylglutathione hydrolase [Bordetella pertussis CS]
          Length = 266

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 137/264 (51%), Gaps = 15/264 (5%)

Query: 3   SLNIAISLYHDNF-CILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S  + +  + DN+   L H  +    A +D  D   + + LR  G  L  I  THHH DH
Sbjct: 8   SAVVPLPAFSDNYIWALAHEGQ---AAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDH 64

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
               L L +    T++GP  E+  +P  D  L++GD  T    +  ++++  PGHT GHI
Sbjct: 65  VGGVLELVQATGATVYGPAGET--LPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHI 122

Query: 120 CYHFMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y       +  L  GDTLF+ GCGR+FE + A+M +SLEK+ +    T +   HEYT  
Sbjct: 123 AYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLA 182

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  +AL+ +P N  LQ++  + + +R++   T PSTI  E++ NPFLR  + ++     +
Sbjct: 183 NLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAV 242

Query: 237 ENASNLA----VFTELRIRKNQSK 256
            +  +LA    VF  LR  KN  K
Sbjct: 243 WSGRSLATPVEVFAALRQWKNNFK 266


>gi|114332143|ref|YP_748365.1| hydroxyacylglutathione hydrolase [Nitrosomonas eutropha C91]
 gi|122313177|sp|Q0AE32|GLO2_NITEC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114309157|gb|ABI60400.1| Hydroxyacylglutathione hydrolase [Nitrosomonas eutropha C91]
          Length = 255

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 137/252 (54%), Gaps = 12/252 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++HN ++ L   ID  D   +   + ++      I  THHH DHT    +
Sbjct: 7   VRAFKDNYIWIVHNQQFALI--IDPGDATPVLAWISQQNLQPIAILCTHHHHDHTGGIPS 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHFMN 125
           L + F   ++GP  E  KIPG+ H L+ GDT  F   S    ++  PGHT GHI Y+  N
Sbjct: 65  LVQEFAIPVYGPANE--KIPGMTHPLTGGDTLSFPELSLEFSVLDIPGHTAGHIAYYGQN 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLF+ GCGRIFE S  +M  SL+K+ S  D+T +Y  HEYT  N  FA   D
Sbjct: 123 --YLFCGDTLFACGCGRIFEGSAQQMLASLQKLASLPDETLVYCAHEYTLANVRFARVLD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL--- 242
           P N +L K  S V+    QN+ T PS++++EK  NPFLR +  ++  + +     +L   
Sbjct: 181 PDNPDLIKLESTVEEKLKQNIPTLPSSLAVEKATNPFLRCDQPAIIHSASQHVGRHLNDP 240

Query: 243 -AVFTELRIRKN 253
            +VF  +R  KN
Sbjct: 241 VSVFAAIRDWKN 252


>gi|33598345|ref|NP_885988.1| hydroxyacylglutathione hydrolase [Bordetella parapertussis 12822]
 gi|33566903|emb|CAE39119.1| probable hydroxyacylglutathione hydrolase [Bordetella
           parapertussis]
          Length = 266

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 137/264 (51%), Gaps = 15/264 (5%)

Query: 3   SLNIAISLYHDNF-CILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S  + +  + DN+   L H  +    A +D  D   + + LR  G  L  I  THHH DH
Sbjct: 8   SAVVPLPAFSDNYIWALAHEGQ---AAVVDPGDAAPVLRWLRATGATLCAILLTHHHPDH 64

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
               L L +    T++GP  E+  +P  D  L++GD  T    +  ++++  PGHT GHI
Sbjct: 65  VGGVLELVQATGATVYGPAGET--LPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHI 122

Query: 120 CYHFMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y       +  L  GDTLF+ GCGR+FE + A+M +SLEK+ +    T +   HEYT  
Sbjct: 123 AYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLA 182

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  +AL+ +P N  LQ++  + + +R++   T PSTI  E++ NPFLR  + ++     +
Sbjct: 183 NLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAV 242

Query: 237 ENASNLA----VFTELRIRKNQSK 256
            +  +LA    VF  LR  KN  K
Sbjct: 243 WSGRSLATPVEVFAALRQWKNNFK 266


>gi|114047733|ref|YP_738283.1| hydroxyacylglutathione hydrolase [Shewanella sp. MR-7]
 gi|113889175|gb|ABI43226.1| Hydroxyacylglutathione hydrolase [Shewanella sp. MR-7]
          Length = 295

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 133/263 (50%), Gaps = 19/263 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+  ++     +    +D  D  ++   L +    L  I  THHH DHT    
Sbjct: 34  AINAFNDNYIWVLRQDSQQNVYVVDPGDANVVLDYLHKHQLTLAGILITHHHRDHTGGIA 93

Query: 67  NLKKFFNCT------IFGPLEESSK---IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
            L      T      ++GP  E+ +   +P ID   SD  T  F   P+ I++ PGHT G
Sbjct: 94  ALAAHVEQTTGHTLAVYGPQSEAIQGINLP-IDPKPSDTLTLPFIDAPVHILSVPGHTAG 152

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y  + D  L  GDTLFS GCGR+FE S A+M++SL  + +  D T +Y  HEYT  N
Sbjct: 153 HIAY--LVDGALFCGDTLFSAGCGRLFEGSPAQMWQSLSLLAALPDTTRVYCAHEYTLAN 210

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + D  N  L+ Y  +   +R+QN  T PSTI LE+ +NPFLR    ++  ++   
Sbjct: 211 LKFAQAVDTDNEALKAYVKRANDLRAQNKATIPSTIELERAINPFLRPLAPTIVNSIKNQ 270

Query: 235 ----NMENASNLAVFTELRIRKN 253
               ++     L  FT LR  K+
Sbjct: 271 FCDQDLTKTDELTCFTLLRQWKD 293


>gi|154707223|ref|YP_001425097.1| hydroxyacylglutathione hydrolase [Coxiella burnetii Dugway
           5J108-111]
 gi|161830842|ref|YP_001596265.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 331]
 gi|212213176|ref|YP_002304112.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuG_Q212]
 gi|154356509|gb|ABS77971.1| hydroxyacylglutathione hydrolase [Coxiella burnetii Dugway
           5J108-111]
 gi|161762709|gb|ABX78351.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 331]
 gi|212011586|gb|ACJ18967.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuG_Q212]
          Length = 257

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 134/255 (52%), Gaps = 10/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH DHT   
Sbjct: 6   LAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWDHTNGI 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD--FGSHPIKIIATPGHTIGHICYHF 123
             + +     ++G +E  S IP  DH + DG TF   +      ++A PGHT+ H+ Y+ 
Sbjct: 66  QGILQKHPAPVYGSVE--SAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVAYY- 122

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  FA +
Sbjct: 123 -ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLDPTTRVYCGHEYTVKNLEFAET 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENA 239
            +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +        A
Sbjct: 182 VEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGYPLA 241

Query: 240 SNLAVFTELRIRKNQ 254
             +AVF  LR  K++
Sbjct: 242 DTVAVFAALRRWKDE 256


>gi|152968802|ref|YP_001333911.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893205|ref|YP_002917939.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae NTUH-K2044]
 gi|262044053|ref|ZP_06017133.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330005758|ref|ZP_08305370.1| hydroxyacylglutathione hydrolase [Klebsiella sp. MS 92-3]
 gi|166990459|sp|A6T510|GLO2_KLEP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|150953651|gb|ABR75681.1| probable hydroxyacylglutathione hydrolase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238545521|dbj|BAH61872.1| probable hydroxyacylglutathione hydrolase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259038625|gb|EEW39816.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328536126|gb|EGF62514.1| hydroxyacylglutathione hydrolase [Klebsiella sp. MS 92-3]
          Length = 251

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++  +  R    +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVLSENNGRCII-VDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ KF +  ++GP E   K  G+   + DGD      H   I +TPGHT+GHICY+  
Sbjct: 63  KQLREKFPSIVVYGPAETQDK--GVTQVVGDGDRLSILGHDFSIFSTPGHTLGHICYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++ +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS 
Sbjct: 119 SEPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNL 242
            P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++
Sbjct: 179 LPDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINKETNLQHSV 238

Query: 243 AVFTELRIRKN 253
           A F  LR +K+
Sbjct: 239 ARFAWLRSKKD 249


>gi|56460798|ref|YP_156079.1| hydroxyacylglutathione hydrolase GloB [Idiomarina loihiensis L2TR]
 gi|81363283|sp|Q5QZL0|GLO2_IDILO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|56179808|gb|AAV82530.1| Probable hydroxyacylglutathione hydrolase GloB [Idiomarina
           loihiensis L2TR]
          Length = 253

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 117/224 (52%), Gaps = 4/224 (1%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   I  +       +D  +   + + L +    +  I  THHH DHT    
Sbjct: 5   AIEAFDDNYIWAIETNDKDKVIIVDPGEAQPVQQWLEQNSKSIETILVTHHHYDHTGGIA 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L +   C + GP  E+ +I  +   +++GD    G    +++ TPGHT+ HI   F   
Sbjct: 65  ELIEQSPCPVIGP--ENPEIKTLTKTVTEGDELTVGGIQWQVLTTPGHTLDHIS--FYTP 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            FL  GDTLFS GCGR+FE +  +  +SL K++    +T ++  HEYT+ N  FAL  +P
Sbjct: 121 GFLFCGDTLFSGGCGRMFEGTPEQFTQSLLKLRKLPGETRVFCAHEYTQANVNFALKVEP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
            N  LQ Y  KV+ +R Q   T PST+ LE  +NPFLR +  S+
Sbjct: 181 ENAVLQSYAEKVRMLREQEQITLPSTLQLELAINPFLRFDQKSV 224


>gi|229590110|ref|YP_002872229.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           SBW25]
 gi|259492013|sp|C3K9Q0|GLO2_PSEFS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|229361976|emb|CAY48876.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           SBW25]
          Length = 255

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/253 (34%), Positives = 133/253 (52%), Gaps = 9/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   +  A +D  D   +   L +  GW L+ I  THHH DH    
Sbjct: 6   ALPAFTDNYIWLLQDPHTQRCAVVDPGDAAPVLDWLEQNPGWALSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK   N  ++GP  E  KIP  D  L+D D          I   PGHT+GHI   F +
Sbjct: 66  EQLKGATNAKVYGPANE--KIPARDVALNDNDRITVLGWDFDIYTVPGHTLGHIT--FYH 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE +  +M+ SLE++ +    T +Y  HEYT++N  FA + +
Sbjct: 122 SGVLLCGDTLFAAGCGRLFEGTPEQMYTSLERLAALPADTRVYCTHEYTQSNLKFAQAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENASN 241
           P N ++ +    V+ +R++   T PS ++LE+  NPFLR   TS+++  +     +N S 
Sbjct: 182 PDNADIAERVESVRQLRARGEITLPSNLALERLTNPFLRTSETSVKQKADERNGRDNRSG 241

Query: 242 LAVFTELRIRKNQ 254
             VF  LR  K++
Sbjct: 242 AEVFASLRAWKDK 254


>gi|113970498|ref|YP_734291.1| hydroxyacylglutathione hydrolase [Shewanella sp. MR-4]
 gi|113885182|gb|ABI39234.1| Hydroxyacylglutathione hydrolase [Shewanella sp. MR-4]
          Length = 295

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 133/263 (50%), Gaps = 19/263 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+  ++     +    +D  D  ++   L +    L  I  THHH DHT    
Sbjct: 34  AINAFNDNYIWVLRQDSQQNVYVVDPGDANVVLDYLHKHQLTLAGILITHHHRDHTGGIA 93

Query: 67  NLKKFFNCT------IFGPLEESSK---IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
            L      T      ++GP  E+ +   +P ID   SD  T  F   P+ I++ PGHT G
Sbjct: 94  ALAAHVEQTTGHTLAVYGPQSEAIQGINLP-IDPKPSDTLTLPFIDAPVHILSVPGHTAG 152

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y  + D  L  GDTLFS GCGR+FE S A+M++SL  + +  D T +Y  HEYT  N
Sbjct: 153 HIAY--LVDGALFCGDTLFSAGCGRLFEGSPAQMWQSLSLLAALPDTTRVYCAHEYTLAN 210

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + D  N  L+ Y  +   +R+QN  T PSTI LE+ +NPFLR    ++  ++   
Sbjct: 211 LKFAQAVDTDNEALKAYVKRTNDLRAQNKATIPSTIELERAINPFLRPLAPTIVNSIKNQ 270

Query: 235 ----NMENASNLAVFTELRIRKN 253
               ++     L  FT LR  K+
Sbjct: 271 FCDQDLTKTDELTCFTLLRQWKD 293


>gi|261346347|ref|ZP_05973991.1| hydroxyacylglutathione hydrolase [Providencia rustigianii DSM 4541]
 gi|282565661|gb|EFB71196.1| hydroxyacylglutathione hydrolase [Providencia rustigianii DSM 4541]
          Length = 250

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 136/252 (53%), Gaps = 9/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I IS   DN+  L+ +++  +   +D  ++  +   L+        I  THHH DHT+  
Sbjct: 4   IRISALSDNYIWLLADNQQCII--VDPAESEPVIATLKTNQLNPAAILLTHHHNDHTQGV 61

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            ++   + N  +FGP E  +K  G    + DGD+   G+   K++  PGHT+GH+   F 
Sbjct: 62  KDIIAAYPNIPVFGPQETLAK--GATLLIEDGDSVVIGNFNFKVLGLPGHTLGHV--GFY 117

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGRIFE +  +MF+S++KI +  D T +   HEYT +N  FA   
Sbjct: 118 QAPYLFCGDTLFSAGCGRIFEGTPEQMFQSIQKIAALPDDTLVCCAHEYTLSNLKFAQHI 177

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNL 242
            P N  ++ Y  KV ++R     T PST+  E+ +N FL+  N  L++ LN  M N S  
Sbjct: 178 WPENEAIKNYSEKVTALRENQQATVPSTLKTERNINIFLQCNNVELQQKLNIKMVNPSLR 237

Query: 243 AVFTELRIRKNQ 254
           A+FT LR  K+Q
Sbjct: 238 AIFTLLRQLKDQ 249


>gi|90407278|ref|ZP_01215464.1| putative hydroxyacylglutathione hydrolase GloB [Psychromonas sp.
           CNPT3]
 gi|90311561|gb|EAS39660.1| putative hydroxyacylglutathione hydrolase GloB [Psychromonas sp.
           CNPT3]
          Length = 258

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/254 (35%), Positives = 132/254 (51%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  ++DN+  LI + + +    +D  D   + ++L ++   +  I  TH H DH    
Sbjct: 5   ITIKAFNDNYIWLIKDSQSQRCILVDPGDAQPVLEILEQQNLSVDAILVTHAHQDHIGGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH--PIKIIATPGHTIGHICYHF 123
             L   FN  I  P+    K+      + +G T  F      +K++  PGHT+ H+ Y+ 
Sbjct: 65  SELLAHFNKEI--PIYSKDKLFSSSEPVEEGKTLCFFEQRLSLKVMFVPGHTLDHVAYY- 121

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            ND  L  GDTLFS GCGR+ E ++ +MF SL +I    D T +Y  HEYT+ N  FAL 
Sbjct: 122 -NDSSLFCGDTLFSAGCGRVMEGTHQQMFTSLARISQLKDTTKVYCAHEYTQQNLIFALH 180

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +P N  L+ +  KV  +R Q L + P+T++LEK +NPFLR  +T L+  L      E  
Sbjct: 181 LEPKNRALRAHMQKVAKLRQQGLASVPTTLALEKTLNPFLRCSDTGLKNALQNKLCDEIH 240

Query: 240 SNLAVFTELRIRKN 253
             L  FT+LR  K+
Sbjct: 241 DALHCFTKLRQYKD 254


>gi|152989464|ref|YP_001348842.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PA7]
 gi|226724005|sp|A6V707|GLO2_PSEA7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|150964622|gb|ABR86647.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PA7]
          Length = 258

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDARPVEAWLAAHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELSGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHAA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 QTPLLFCGDTLFAAGCGRLFEGTPAQMHRSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPENQALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|89900255|ref|YP_522726.1| hydroxyacylglutathione hydrolase [Rhodoferax ferrireducens T118]
 gi|89344992|gb|ABD69195.1| Hydroxyacylglutathione hydrolase [Rhodoferax ferrireducens T118]
          Length = 240

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 126/244 (51%), Gaps = 12/244 (4%)

Query: 18  LIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIF 77
           ++H+ ++ L   +D  D   + + L++ G  L  I  THHH DHT     L+      +F
Sbjct: 1   MVHDERHALV--VDPGDAQPVLEALQQLGLQLETILVTHHHPDHTGGVAALRAATGAQVF 58

Query: 78  GPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND----HFLCVGD 133
           GP  E    P I   L+            ++I  PGHT  HI Y F  D      L  GD
Sbjct: 59  GPAREPMPEPLIR--LTGDQQLQALGLNFQVIDVPGHTACHIAY-FCADVDGAPLLFCGD 115

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLFS GCGR+FE S A+M  SL+ + +  D T +   HEYT +N  FA + +P N  L  
Sbjct: 116 TLFSAGCGRLFEGSPAQMLASLDTLAALPDATRVCCAHEYTLSNLKFACAVEPVNQALTD 175

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS---NLAVFTELRI 250
           Y  K +++RSQ   T PS+I LE+++NPFLR    ++ + +   +AS    +++F  LR 
Sbjct: 176 YTVKAEALRSQQQPTLPSSILLERQINPFLRTRQATVTQAVQAFDASARDEVSIFAALRQ 235

Query: 251 RKNQ 254
            KNQ
Sbjct: 236 WKNQ 239


>gi|294950453|ref|XP_002786637.1| hydroxyacylglutathione hydrolase, putative [Perkinsus marinus ATCC
           50983]
 gi|239900929|gb|EER18433.1| hydroxyacylglutathione hydrolase, putative [Perkinsus marinus ATCC
           50983]
          Length = 280

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 135/252 (53%), Gaps = 7/252 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTY-IISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +    DN+  ++   K      +D P+   ++S++ +       +I NTHHH DHT  N 
Sbjct: 28  VPCLKDNYGWILRCPKTGTIGLVDTPEAGPLLSELRKNFNGRADYILNTHHHWDHTGGNN 87

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            +K   +C + GP  +S +I G+D  +  GD F FG   +++   PGHT GH+ YHF   
Sbjct: 88  EIKAATHCKVIGPGHDS-QIDGLDKAVGGGDEFKFGDLTVRVFDLPGHTHGHVGYHFPEA 146

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
           +    GDTLF LGCGR+FE +  + + +L++I+     T ++  HEY+++NA FA   D 
Sbjct: 147 NAFFCGDTLFVLGCGRMFEGTKNQFWSTLQRIRGLPKDTVMFCAHEYSQSNAKFARYIDS 206

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMENASNL 242
            N  L++    + +MRS+   T PS ++ E   NPFLR++  +++K        E   +L
Sbjct: 207 SNEYLKQASDVITNMRSRGEATVPSMLADELLCNPFLRVDQEAIQKRALELTGSEPTHDL 266

Query: 243 A-VFTELRIRKN 253
           A VF  +R  K+
Sbjct: 267 AEVFARVRSLKD 278


>gi|104782589|ref|YP_609087.1| hydroxyacylglutathione hydrolase GloB [Pseudomonas entomophila L48]
 gi|122402666|sp|Q1I7T2|GLO2_PSEE4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|95111576|emb|CAK16296.1| hydroxyacylglutathione hydrolase GloB [Pseudomonas entomophila L48]
          Length = 259

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/254 (33%), Positives = 133/254 (52%), Gaps = 9/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAID-APDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D   D  +++ + +  GW L  I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTANRRCAVVDPGDDAPVLAWLGKHPGWVLEAILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK      +FGP  E  +IP  D  L DG           ++A PGHT+GHI Y+   
Sbjct: 66  EALKHATGAQVFGPANE--RIPARDIALEDGAQVHVLGLAFDVLAMPGHTLGHIAYYTAQ 123

Query: 126 DH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE +  +M  SL+++ +  ++T +Y  HEYT +N  FA +
Sbjct: 124 SPTPLLFSGDTLFAAGCGRLFEGTPEQMHHSLQRLAALPEQTQVYCAHEYTLSNLRFARA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENA 239
            +PH+  +Q+    V  +R+ N  + PSTI +E++ NPFLR    S+++  +      N 
Sbjct: 184 VEPHSEPVQQRFEAVTQLRADNRISLPSTIGIERQTNPFLRTAEISVKQKADEWKGHSNP 243

Query: 240 SNLAVFTELRIRKN 253
           +  +VF  LR  K+
Sbjct: 244 TQASVFAALRSWKD 257


>gi|254240206|ref|ZP_04933528.1| hypothetical protein PA2G_00848 [Pseudomonas aeruginosa 2192]
 gi|126193584|gb|EAZ57647.1| hypothetical protein PA2G_00848 [Pseudomonas aeruginosa 2192]
          Length = 258

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 131/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+S ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALSAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|323526832|ref|YP_004228985.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1001]
 gi|323383834|gb|ADX55925.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1001]
          Length = 263

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 141/260 (54%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +  + +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWVVSDGHHAVV--VDPGEAAPVRACLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L K     ++GP  E+  I  +   L +GD        ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLKGQAVPVYGPAGEA--IEHVTQRLKNGDRVTIAKPALEFSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE + A+M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 TADPGGTPHVFC-GDTLFACGCGRLFEGTPAQMLASLDALAALPGATQVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N+ELQ +  K   +R++N  T P+TI+ E+ VNPFLR ++     +L++ L
Sbjct: 182 RFALACEPGNVELQAWRDKASELRARNQPTLPTTIAHERAVNPFLRSDSPAVHATLQEQL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           + + +  L  FT +R  KN+
Sbjct: 242 HEKISDRLTAFTLMREWKNR 261


>gi|187929604|ref|YP_001900091.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|309781616|ref|ZP_07676350.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
 gi|187726494|gb|ACD27659.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|308919591|gb|EFP65254.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
          Length = 257

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 130/252 (51%), Gaps = 10/252 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++H+ ++     +D  ++  +   L++ G  L  I  THHH DH      
Sbjct: 7   LPAFADNYIWVLHDERHAWV--VDPGESAQVLDYLQKHGLVLQGILLTHHHSDHVGGVQA 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L++     ++GP  E   IP     L  GD  D      ++I  PGHT GHI Y      
Sbjct: 65  LRQQTGAAVYGPAGE--PIPEPARRLRQGDRVDVLEQQFEVIDVPGHTAGHIAYFSAACP 122

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +   L  GDTLFS GCGR+FE +  +M  SL+ + +   +T +   HEYT  N  FA + 
Sbjct: 123 DGPLLFCGDTLFSGGCGRLFEGTPEQMLASLDTLAALPAQTQVCPAHEYTLANLRFAQTV 182

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA- 243
           +P N  L ++    + +R+Q L T PS + LE+++NPFLR    S+R++L+   +++L  
Sbjct: 183 EPSNEALARHVPYCEMLRAQGLPTLPSRLGLERQINPFLRSREPSVRQSLSRLPSASLGD 242

Query: 244 --VFTELRIRKN 253
             VF  LR  KN
Sbjct: 243 VHVFAALREWKN 254


>gi|260836375|ref|XP_002613181.1| hypothetical protein BRAFLDRAFT_210530 [Branchiostoma floridae]
 gi|229298566|gb|EEN69190.1| hypothetical protein BRAFLDRAFT_210530 [Branchiostoma floridae]
          Length = 308

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/263 (31%), Positives = 129/263 (49%), Gaps = 16/263 (6%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +++  DN+  ++ N K R+   +D  D   +   ++++G  L  +  TH H DH+  N  
Sbjct: 45  VAIVSDNYSYVVMNTKRRIAVVVDPSDPVAVQAYVKQEGIQLAAVLTTHKHWDHSGGNHA 104

Query: 68  LKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           LK+ F    I+G    +  +PG+ + + DGD    G     +++TPGHT+GH+ Y     
Sbjct: 105 LKRMFPGLPIYG--SATDGVPGLTNPVLDGDMIQVGGLEFHVMSTPGHTVGHVVYQLDGA 162

Query: 127 HF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
            F     L  GD LF  GCGR FE   A M +SLEK+ S  D T I+ GHEYT  N  + 
Sbjct: 163 PFQAPDSLFTGDLLFIGGCGRTFEGDAATMLKSLEKVSSQPDNTIIWPGHEYTLENLLYG 222

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS- 240
            + D  N  +++     K  R   + T PST+  EK+ N FLR  + ++ + + M     
Sbjct: 223 ETIDGDNENIREKLRWTKDRRKARMATCPSTVGDEKQHNVFLRTRDPAVAEAVGMATRRL 282

Query: 241 -------NLAVFTELRIRKNQSK 256
                    +V   LR RK++ K
Sbjct: 283 TGVTEEFQASVLAALRERKDKFK 305


>gi|241663704|ref|YP_002982064.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
 gi|240865731|gb|ACS63392.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
          Length = 257

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 130/252 (51%), Gaps = 10/252 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++H+ ++     +D  ++  +   L++ G  L  I  THHH DH      
Sbjct: 7   LPAFADNYIWVLHDERHAWV--VDPGESAQVLDYLQKHGLVLQGILLTHHHSDHVGGVQA 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L++     ++GP  E   IP     L  GD  D      ++I  PGHT GHI Y      
Sbjct: 65  LRQQTGAAVYGPAGE--PIPEPARRLRQGDRVDVLEQQFEVIDVPGHTAGHIAYFSAACP 122

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +   L  GDTLFS GCGR+FE +  +M  SL+ + +   +T +   HEYT  N  FA + 
Sbjct: 123 DGPLLFCGDTLFSGGCGRLFEGTPEQMLASLDTLAALPAQTQVCPAHEYTLANLRFAQTV 182

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA- 243
           +P N  L ++    + +R+Q L T PS + LE+++NPFLR    S+R++L+   +++L  
Sbjct: 183 EPSNEALARHVRYCEMLRAQGLPTLPSRLGLERQINPFLRSREPSVRQSLSPLPSASLGD 242

Query: 244 --VFTELRIRKN 253
             VF  LR  KN
Sbjct: 243 VHVFAALREWKN 254


>gi|134295350|ref|YP_001119085.1| hydroxyacylglutathione hydrolase [Burkholderia vietnamiensis G4]
 gi|134138507|gb|ABO54250.1| Hydroxyacylglutathione hydrolase [Burkholderia vietnamiensis G4]
          Length = 268

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 137/264 (51%), Gaps = 19/264 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP  E+  +  +   L+ G   T D  +    ++  PGHT GHI
Sbjct: 65  AALRDSQPDDAPLVVYGPAAEAIGV--VTRPLAGGARVTLDAPALAFDVLDVPGHTRGHI 122

Query: 120 CYHFMNDHFLCV-----GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y     H   +     GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEYT
Sbjct: 123 AYFQAAGHGAAIPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEYT 182

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPFLR ++ ++   L
Sbjct: 183 LSNIRFALACEPGNAALAAWRDDAQALRARGMPTLPTTIAHERAVNPFLRADSAAIHATL 242

Query: 235 NME----NASNLAVFTELRIRKNQ 254
             E        LA FT +R  KN+
Sbjct: 243 EAELHETVPDRLAAFTLMREWKNR 266


>gi|194875152|ref|XP_001973539.1| GG16137 [Drosophila erecta]
 gi|190655322|gb|EDV52565.1| GG16137 [Drosophila erecta]
          Length = 348

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K L+E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTLQEQQLTLSKVLTTHHHWDHAGGNEKLVKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH-- 127
           +     ++G      +I  ++  +   DTF  G+  +K ++TP HT GHICYH       
Sbjct: 159 WEKELDVYG---GDDRIGALNKKVQQDDTFTIGALNVKCLSTPCHTTGHICYHVTAQEGS 215

Query: 128 ---FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
               +  GDTLF  GCGR FE +  EM+E+L  K+ S  D T ++ GHEYT  N  FA  
Sbjct: 216 GKGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSSLPDTTKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++K+      +   
Sbjct: 276 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEASVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           + T  ++RK +
Sbjct: 333 IVTMGKLRKEK 343


>gi|107022362|ref|YP_620689.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia AU 1054]
 gi|116689309|ref|YP_834932.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia HI2424]
 gi|105892551|gb|ABF75716.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia AU 1054]
 gi|116647398|gb|ABK08039.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia HI2424]
          Length = 273

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 88/270 (32%), Positives = 139/270 (51%), Gaps = 26/270 (9%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLK----KFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+         T++GP  E+  +  +   LS GD  T D  +    ++  PGHT GHI
Sbjct: 65  EALQHSQPADVPLTVYGPAAEAIGV--VTRPLSGGDRVTLDAPAVAFDVLDVPGHTRGHI 122

Query: 120 CYHFMN-----------DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
            Y                H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++
Sbjct: 123 AYFQAAGQGAAGQGNAVPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVH 181

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ 
Sbjct: 182 CAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSA 241

Query: 229 SLRKNLNME----NASNLAVFTELRIRKNQ 254
           ++   L  E        LA FT +R  KN+
Sbjct: 242 AIHATLEAELHETVTDRLAAFTLMREWKNR 271


>gi|332286827|ref|YP_004418738.1| hydroxyacylglutathione hydrolase [Pusillimonas sp. T7-7]
 gi|330430780|gb|AEC22114.1| hydroxyacylglutathione hydrolase [Pusillimonas sp. T7-7]
          Length = 234

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 123/236 (52%), Gaps = 11/236 (4%)

Query: 30  IDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGI 89
           +D      +  +L ++G  L  I  THHH DH    L L++     ++GP  E  K+P  
Sbjct: 1   MDPGQAAPVQAVLDQRGLILDAILLTHHHADHVGGVLALQQRTGAPVYGPASE--KLPAC 58

Query: 90  DHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHFM---NDHFLCVGDTLFSLGCGRIF 144
           DH L +GDT  F +  ++  ++  PGHT GHI Y+         +  GDTLF+ GCGR+F
Sbjct: 59  DHRLMEGDTVQFPTVGLQLSVLDVPGHTAGHIAYYGTLSTGKPVVFCGDTLFAAGCGRLF 118

Query: 145 EDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQ 204
           E + A+M +SL K+++    T +   HEYT  N  +AL  +P NL LQ+       +RS 
Sbjct: 119 EGTPAQMLDSLGKLRALPADTLVCCAHEYTLANLRWALQVEPDNLVLQQRWEADSRLRSD 178

Query: 205 NLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA----VFTELRIRKNQSK 256
           ++ T PS I+LE   NPFLR+  TS+ K       + L     VF  LR  KN  K
Sbjct: 179 SMPTLPSNIALELDTNPFLRVSQTSVAKAAASYAGAVLEAPVDVFACLREWKNNFK 234


>gi|332141407|ref|YP_004427145.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551429|gb|AEA98147.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 263

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 132/257 (51%), Gaps = 19/257 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IH+    +   +D  D   +   +  KG  L+ +  THHH DHT     
Sbjct: 15  IPAFTDNYIWCIHDDTNAIV--VDPGDAEPVLAFINAKGLTLSAVLITHHHRDHTGGIAK 72

Query: 68  LKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI-----KIIATPGHTIGHICY 121
           L        I GP    + I GI   ++ GDT    S PI     +++  PGHT+ HI +
Sbjct: 73  LATAVPELPIIGP--RGNHIRGITKSVAQGDTV---SLPILNLSFQVMEVPGHTLDHIAF 127

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
            F +    C GDTLFS GCGR+FE S  +M+ SL K+K   D T +Y  HEYT+ N  FA
Sbjct: 128 -FGHGALFC-GDTLFSAGCGRLFEGSPEQMYHSLNKLKRLPDDTKVYCTHEYTQANVNFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--EN- 238
           L+ +P N  L  Y   V SMR QNL T PS +  +K +NPFLR    S++       EN 
Sbjct: 186 LAVEPDNGALNHYADWVASMREQNLPTLPSNLEEQKNINPFLRAHELSVKTAAEAYCENN 245

Query: 239 -ASNLAVFTELRIRKNQ 254
            A ++AVF  +R  K++
Sbjct: 246 LADDVAVFAAVRRWKDE 262


>gi|120611319|ref|YP_970997.1| hydroxyacylglutathione hydrolase [Acidovorax citrulli AAC00-1]
 gi|120589783|gb|ABM33223.1| Hydroxyacylglutathione hydrolase [Acidovorax citrulli AAC00-1]
          Length = 258

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 128/257 (49%), Gaps = 12/257 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+      A +D  +   + + L+  G  L  I  THHH DH    
Sbjct: 2   LPLPAFADNYIWMLHDGHS--AAVVDPGEAGPVLQALQHHGLALQAILVTHHHGDHVGGV 59

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     ++GP  ES  IP     L+DGDT       + +I  PGHT GHI YH  +
Sbjct: 60  AALREATGAPVYGPARES--IPQPAQPLADGDTLQVLGLRLSVIDVPGHTAGHIAYHAAD 117

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +   +T +   HEYT +N  FA 
Sbjct: 118 AAGGPLLFCGDTLFSGGCGRLFEGTPAQMQHSLDRLGALPPETRVCCAHEYTLSNLAFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK-----NLNME 237
           + +P N  L +Y    +++R+    T PS +  E  VNPFLR    ++ +     +   +
Sbjct: 178 AVEPGNAALLQYSHDCEALRAAGQPTLPSRLGTEHAVNPFLRAREPAVARAAQGFDPRTD 237

Query: 238 NASNLAVFTELRIRKNQ 254
            A   +V   LR  KN+
Sbjct: 238 AADPASVLAALRQWKNE 254


>gi|77458411|ref|YP_347916.1| Beta-lactamase-like [Pseudomonas fluorescens Pf0-1]
 gi|123605042|sp|Q3KE79|GLO2_PSEPF RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|77382414|gb|ABA73927.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           Pf0-1]
          Length = 255

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 130/252 (51%), Gaps = 9/252 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +H  +  A +D  D   +   L    GW L  I  THHH DH    
Sbjct: 6   ALPAFTDNYIWLLQDHATQRCAVVDPGDAAPVQAWLDAHPGWVLGDILITHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LKK    T++GP  E+  IPG D  L D DT         + A PGHT+GHI Y+  +
Sbjct: 66  ETLKKATGATVYGPASEN--IPGRDVALKDNDTVRVLGWDFDVYAVPGHTLGHIAYY--H 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE +  +M +SL ++ +  + T +Y  HEYT +N  FA + +
Sbjct: 122 HGLLFCGDTLFAAGCGRLFEGTPQQMHQSLSRLAALPEDTLVYCTHEYTLSNLKFAAAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA-SNLA- 243
           P N ++     KV   R   + T PST++LEK  NPFLR     + + ++  N   N A 
Sbjct: 182 PDNRDIAARLEKVTRQRENGVMTLPSTLALEKLTNPFLRTGEILVTQKVDERNGPQNRAP 241

Query: 244 --VFTELRIRKN 253
             VF  LR  K+
Sbjct: 242 SEVFAALRAWKD 253


>gi|115891513|ref|XP_783848.2| PREDICTED: similar to hydroxyacyl glutathione hydrolase
           [Strongylocentrotus purpuratus]
 gi|115949376|ref|XP_001191822.1| PREDICTED: similar to hydroxyacyl glutathione hydrolase
           [Strongylocentrotus purpuratus]
          Length = 258

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 135/255 (52%), Gaps = 11/255 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +S   DN+  L+ +   +  A +D  D   + K ++E+G  LT +  THHH DH   N  
Sbjct: 6   LSALEDNYMYLLTDEATKEAAIVDPVDPEKVLKAVQEEGVNLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFN-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L K  +  T+ G      +I  ++  +  GD F  G+  ++ + TP HT GHICY    D
Sbjct: 66  LVKLTSGLTVCG---GDDRIGALNKKVGHGDEFKVGNLQVRCLFTPCHTTGHICYFVQGD 122

Query: 127 H----FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCGR FE +  +M+ +L EK+    D T+++ GHEY+ ++  FA
Sbjct: 123 PSEAPVVFTGDTLFLSGCGRFFEGTPDQMYAALIEKLSKLPDNTNVFCGHEYSVSSLSFA 182

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           LS +P N+ +QK     K  R++ L T PST++ EK  NPF+R+   S++ ++   +   
Sbjct: 183 LSVEPDNVSIQKKLEWAKDQRAKKLPTIPSTLAEEKAYNPFMRVGAKSIQDHVG--STEP 240

Query: 242 LAVFTELRIRKNQSK 256
           + V   LR  K+  K
Sbjct: 241 IEVMGRLRKEKDNFK 255


>gi|172060231|ref|YP_001807883.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MC40-6]
 gi|171992748|gb|ACB63667.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MC40-6]
          Length = 273

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 86/270 (31%), Positives = 138/270 (51%), Gaps = 26/270 (9%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP  E+  +  +   L+ GD  T D  +    ++  PGHT GHI
Sbjct: 65  AALRDSQPDDAPLVVYGPAAEAIGV--VTRSLAGGDRVTLDAPALAFDVLDVPGHTRGHI 122

Query: 120 CY-----------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
            Y                H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++
Sbjct: 123 AYFQAAGVGGAGQGAATPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVH 181

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ 
Sbjct: 182 CAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSA 241

Query: 229 SLRKNLNME----NASNLAVFTELRIRKNQ 254
           ++   L  E        LA FT +R  KN+
Sbjct: 242 AIHATLEAELHERVPDRLAAFTLMREWKNR 271


>gi|91784546|ref|YP_559752.1| hydroxyacylglutathione hydrolase [Burkholderia xenovorans LB400]
 gi|91688500|gb|ABE31700.1| Hydroxyacylglutathione hydrolase [Burkholderia xenovorans LB400]
          Length = 263

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 137/260 (52%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +    +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWVVSDGHSAVV--VDPGEAAPVQAYLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L       ++GP  E+  I  + H L +GD     +  ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQAVPVYGPAGEA--IEHLTHRLKNGDHVSIAAPALELSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 AADPRGTPHVFC-GDTLFACGCGRLFEGTPKQMLASLDALAALPGATEVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N ELQ +  K   +R++ + T P+TI+ E+ VNPFLR  N     SLR+ L
Sbjct: 182 RFALACEPANAELQAWRDKAGELRARGVPTLPTTIAHERAVNPFLRAGNPAVQASLREQL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           + +    L  FT +R  KN+
Sbjct: 242 HEKVPDRLTAFTLMREWKNR 261


>gi|218892233|ref|YP_002441100.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           LESB58]
 gi|226724006|sp|B7VB64|GLO2_PSEA8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218772459|emb|CAW28241.1| probable hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           LESB58]
          Length = 258

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|262376276|ref|ZP_06069506.1| hydroxyacylglutathione hydrolase [Acinetobacter lwoffii SH145]
 gi|262308877|gb|EEY90010.1| hydroxyacylglutathione hydrolase [Acinetobacter lwoffii SH145]
          Length = 244

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 119/223 (53%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
            N+  L+ +      A ID  +  ++     E G  ++ I+ TH H DH      L +  
Sbjct: 16  QNYIWLLEHTASHQVAVIDPTEAELVQDYCAEHGLTVSQIWLTHWHKDHIGGVPELIQGQ 75

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVG 132
           N  ++GP  E SKIP I H L   + F+F    I++IA PGHT+GHI Y       L  G
Sbjct: 76  NLPVYGPRAELSKIPFITHPLEHEEQFNFHGIDIQVIAVPGHTLGHIVYFIDAIDVLFCG 135

Query: 133 DTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQ 192
           DTLF++GCGR+FE +Y++M+ SL ++ +   +T +Y  HEYT +NA FA   +P N  + 
Sbjct: 136 DTLFAMGCGRVFEGTYSQMYHSLSRLAALPPRTQVYCTHEYTLSNAQFAKHVEPDNSAIL 195

Query: 193 KYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           +    ++ +R     T PS+I  E + NPFLR E+    + L 
Sbjct: 196 ERFEHIERLRILGQCTLPSSIEDELQTNPFLRAESVEEFQRLR 238


>gi|15597010|ref|NP_250504.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PAO1]
 gi|313110511|ref|ZP_07796396.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           39016]
 gi|81541212|sp|Q9I2T1|GLO2_PSEAE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|9947798|gb|AAG05202.1|AE004608_1 probable hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           PAO1]
 gi|310882898|gb|EFQ41492.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           39016]
          Length = 258

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|296389796|ref|ZP_06879271.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PAb1]
          Length = 258

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERIEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|254234907|ref|ZP_04928230.1| hypothetical protein PACG_00782 [Pseudomonas aeruginosa C3719]
 gi|126166838|gb|EAZ52349.1| hypothetical protein PACG_00782 [Pseudomonas aeruginosa C3719]
          Length = 258

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLATHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|237730196|ref|ZP_04560677.1| hydroxyacylglutathione hydrolase [Citrobacter sp. 30_2]
 gi|226905735|gb|EEH91653.1| hydroxyacylglutathione hydrolase [Citrobacter sp. 30_2]
          Length = 251

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 122/232 (52%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N+       +D  +   + K + E  W    I  THHH DH     
Sbjct: 5   SIPAFQDNYIWVLSNNDQH-CLIVDPGEAAPVLKAIAEHNWVPEAILLTHHHQDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F    ++GP E   K  G  H + DGD      H  ++IATPGHT+GHICY F +
Sbjct: 64  ELLQHFPQIVVYGPAETQDK--GTTHVVEDGDIALVLGHEFRVIATPGHTLGHICY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE +  +M++SL+KI    D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTATQMYQSLKKINELPDDTLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+  + +Y  KV  +R +   T P  +  E++ N FLR E+  L   +N E
Sbjct: 180 PHDSFINEYYRKVNELRVKKQMTLPVILKNERRNNLFLRTEDIDLINEINKE 231


>gi|114321143|ref|YP_742826.1| hydroxyacylglutathione hydrolase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311280|sp|Q0A751|GLO2_ALHEH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114227537|gb|ABI57336.1| Hydroxyacylglutathione hydrolase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 256

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 132/261 (50%), Gaps = 11/261 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT + +AI  + DN+  L  +   RL A +D  D   +   LR  G  L+ I  THHH D
Sbjct: 1   MTEI-VAIPAFADNYIWLAVDRNRRLAAVVDPGDAEPVEAALRASGLRLSAILITHHHHD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH--PIKIIATPGHTIGH 118
           HT     L       ++GP +ES  +PG+   L + D F+      P++++  PGHT GH
Sbjct: 60  HTGGVEELLAAHPVPVYGPADES--VPGVSQPLREPDAFEVPGLGLPLRVLDVPGHTAGH 117

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I    + D  L  GD LF+ GCGR+FE +  +M+ SL K+ +  + T +Y GHEYT  N 
Sbjct: 118 IA--LVADGALFSGDALFAGGCGRLFEGTPEQMYASLGKLAALPEATRVYCGHEYTLANL 175

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA   +P N  L +   + ++ R +   T PS ++ E   NPFLR    ++R      +
Sbjct: 176 RFAHQVEPDNPNLTQRLRQAEAARQRGEPTVPSRMADEHATNPFLRAHLPAVRTAAERWS 235

Query: 239 ASNL----AVFTELRIRKNQS 255
              L    AVF  LR  K+QS
Sbjct: 236 GQTLDEPVAVFAALRRWKDQS 256


>gi|107101245|ref|ZP_01365163.1| hypothetical protein PaerPA_01002278 [Pseudomonas aeruginosa PACS2]
          Length = 258

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 130/254 (51%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH DH    
Sbjct: 6   ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLATHPDWRLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY-HFM 124
             LK+     + GP  E  KIP  D  L DG+  +      +I   PGHT+GHI Y H  
Sbjct: 66  AALKELTGARVLGPANE--KIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHIAYYHPA 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N  FAL+ 
Sbjct: 124 ETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNLRFALAV 183

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K  +     +N +
Sbjct: 184 EPDNASLRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRSGQQNRT 243

Query: 241 NLAVFTELRIRKNQ 254
              VF  LR  K+Q
Sbjct: 244 PEEVFAVLRAWKDQ 257


>gi|330799145|ref|XP_003287608.1| hypothetical protein DICPUDRAFT_151708 [Dictyostelium purpureum]
 gi|325082394|gb|EGC35877.1| hypothetical protein DICPUDRAFT_151708 [Dictyostelium purpureum]
          Length = 262

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 99/263 (37%), Positives = 141/263 (53%), Gaps = 19/263 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPD-TYIISKMLREKGWFLTHIFNTHHHIDHTRA 64
           I + +  DN+  L+ + K +L  AID  + T IIS     K   + ++F THHH DH   
Sbjct: 4   IPVLVNRDNYSYLLVDEKNKLGVAIDPCEPTKIISAA--PKDIQIENVFTTHHHWDHAGG 61

Query: 65  NLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF 123
           N  +K+      I+G  E   +I GI + L+DGDT   GS  IK +  P HT GH+ Y+ 
Sbjct: 62  NNQIKELIKGVKIYGGDE---RIEGITNKLNDGDTIKIGSLTIKTLKAPAHTSGHVLYYV 118

Query: 124 M-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENN 177
           +     N   L  GDTLF  GCGR+FE    +M+ +L E I    ++T +Y GHEYT NN
Sbjct: 119 LDEEEPNKSVLFTGDTLFIGGCGRLFEGDPKQMYHALYEIIGKLPEETLVYVGHEYTLNN 178

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR-----IENTSLRK 232
             FAL+ +  N +L  Y  +V+ M +    T PSTIS EKK+NPF+R     I N  L+ 
Sbjct: 179 LKFALTLESDNNDLNSYFKQVEKMVANQQPTVPSTISNEKKINPFMRCHLPSIYNNYLKA 238

Query: 233 NLNMENASN-LAVFTELRIRKNQ 254
           N   +   + +AV   +R  K++
Sbjct: 239 NPQSQVPPDTIAVLGYIRELKDK 261


>gi|254480561|ref|ZP_05093808.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2148]
 gi|214039144|gb|EEB79804.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2148]
          Length = 257

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 130/251 (51%), Gaps = 7/251 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  ++DN+  LI          +D  D  ++ + L E+   LT +  THHH DH     +
Sbjct: 7   IPAFNDNYIWLICIDGTDQAYVVDPGDAEVVEQALEERQLQLTGVLITHHHFDHVGGLAD 66

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +N  ++GP  ++  I G+DH +  GD  D     ++++  PGHT+ HI Y    D 
Sbjct: 67  LKAKYNPVVYGP--DNPSIDGLDHIVRAGDVIDVLGASLEVLEVPGHTLDHIAYFLAGDA 124

Query: 128 FLC-VGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            L   GDTLF+ GCGR+FE +   M  SL  +     +T IY  HEYT  N  FA + +P
Sbjct: 125 PLVFCGDTLFAGGCGRVFEGTPDMMHASLCALAELPAETRIYCAHEYTLANLAFAQAVEP 184

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNL-- 242
           +N  L +     ++ R+    T PST++LE   NPF+R E   L+ +L  ++   S+L  
Sbjct: 185 NNPALAQRVVADQASRAAGEPTVPSTLALELATNPFVRCETHELQNSLRQQDKLISDLPA 244

Query: 243 AVFTELRIRKN 253
           +VF  +R  K+
Sbjct: 245 SVFATVRGWKD 255


>gi|325277449|ref|ZP_08143058.1| hydroxyacylglutathione hydrolase [Pseudomonas sp. TJI-51]
 gi|324097419|gb|EGB95656.1| hydroxyacylglutathione hydrolase [Pseudomonas sp. TJI-51]
          Length = 260

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 132/257 (51%), Gaps = 14/257 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ +   R  A +D  D   + + L    GW L+ I  THHH DH    
Sbjct: 6   ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPGWALSDILITHHHNDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+     + GP  E  +IP  D  L +G   +      +++A PGHT+GHI   F +
Sbjct: 66  ARLKQLTGARVCGPANE--QIPCRDLALDEGAEVEVLGVVFQVLAVPGHTLGHIA--FFS 121

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           D       L  GDTLF+ GCGR+FE +  +M  +L ++ +    T +Y  HEYT  N  F
Sbjct: 122 DQPSETPLLFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPAHTQVYCAHEYTLANLRF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM---- 236
           A + +P N  +Q+   +V  +R+    T PSTI LE+  NPFLR   T +++  +     
Sbjct: 182 AKAVEPDNPHVQQRFDEVTRLRADQRITLPSTIGLERLTNPFLRTSETLVKQKADEWKGH 241

Query: 237 ENASNLAVFTELRIRKN 253
            NA+++AVF  LR  K+
Sbjct: 242 SNATHVAVFAALRSWKD 258


>gi|51597282|ref|YP_071473.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis IP
           32953]
 gi|153947476|ref|YP_001400033.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|170023352|ref|YP_001719857.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           YPIII]
 gi|186896387|ref|YP_001873499.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           PB1/+]
 gi|81638785|sp|Q667M5|GLO2_YERPS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166990463|sp|A7FFK5|GLO2_YERP3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724039|sp|B2KAD1|GLO2_YERPB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724040|sp|B1JR44|GLO2_YERPY RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|51590564|emb|CAH22205.1| putative hydroxyacylglutathione hydrolase [Yersinia
           pseudotuberculosis IP 32953]
 gi|152958971|gb|ABS46432.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|169749886|gb|ACA67404.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           YPIII]
 gi|186699413|gb|ACC90042.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 251

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 139/251 (55%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L+  F +  ++GP E + K  G    ++DGD+         IIA PGHT+GHI Y+  
Sbjct: 63  ADLRHHFPDIPVYGPQETAKK--GATVIVNDGDSLTIAGQNYTIIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA + 
Sbjct: 119 SSPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ + + +  +  +
Sbjct: 179 LPADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGITSPPDSLV 238

Query: 243 AVFTELRIRKN 253
           +VF ELR RK+
Sbjct: 239 SVFCELRSRKD 249


>gi|24374106|ref|NP_718149.1| metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
 gi|81589197|sp|Q8EE27|GLO2_SHEON RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24348596|gb|AAN55593.1|AE015698_1 metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
          Length = 267

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 134/264 (50%), Gaps = 21/264 (7%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+  ++     +    +D  D  ++   L      L  I  THHH DHT    
Sbjct: 6   AINAFNDNYIWVLQQDTQQAVYVVDPGDVNVVLDYLNAHQLTLAGILITHHHRDHTGGIA 65

Query: 67  NLKKFFNCT------IFGPLEESSKIPGIDHGLSDGDT----FDFGSHPIKIIATPGHTI 116
            L  +   T      ++GP  +S  I G++  +    T      F + P+++++ PGHT 
Sbjct: 66  ALVAYVEQTTGHTLAVYGP--QSEAIQGVNIAIEPQITQILHLPFLNSPVQVLSVPGHTA 123

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y  + D  L  GDTLFS GCGR+FE + A+M  SL  + +   +T +Y  HEYT  
Sbjct: 124 GHIAY--LVDGALFCGDTLFSGGCGRLFEGTPAQMCHSLRLLAALPAETRVYCAHEYTLA 181

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-- 234
           N  FA + DP N +L+ Y  +  ++R+Q   T PSTI LE+ +NPFLR    ++  ++  
Sbjct: 182 NLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSINPFLRGLTPTIVDSIKQ 241

Query: 235 -----NMENASNLAVFTELRIRKN 253
                ++ N   L  FT LR  K+
Sbjct: 242 QFCDQDLSNVDELTYFTLLRQWKD 265


>gi|120538690|gb|AAI29447.1| Im:7147352 protein [Danio rerio]
          Length = 343

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (49%), Gaps = 16/262 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  ++ +        +D  D   +   L  +G  L  +  TH H DH+  N
Sbjct: 79  IPVPILLDNYSYVVIDTASNTAVVVDPADPQPVQACLEAEGVALQAVLCTHKHWDHSGGN 138

Query: 66  LNLKKFFN-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP-IKIIATPGHTIGHICY-- 121
             LK+ ++ C ++G       IPG+ H L D DT DFG+    +   TPGHT+GH+ Y  
Sbjct: 139 RALKRRYSSCRVYG--NAMDNIPGLTHPLLDKDTIDFGTQLHFRAFYTPGHTVGHMIYLL 196

Query: 122 ---HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                     L  GD +F  GCGR+FE + + M  SL+ + S +D T ++ GHEY E+N 
Sbjct: 197 DGRAIGGPSSLFSGDLVFLSGCGRMFEGNASTMLSSLDTVGSLNDDTLLWPGHEYAEDNL 256

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA   +P N+  ++    V   RSQ L T PST+  EK+ NPFLR  +  L + L ++ 
Sbjct: 257 LFAADVEPGNVVREQKLQWVLQQRSQRLCTCPSTLLEEKQYNPFLRSHSQDLHQALGLQQ 316

Query: 239 ASN-------LAVFTELRIRKN 253
             +         V  ELR RK+
Sbjct: 317 KQDEDWTSYRARVLEELRRRKD 338


>gi|189520161|ref|XP_001923240.1| PREDICTED: probable hydrolase PNKD [Danio rerio]
          Length = 361

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (49%), Gaps = 16/262 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  ++ +        +D  D   +   L  +G  L  +  TH H DH+  N
Sbjct: 97  IPVPILLDNYSYVVIDTASNTAVVVDPADPQPVQACLEAEGVALQAVLCTHKHWDHSGGN 156

Query: 66  LNLKKFFN-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP-IKIIATPGHTIGHICY-- 121
             LK+ ++ C ++G       IPG+ H L D DT DFG+    +   TPGHT+GH+ Y  
Sbjct: 157 RALKRRYSSCRVYG--NAMDNIPGLTHPLLDKDTIDFGTQLHFRAFYTPGHTVGHMIYLL 214

Query: 122 ---HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
                     L  GD +F  GCGR+FE + + M  SL+ + S +D T ++ GHEY E+N 
Sbjct: 215 DGRAIGGPSSLFSGDLVFLSGCGRMFEGNASTMLSSLDTVGSLNDDTLLWPGHEYAEDNL 274

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA   +P N+  ++    V   RSQ L T PST+  EK+ NPFLR  +  L + L ++ 
Sbjct: 275 LFAADVEPGNVVREQKLQWVLQQRSQRLCTCPSTLLEEKQYNPFLRSHSQDLHQALGLQQ 334

Query: 239 ASN-------LAVFTELRIRKN 253
             +         V  ELR RK+
Sbjct: 335 KQDEDWTSYRARVLEELRRRKD 356


>gi|115351217|ref|YP_773056.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria AMMD]
 gi|115281205|gb|ABI86722.1| Hydroxyacylglutathione hydrolase [Burkholderia ambifaria AMMD]
          Length = 260

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 136/263 (51%), Gaps = 21/263 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH      
Sbjct: 1   MPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGVAA 58

Query: 68  LKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHICY 121
           L+          ++GP  E+  +  +   L+ GD    D  +    ++  PGHT GHI Y
Sbjct: 59  LRDSQPDDAPLVVYGPAAEAIGV--VTRPLAGGDRVMLDAPALAFDVLDVPGHTRGHIAY 116

Query: 122 ------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
                      H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEYT 
Sbjct: 117 FQAAGVGAATPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEYTL 175

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ ++   L 
Sbjct: 176 SNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSAAIHATLE 235

Query: 236 ME----NASNLAVFTELRIRKNQ 254
            E        LA FT +R  KN+
Sbjct: 236 AELHETVPDRLAAFTLMREWKNR 258


>gi|283834502|ref|ZP_06354243.1| hydroxyacylglutathione hydrolase [Citrobacter youngae ATCC 29220]
 gi|291070052|gb|EFE08161.1| hydroxyacylglutathione hydrolase [Citrobacter youngae ATCC 29220]
          Length = 251

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 121/232 (52%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N+       +D  +   + K + E  W    I  THHH DH     
Sbjct: 5   SIPAFQDNYIWVLSNNDQH-CLIVDPGEAAPVLKAIAEHNWIPEAILLTHHHQDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F    ++GP E   K  G    + DGD      H  K+IATPGHT+GHICY   N
Sbjct: 64  ELLQHFPQIVVYGPAETQDK--GTTRIVEDGDIALVLGHEFKVIATPGHTLGHICY--FN 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M++SL++I +  D T I   HEYT  N  FALS  
Sbjct: 120 HPYLFCGDTLFSGGCGRLFEGTATQMYQSLKRISALPDDTLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+  + +Y  KV  +R +   T P  +  E++ N FLR E+  L   +N E
Sbjct: 180 PHDSFINEYYRKVNELRVKKQMTLPVILKNERRNNIFLRTEDVDLINEINKE 231


>gi|254786146|ref|YP_003073575.1| hydroxyacylglutathione hydrolase [Teredinibacter turnerae T7901]
 gi|237684030|gb|ACR11294.1| hydroxyacylglutathione hydrolase [Teredinibacter turnerae T7901]
          Length = 261

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 131/257 (50%), Gaps = 16/257 (6%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           ++  HDN+  +I +    L   ID  +   +  +L+E+G   T I  TH H DH      
Sbjct: 8   VATLHDNYVWIIEHRNNAL--VIDPGEAAPVIAVLKERGLSATAILLTHRHWDHVDGIPE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDF--GSHPIKIIATPGHTIGHICYHFMN 125
           L++ F C I+GP  ESS +P +   L++GD  +F  G    +I  TPGHT  HI Y   +
Sbjct: 66  LQEHFPCPIYGP--ESSAMPQVTQTLTEGDHLEFWDGMAKFQIWHTPGHTEEHIAYLLAD 123

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H       C GDTLFS GCGR+   +  ++  SLE+ K  +  T +Y  HEYT+ N  F
Sbjct: 124 EHNNSTAIFC-GDTLFSAGCGRLLGGTAEQLCNSLERYKRLAADTILYCTHEYTQANLRF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNLNM 236
           A + +P N  +++Y   V+  R     T P+T+  E ++NPFLR +     T +  +   
Sbjct: 183 AQAVEPSNTLIREYAGVVQEQRLNGATTLPTTVGKELEINPFLRCDQPEVITQIEAHTGK 242

Query: 237 ENASNLAVFTELRIRKN 253
              S L  FT LR  K+
Sbjct: 243 TVTSGLQTFTALRQWKD 259


>gi|320538888|ref|ZP_08038564.1| putative hydroxyacylglutathione hydrolase [Serratia symbiotica str.
           Tucson]
 gi|320031048|gb|EFW13051.1| putative hydroxyacylglutathione hydrolase [Serratia symbiotica str.
           Tucson]
          Length = 251

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/254 (33%), Positives = 137/254 (53%), Gaps = 14/254 (5%)

Query: 6   IAISLYHDNFCILI---HNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           I+I    DN+  L+   H H   +     AP   ++  + R K      I  THHH DH 
Sbjct: 4   ISIPALQDNYIWLLDDQHGHCVIIDPGESAP---VLGALYRLK-LIPDAILLTHHHQDHV 59

Query: 63  RANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                +   + N  ++GP E + K  G+DH + DG+ F+        IA PGHT+GH+  
Sbjct: 60  GGVAQVVAHYPNLPVYGPQETADK--GVDHVVHDGEKFEINGRQYVTIALPGHTLGHVA- 116

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
            F +  +L  GDT+FS GCGR+FE +  +M++S +++    D T I   HEYT +N  FA
Sbjct: 117 -FYSAPYLFCGDTMFSAGCGRLFESTAEQMYDSFQQLAQLPDNTLICCAHEYTLSNLKFA 175

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            +  P + E++ Y   V+++R++N  + P+ + LE+K+N FLR  +  L+K L   +   
Sbjct: 176 RAVLPEDREIEVYQQHVEALRAKNQPSVPTNLQLERKINLFLRCHDYDLQKKLGFNSPPK 235

Query: 242 L--AVFTELRIRKN 253
              +VF+ELR+RK+
Sbjct: 236 QLHSVFSELRLRKD 249


>gi|223996443|ref|XP_002287895.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
 gi|220977011|gb|EED95338.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
          Length = 262

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 124/231 (53%), Gaps = 9/231 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LI ++  +  A ID  D   I K   +    +T I  TH+H DH+  N
Sbjct: 7   IPVPALQDNYMYLIIDNDSKKAAVIDPVDVDAIQKAAHDNHATITTILTTHNHWDHSGGN 66

Query: 66  LNLKKFFNCT--IFGPLEESSKIPGIDHGLSDGDTFDFG-SHPIKIIATPGHTIGHICYH 122
           + L K  +    ++G + +   +PG  H + +GDTF  G S  +K++ TP HT GH+CY+
Sbjct: 67  IKLVKTLSTIDRVYGGVGDG--VPGCTHEVGEGDTFTIGNSTHVKVLFTPCHTPGHVCYY 124

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             N H    GDT+F  GCG     +  +M E+ +K+    D T+++ GHEYT  N  FA 
Sbjct: 125 IDNAHVF-TGDTMFISGCGNFNTGTPRQMTEAFDKLLGLPDDTNVWVGHEYTAKNCAFAC 183

Query: 183 SCDPHNLEL---QKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
            C+P+N +L   QK+     S+ +    T PSTI +EKK NPF RI+  S+
Sbjct: 184 FCEPNNQDLKGRQKWAEGQGSLHNGGKGTVPSTIKMEKKCNPFARIDELSV 234


>gi|317052652|ref|YP_004113768.1| hydroxyacylglutathione hydrolase [Desulfurispirillum indicum S5]
 gi|316947736|gb|ADU67212.1| hydroxyacylglutathione hydrolase [Desulfurispirillum indicum S5]
          Length = 259

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 118/221 (53%), Gaps = 4/221 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  LI   +   +A +D      + +++R      T +  THHH DH    
Sbjct: 4   IPIPCAQDNYAYLILCEETGESAVVDPCQFAPVDRVIRHHDIRPTALLCTHHHADHVGGV 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + +    ++    +  +IPG +   +DGDT   G  P +++ TPGHT G + YHF 
Sbjct: 64  EELLQAYPGLRVWAHTSDRGRIPGQNGFANDGDTLTVGKIPGRVLHTPGHTRGSVVYHFD 123

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLE-KIKSFSDKTHIYFGHEYTENNAYFALS 183
              F   GD+LFS GCGR+FE S  +M+ SL  ++ S +D   IYFGHEYTE+N  FA  
Sbjct: 124 GAAF--TGDSLFSAGCGRLFEGSAEQMYHSLNVRLASLTDDVAIYFGHEYTESNLRFARH 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
            +P N  L  Y  +V+++R     T PST+  E+ +NPFLR
Sbjct: 182 VEPSNPALLGYHDEVQALRRMGKATTPSTMGQERLINPFLR 222


>gi|198463971|ref|XP_001353016.2| GA18136 [Drosophila pseudoobscura pseudoobscura]
 gi|198151486|gb|EAL30517.2| GA18136 [Drosophila pseudoobscura pseudoobscura]
          Length = 305

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/263 (32%), Positives = 134/263 (50%), Gaps = 15/263 (5%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E    L+ +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAVVDPVDPELVIKTVQEANVTLSKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           DH   N  L K +     ++G      +I  ++  +   D+F  GS  ++ ++TP HT G
Sbjct: 104 DHAGGNEKLVKLWEKELEVYGG---DDRIGALNKMVRQDDSFTIGSLNVRCLSTPCHTTG 160

Query: 118 HICYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGH 171
           HICYH        +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GH
Sbjct: 161 HICYHVTAGDGKGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGH 220

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++
Sbjct: 221 EYTLQNMSFARHVEPDNESIQQRIEWAKLRRASQDPTVPSTIGEEKIWNPFMRVHEASVQ 280

Query: 232 KNLNMENASNLAVFTELRIRKNQ 254
           K+      +   + T  ++RK +
Sbjct: 281 KHA---GGATDPIVTMGKLRKEK 300


>gi|21356335|ref|NP_649258.1| CG4365, isoform A [Drosophila melanogaster]
 gi|10726918|gb|AAF51642.2| CG4365, isoform A [Drosophila melanogaster]
 gi|16769332|gb|AAL28885.1| LD26447p [Drosophila melanogaster]
 gi|220944250|gb|ACL84668.1| CG4365-PA [synthetic construct]
 gi|220954192|gb|ACL89639.1| CG4365-PA [synthetic construct]
          Length = 305

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 56  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 115

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 116 WEKELDVYGG---DDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGS 172

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 173 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 232

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 233 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKHA---GGATDP 289

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 290 VVTMGKLRKEK 300


>gi|108806554|ref|YP_650470.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Antiqua]
 gi|108813079|ref|YP_648846.1| hydroxyacylglutathione hydrolase [Yersinia pestis Nepal516]
 gi|149366918|ref|ZP_01888952.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis
           CA88-4125]
 gi|165924657|ref|ZP_02220489.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938282|ref|ZP_02226840.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011971|ref|ZP_02232869.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211458|ref|ZP_02237493.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399719|ref|ZP_02305237.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419706|ref|ZP_02311459.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167470218|ref|ZP_02334922.1| metallo-beta-lactamase family protein [Yersinia pestis FV-1]
 gi|218928248|ref|YP_002346123.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis CO92]
 gi|229841010|ref|ZP_04461169.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229843115|ref|ZP_04463261.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229895467|ref|ZP_04510639.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Pestoides A]
 gi|229903522|ref|ZP_04518635.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Nepal516]
 gi|294503095|ref|YP_003567157.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Z176003]
 gi|122960103|sp|Q0WHW5|GLO2_YERPE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123372682|sp|Q1CAJ7|GLO2_YERPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123372998|sp|Q1CFI4|GLO2_YERPN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|108776727|gb|ABG19246.1| hydroxyacylglutathione hydrolase [Yersinia pestis Nepal516]
 gi|108778467|gb|ABG12525.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Antiqua]
 gi|115346859|emb|CAL19745.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis CO92]
 gi|149291292|gb|EDM41367.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis
           CA88-4125]
 gi|165913660|gb|EDR32279.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923717|gb|EDR40849.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989138|gb|EDR41439.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166207229|gb|EDR51709.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962447|gb|EDR58468.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050427|gb|EDR61835.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|229679292|gb|EEO75395.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Nepal516]
 gi|229689462|gb|EEO81523.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697376|gb|EEO87423.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701622|gb|EEO89649.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Pestoides A]
 gi|262365375|gb|ACY61932.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis D182038]
 gi|294353554|gb|ADE63895.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Z176003]
 gi|320014215|gb|ADV97786.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 251

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L+  F +  ++GP E + K  G    ++DGD+         IIA PGHT+GHI Y+  
Sbjct: 63  ADLRHHFPDIPVYGPQETAKK--GATVIVNDGDSLTIAGQNYTIIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA + 
Sbjct: 119 SSPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  +
Sbjct: 179 LPADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTSPPDSLV 238

Query: 243 AVFTELRIRKN 253
           +VF ELR RK+
Sbjct: 239 SVFCELRSRKD 249


>gi|322779041|gb|EFZ09440.1| hypothetical protein SINV_15790 [Solenopsis invicta]
          Length = 242

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 129/238 (54%), Gaps = 13/238 (5%)

Query: 27  TAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKK-FFNCTIFGPLEESSK 85
            A +D  D   ++  +++    LT +  THHH DH   N  L K F +  I+G      +
Sbjct: 9   AAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWDHAGGNAKLSKSFADIAIYG---GDDR 65

Query: 86  IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN----DHFLCV--GDTLFSLG 139
           I  I+H +   DTF+ G+  IK +ATP HT GHICY+       +H   V  GDTLF+ G
Sbjct: 66  IEAINHKIMHSDTFNIGNLSIKCLATPCHTRGHICYYVTGGGGGEHPPAVFTGDTLFAGG 125

Query: 140 CGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKV 198
           CG+ FE +  +M+++L E + S  ++T +Y GHEYT NN  FAL  +P N  +++    V
Sbjct: 126 CGKFFEGTADQMYKALVEILGSLPEQTKVYCGHEYTVNNLKFALHVEPENATIRQKLDMV 185

Query: 199 KSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKNQSK 256
            + R+ NL T PSTI  EK  NPF+R+   S+ K+    +   +   + LR  K+  K
Sbjct: 186 HTQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHAQQNDP--IQTMSYLRREKDNFK 241


>gi|170589387|ref|XP_001899455.1| Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site. [Brugia malayi]
 gi|158593668|gb|EDP32263.1| Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site., putative [Brugia malayi]
          Length = 271

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/253 (35%), Positives = 130/253 (51%), Gaps = 15/253 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+ + K    A ID  D   I+K ++E G  LT    THHH DH  A 
Sbjct: 25  IPVPALSDNYMYLLVDEKSSDAAIIDPVDLKGINKTVKENGVKLTSSLVTHHHWDHAGAT 84

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L  ++   +I+G      +I  I + + DGD F  G   +K + TP HT G +CY+  
Sbjct: 85  NELSDEYRGLSIYGG---DDRIASITNKVRDGDIFKIGELDVKCLYTPCHTTGSVCYYVT 141

Query: 125 N---DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYF 180
           +   D  +  GDTLF  GCGR FE   A+M  +L +K+ S  + T IY GHEYT  N  F
Sbjct: 142 DGSGDKVVFTGDTLFIGGCGRFFEGDAADMDSALNKKLGSLPNDTKIYCGHEYTVENLKF 201

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A S +P N E+ K  +  +  R    YT PSTI  EK+ NPF+R+ N +       +++ 
Sbjct: 202 AHSIEPKNDEITKKLAWAEERRKAGDYTVPSTIEEEKRFNPFMRVRNVT-------KSSD 254

Query: 241 NLAVFTELRIRKN 253
            + +  ++R  KN
Sbjct: 255 PITIMAKIRSMKN 267


>gi|312069728|ref|XP_003137817.1| hydroxyacylglutathione hydrolase [Loa loa]
 gi|307767014|gb|EFO26248.1| hydroxyacylglutathione hydrolase [Loa loa]
          Length = 277

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/253 (35%), Positives = 133/253 (52%), Gaps = 9/253 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+ + +    A +D  +   I+K ++E G  LT    THHH DH  A 
Sbjct: 25  IPIPALSDNYMYLLIDEETSNAAIVDPVNLKGINKAVKETGVRLTSSLVTHHHWDHAGAT 84

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L  ++   +I+G      +I GI   + DGD F  G   +K + TP HT G +CY+  
Sbjct: 85  RELSVEYPGLSIYG---GDDRIIGITSKVGDGDIFKIGKVNVKCLYTPCHTTGSVCYYVT 141

Query: 125 N---DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYF 180
           +   D  +  GDTLF  GCGR FE +  +M  +L EK+ S  + T +Y GHEYT  N  F
Sbjct: 142 DGNGDKVVFTGDTLFIGGCGRFFEGNATDMDSALNEKLGSLPNDTMVYCGHEYTVENLKF 201

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A S +P N E+ K  +  +  R    YT PSTI  EK+ NPF+R+  +   +N+  ++A+
Sbjct: 202 AHSVEPENDEITKKLAWAEEQRKAGNYTVPSTIGEEKRFNPFMRVRISDELRNV-AKSAN 260

Query: 241 NLAVFTELRIRKN 253
            + V  ++R  KN
Sbjct: 261 PIIVMAKIRSMKN 273


>gi|195348363|ref|XP_002040718.1| GM22320 [Drosophila sechellia]
 gi|194122228|gb|EDW44271.1| GM22320 [Drosophila sechellia]
          Length = 348

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 159 WQKELDVYG---GDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHVTAQDGS 215

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 216 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 276 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEAAVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 333 VVTMGKLRKEK 343


>gi|145598915|ref|YP_001162991.1| hydroxyacylglutathione hydrolase [Yersinia pestis Pestoides F]
 gi|160395515|sp|A4TL56|GLO2_YERPP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145210611|gb|ABP40018.1| hydroxyacylglutathione hydrolase [Yersinia pestis Pestoides F]
          Length = 251

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L+  F +  ++GP E + K  G    ++DGD+         IIA PGHT+GHI Y+  
Sbjct: 63  ADLRHHFPDIPVYGPQETAKK--GATVIVNDGDSLTIAGQNYTIIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA + 
Sbjct: 119 SSPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  +
Sbjct: 179 LPADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIETTSPPDSLV 238

Query: 243 AVFTELRIRKN 253
           +VF ELR RK+
Sbjct: 239 SVFCELRSRKD 249


>gi|22126973|ref|NP_670396.1| hydroxyacylglutathione hydrolase [Yersinia pestis KIM 10]
 gi|45442538|ref|NP_994077.1| hydroxyacylglutathione hydrolase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|162420794|ref|YP_001607086.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|167424058|ref|ZP_02315811.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|21960016|gb|AAM86647.1|AE013910_9 probable hydroxyacylglutathione hydrolase [Yersinia pestis KIM 10]
 gi|45437403|gb|AAS62954.1| probable hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162353609|gb|ABX87557.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|167056907|gb|EDR66670.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|262361132|gb|ACY57853.1| hydroxyacylglutathione hydrolase [Yersinia pestis D106004]
          Length = 280

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 33  ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 91

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L+  F +  ++GP E + K  G    ++DGD+         IIA PGHT+GHI Y+  
Sbjct: 92  ADLRHHFPDIPVYGPQETAKK--GATVIVNDGDSLTIAGQNYTIIAVPGHTLGHIAYY-- 147

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA + 
Sbjct: 148 SSPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAI 207

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  +
Sbjct: 208 LPADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTSPPDSLV 267

Query: 243 AVFTELRIRKN 253
           +VF ELR RK+
Sbjct: 268 SVFCELRSRKD 278


>gi|24667703|ref|NP_730568.1| CG4365, isoform C [Drosophila melanogaster]
 gi|23094188|gb|AAN12145.1| CG4365, isoform C [Drosophila melanogaster]
          Length = 348

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 159 WEKELDVYG---GDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGS 215

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 216 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 276 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 333 VVTMGKLRKEK 343


>gi|332374344|gb|AEE62313.1| unknown [Dendroctonus ponderosae]
          Length = 302

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 90/253 (35%), Positives = 136/253 (53%), Gaps = 17/253 (6%)

Query: 13  DNFCILIHNHKYRLTAAID--APDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKK 70
           DN+  LI +   +  A +D  APDT +    ++ +G  LT I  THHH DH   N  L K
Sbjct: 57  DNYMYLITDETTKQAAIVDPVAPDTVL--HAVQNEGVNLTQILTTHHHWDHAGGNEELIK 114

Query: 71  FFNCTIFGPLE---ESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
              C    PLE      +I G+ + +SDGD F  G   ++ + TP HT GHICY+  +  
Sbjct: 115 --KCP--NPLEVYGGDKRIGGLTNKVSDGDRFKIGEIDVECLFTPCHTTGHICYYLTDPK 170

Query: 126 -DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  +M+ +L EK+    D T ++ GHEYT+ N  FA  
Sbjct: 171 GETAVFTGDTLFVAGCGRFFEGTPQQMYTALVEKLSKLPDNTLVFCGHEYTQQNLKFARH 230

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +  N ++ K  +     R + + T PSTI  EKK+NPF+R+   S++++ + ++A  +A
Sbjct: 231 VERENRDIMKASADADEKRQKGIPTVPSTILQEKKINPFMRVMMGSVQRHASCDDA--IA 288

Query: 244 VFTELRIRKNQSK 256
               +R  K+  K
Sbjct: 289 TMQAIRKEKDTFK 301


>gi|24667711|ref|NP_730569.1| CG4365, isoform B [Drosophila melanogaster]
 gi|10726919|gb|AAG22178.1| CG4365, isoform B [Drosophila melanogaster]
          Length = 271

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 22  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 81

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 82  WEKELDVYGG---DDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGS 138

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 139 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 198

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 199 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKHA---GGATDP 255

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 256 VVTMGKLRKEK 266


>gi|195591960|ref|XP_002085704.1| GD14908 [Drosophila simulans]
 gi|194197713|gb|EDX11289.1| GD14908 [Drosophila simulans]
          Length = 348

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 159 WQKELDVYG---GDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHVTAQDGS 215

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 216 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 276 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 333 VVTMGKLRKEK 343


>gi|126642239|ref|YP_001085223.1| putative hydroxyacylglutathione hydrolase [Acinetobacter baumannii
           ATCC 17978]
          Length = 168

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%)

Query: 75  TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDT 134
            ++GP +E SKIPGI H L   D   F    ++IIATPGHT+GHI Y     + L  GDT
Sbjct: 2   AVYGPRDELSKIPGITHPLQHDDHLKFNDLKVEIIATPGHTLGHIVYFIEELNTLFCGDT 61

Query: 135 LFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKY 194
           LF++GCGR+FE +  +M+ SL ++ +    T +Y  HEYT +NA FALS +P N  LQ+ 
Sbjct: 62  LFAMGCGRLFEGTAEQMYHSLNRLAALPTATKVYCTHEYTLSNAEFALSVEPENHALQER 121

Query: 195 CSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             +V+ +R +   T PS+I LE   NPFLR E+ 
Sbjct: 122 AEQVRMLRQEGKITLPSSIELELATNPFLRAESV 155


>gi|313661527|gb|ADR71718.1| AT09325p [Drosophila melanogaster]
          Length = 360

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 111 QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKL 170

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G   +K ++TP HT GHICYH       
Sbjct: 171 WEKELDVYG---GDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHVTAQQGS 227

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 228 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARH 287

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 288 VEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH---AGGATDP 344

Query: 244 VFTELRIRKNQ 254
           V T  ++RK +
Sbjct: 345 VVTMGKLRKEK 355


>gi|325527248|gb|EGD04627.1| hydroxyacylglutathione hydrolase [Burkholderia sp. TJI49]
          Length = 268

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 136/265 (51%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGHI 119
             L+          ++GP  E+  +  +   L+ G      +      ++  PGHT GHI
Sbjct: 65  EALRAGQPDDLPLPVYGPAAEAIGV--VTQPLAGGARVTLAAPAAHFDVLDVPGHTRGHI 122

Query: 120 CY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGQGAAVPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPF+R ++ ++R  
Sbjct: 182 TLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFMRADSEAIRAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E        LA F  LR  KN+
Sbjct: 242 LEAELHETVPDRLAAFRLLREWKNR 266


>gi|195495786|ref|XP_002095415.1| GE19704 [Drosophila yakuba]
 gi|194181516|gb|EDW95127.1| GE19704 [Drosophila yakuba]
          Length = 348

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 129/251 (51%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLVKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++  +   DTF  G+  +K ++TP HT GHICYH       
Sbjct: 159 WEKELDVYG---GDDRIGALNKRVQQDDTFTIGALNVKCLSTPCHTTGHICYHVTTPEGS 215

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 216 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 276 VEPDNELIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           + T  ++RK +
Sbjct: 333 IVTMGKLRKEK 343


>gi|195495777|ref|XP_002095411.1| GE19707 [Drosophila yakuba]
 gi|194181512|gb|EDW95123.1| GE19707 [Drosophila yakuba]
          Length = 348

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 129/251 (51%), Gaps = 14/251 (5%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH DH   N  L K 
Sbjct: 99  QDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLVKL 158

Query: 72  FN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN---- 125
           +     ++G      +I  ++  +   DTF  G+  +K ++TP HT GHICYH       
Sbjct: 159 WEKELDVYG---GDDRIGALNKRVQQDDTFTIGALNVKCLSTPCHTTGHICYHVTGPEGS 215

Query: 126 -DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 216 GEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGHEYTLQNMSFARH 275

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+      +   
Sbjct: 276 VEPDNELIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH---AGGATDP 332

Query: 244 VFTELRIRKNQ 254
           + T  ++RK +
Sbjct: 333 IVTMGKLRKEK 343


>gi|167582319|ref|ZP_02375193.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis TXDOH]
          Length = 268

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 140/265 (52%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + ++ +  A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDGRHAV--AVDPGEAAPVRRHLDARGWRLTAILLTHHHGDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  + H ++ G+    GS  ++  +I  PGHT GHI
Sbjct: 65  AELLATAREGEPLAVFGPAHEA--IEHLTHRVTGGERVRIGSPALEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+R  
Sbjct: 182 TLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSIRAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  +        LA FT +R  KN+
Sbjct: 242 LEAQLHEAAPDRLAAFTLMREWKNR 266


>gi|163914993|ref|NP_001106490.1| paroxysmal nonkinesigenic dyskinesia [Xenopus (Silurana)
           tropicalis]
 gi|159155173|gb|AAI54687.1| pnkd protein [Xenopus (Silurana) tropicalis]
          Length = 312

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 125/261 (47%), Gaps = 15/261 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI +    L A +D  D   +   L  +G  L  I  TH H DH+  N
Sbjct: 49  VPIPVLSDNYSYLIIDTASSLAAVVDPSDPLTVQAYLEREGVTLEAILCTHKHWDHSGGN 108

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
             LK+ + +C ++G       IP + H LSD +    G    +   TPGHT+GH+ Y   
Sbjct: 109 KALKRLYKSCRVYG--SSYDDIPELTHALSDREQLSVGRLQFQAYFTPGHTVGHMIYVLD 166

Query: 124 --MNDHFLCV--GDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
               D   C+  GD LF  GCGR+FE S   M  SL+   S +D T ++ GHEY  +N  
Sbjct: 167 GKSGDGPDCLFSGDLLFLAGCGRMFEGSAETMLASLDTAASLNDSTLLWPGHEYAADNLT 226

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA   +P N    K C  V   R +   T PSTI  EK+ NPFLR     L + L+++  
Sbjct: 227 FAAVVEPENSVRDKKCQWVLHRRLEKKSTCPSTIGEEKEYNPFLRTHCRDLHQALDLQRG 286

Query: 240 SN-------LAVFTELRIRKN 253
           +N         V  E+R RK+
Sbjct: 287 ANEDWNHFRARVLEEVRKRKD 307


>gi|325927447|ref|ZP_08188694.1| hydroxyacylglutathione hydrolase [Xanthomonas perforans 91-118]
 gi|325542197|gb|EGD13692.1| hydroxyacylglutathione hydrolase [Xanthomonas perforans 91-118]
          Length = 255

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 128/254 (50%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQHQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ ++ N  +FGP +E  +IP   H +  G+         +++  PGHT  HI   F+
Sbjct: 63  AELQQRWPNLALFGPADE--RIPAHAHQVGQGERLRLLDVEFQVLQVPGHTRSHIA--FV 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            D +L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  
Sbjct: 119 ADGYLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA- 243
           DP N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +    A  L+ 
Sbjct: 179 DPTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTGRPEIRAAVAPRAAGELSS 238

Query: 244 ---VFTELRIRKNQ 254
              VF ELR  K++
Sbjct: 239 EVDVFAELRRWKDE 252


>gi|326403972|ref|YP_004284054.1| hydroxyacylglutathione hydrolase [Acidiphilium multivorum AIU301]
 gi|325050834|dbj|BAJ81172.1| hydroxyacylglutathione hydrolase [Acidiphilium multivorum AIU301]
          Length = 243

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 104/183 (56%), Gaps = 1/183 (0%)

Query: 46  GWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP 105
           G  L  +  THHH DH    ++L   F   I G   +++++P +D  L+ G T D G   
Sbjct: 49  GGRLDWVLLTHHHDDHIAGAVDLAARFGARIAGNAADAARLPKLDAALAPGQTIDLGGEA 108

Query: 106 IKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
           +++IATPGHT+GH+ Y F +    C GDTLFSLGCGR+FE + A+   SL+ + +   +T
Sbjct: 109 VRMIATPGHTVGHVTYLFGDAAAAC-GDTLFSLGCGRMFEGTPAQFHASLQALAALDPET 167

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            +  GHEYT +NA FA   DP N  L    ++V+ +R+    T P  ++ E   NPFLR 
Sbjct: 168 LMLCGHEYTLSNARFARHVDPDNAALAARAAEVERLRAAGAPTLPVRLADELAANPFLRA 227

Query: 226 ENT 228
            + 
Sbjct: 228 ASA 230


>gi|171318241|ref|ZP_02907404.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MEX-5]
 gi|171096585|gb|EDT41479.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MEX-5]
          Length = 283

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 139/280 (49%), Gaps = 36/280 (12%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + +  +  A+D  +   + ++L E+GW LT I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGRDAI--AVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGV 64

Query: 66  LNLKKF----FNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHI 119
             L+          ++GP  E+  +  +   L+ GD  T D  +    ++  PGHT GHI
Sbjct: 65  AALRDGQPDDAPLGVYGPAAEAIGV--VTRPLAGGDRVTLDAPALAFDVLDVPGHTRGHI 122

Query: 120 CY---------------------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKI 158
            Y                          H  C GDTLFS GCGR+FE + A+M  SL+ +
Sbjct: 123 AYFQAAGAGAAGVGAAGAAKAGQGAATPHVFC-GDTLFSCGCGRLFEGTPAQMLASLDAL 181

Query: 159 KSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKK 218
            +    T ++  HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ 
Sbjct: 182 AALPGDTRVHCAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERA 241

Query: 219 VNPFLRIENTSLRKNLNME----NASNLAVFTELRIRKNQ 254
           VNPF+R ++T++   L  E        LA FT +R  KN+
Sbjct: 242 VNPFMRADSTAIHATLEAELHERVPDRLAAFTLMREWKNR 281


>gi|114327117|ref|YP_744274.1| hydroxyacylglutathione hydrolase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315291|gb|ABI61351.1| hydroxyacylglutathione hydrolase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 242

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/221 (40%), Positives = 121/221 (54%), Gaps = 1/221 (0%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+ + +  L A ID  +     + LR+ G  L  I  THHH DH  A   
Sbjct: 8   VPMRTDNYAWLVSDTESDLRAIIDPCEEQPALEALRQSGGHLALILLTHHHDDHIAAAAA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGS-HPIKIIATPGHTIGHICYHFMND 126
           L++     I G   ++ ++P +DH L +GD   FG+    ++I TPGHT GHI Y     
Sbjct: 68  LRERTGALIAGAAADADRLPRLDHALHEGDRLPFGTLAEFQVINTPGHTRGHISYFMPQG 127

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            FL  GDTLFSLGCGR+FE +  +MF+SL KI +    T I  GHEYT  NA FAL  DP
Sbjct: 128 PFLFCGDTLFSLGCGRLFEGTPEDMFKSLRKIATLPADTLIACGHEYTSANARFALHVDP 187

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN 227
            N  LQ+  + V  MR+    + P T++ E   NPFLR  N
Sbjct: 188 DNAVLQRRTADVTRMRASGQPSLPVTLAQELATNPFLRASN 228


>gi|158430160|pdb|2QED|A Chain A, Crystal Structure Of Salmonella Thyphimurium Lt2
           Glyoxalase Ii
          Length = 258

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 136/255 (53%), Gaps = 9/255 (3%)

Query: 3   SLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S+N+ +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH
Sbjct: 7   SMNLNSIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDH 65

Query: 62  TRANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
                 L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+C
Sbjct: 66  VGGVKELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVC 123

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y F   +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  F
Sbjct: 124 Y-FSRPYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKF 181

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-- 238
           ALS  PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E   
Sbjct: 182 ALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETIL 241

Query: 239 ASNLAVFTELRIRKN 253
               A F  LR +K+
Sbjct: 242 QQPEARFAWLRSKKD 256


>gi|168819167|ref|ZP_02831167.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344171|gb|EDZ30935.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320084510|emb|CBY94302.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 251

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 134/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP+E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPVETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|195172241|ref|XP_002026907.1| GL12815 [Drosophila persimilis]
 gi|194112675|gb|EDW34718.1| GL12815 [Drosophila persimilis]
          Length = 305

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 134/263 (50%), Gaps = 15/263 (5%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E    L+ +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAVVDPVDPELVIKTVQEANVTLSKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           DH   N  L K +     ++G      +I  ++  +   D+F  GS  ++ ++TP HT G
Sbjct: 104 DHAGGNEKLVKLWEKELEVYGG---DDRIGALNKMVRQDDSFTIGSLNVRCLSTPCHTTG 160

Query: 118 HICYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGH 171
           HICYH        +  +  GDTLF  GCGR FE +  EM+++L  K+ +  D T ++ GH
Sbjct: 161 HICYHVTAGDGKGEGAVFTGDTLFQGGCGRFFEGTPEEMYDALCTKLSALPDTTKVFCGH 220

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++
Sbjct: 221 EYTLQNMSFARHVEPDNESIQQRIEWAKLRRASQDPTVPSTIGEEKIWNPFMRVHEASVQ 280

Query: 232 KNLNMENASNLAVFTELRIRKNQ 254
           K+      +   + T  ++RK +
Sbjct: 281 KHA---GGATDPIVTMGKLRKEK 300


>gi|42523665|ref|NP_969045.1| hydroxyacylglutathione hydrolase GloB [Bdellovibrio bacteriovorus
           HD100]
 gi|81617111|sp|Q6ML19|GLO2_BDEBA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|39575872|emb|CAE80038.1| hydroxyacylglutathione hydrolase GloB [Bdellovibrio bacteriovorus
           HD100]
          Length = 251

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 118/226 (52%), Gaps = 12/226 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + ++ DN+  ++ +   +   A+D  D   +   LR     L  I  THHH DH      
Sbjct: 10  VPIFDDNYVFILTDDATQKAVAVDPGDAGPVIDFLRANKLDLAAILLTHHHSDHIGGVGE 69

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  F+C ++ P +   +IP  D  L +GD+   G     ++  PGHT+GHI Y      
Sbjct: 70  LKAAFDCPVYAPQKNQKQIPVADQWLKEGDSVTCGPWDFTVMELPGHTLGHIAYWNQKHK 129

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF------- 180
           +L  GD +F LGCGR+FE ++ + +ESL++IK    +T IY  HEYT++N  F       
Sbjct: 130 WLFSGDVIFGLGCGRLFEGTFEQGYESLQRIKKLPPQTLIYCTHEYTKSNLEFCRILTNQ 189

Query: 181 ---ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFL 223
               ++ D   LEL  Y +++ + R  NL + P  +S+E+ VNPFL
Sbjct: 190 DNTPITGDSEALEL--YANELSNRRELNLPSVPLKLSIEESVNPFL 233


>gi|261820456|ref|YP_003258562.1| hydroxyacylglutathione hydrolase [Pectobacterium wasabiae WPP163]
 gi|261604469|gb|ACX86955.1| hydroxyacylglutathione hydrolase [Pectobacterium wasabiae WPP163]
          Length = 251

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALKDNYIWLLSNKENR-CVIVDPGEATPVLNTLDQHSLFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L K + N  +FGP +E++K  G  + + +G+T    +    +I  PGHT+GHI Y+  
Sbjct: 63  SELLKHYPNLPVFGP-KETAKC-GATYLVEEGNTVSLLNSEFSVIEVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           N  FL  GDTLFS GCGRI E +  +M+ES++KI +F D T +   HEYT +N  F+ + 
Sbjct: 119 NAPFLFCGDTLFSAGCGRILEGNPMQMYESIKKISNFPDDTVVCCAHEYTLSNLTFSNAM 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNL 242
            P +  ++ Y  K+  +R ++  + P+T+ LE+++N FLR     L++ L++  EN  N 
Sbjct: 179 WPEDPNIEAYLHKISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKLSIEPENIENW 238

Query: 243 AVFTELRIRKN 253
            VF  LR +K+
Sbjct: 239 QVFKLLRSKKD 249


>gi|293408301|ref|ZP_06652140.1| hydroxyacylglutathione hydrolase [Escherichia coli B354]
 gi|291471479|gb|EFF13962.1| hydroxyacylglutathione hydrolase [Escherichia coli B354]
          Length = 251

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 129/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE++ ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEETPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|195019128|ref|XP_001984915.1| GH16754 [Drosophila grimshawi]
 gi|193898397|gb|EDV97263.1| GH16754 [Drosophila grimshawi]
          Length = 303

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 127/244 (52%), Gaps = 10/244 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E+   L  +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAIVDPVDPELVIKTVQEENVKLNKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           DH   N  L K ++    ++G      +I  ++  +S   TF+ G   ++ ++TP HT G
Sbjct: 104 DHAGGNEKLVKLWSGELQVYGG---DDRIGAMNQKVSQDVTFNIGELKVRCLSTPCHTTG 160

Query: 118 HICYHFMNDH---FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEY 173
           HICYH  N      +  GDTLF  GCGR FE +  EM+++L  K+ +  D T ++ GHEY
Sbjct: 161 HICYHVTNGQNAGAVFTGDTLFQGGCGRFFEGTPEEMYDALCAKLSALPDDTKVFCGHEY 220

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+   +++++
Sbjct: 221 TLQNMSFARHVEPDNKLIQNRIEWAKLRRASKDPTVPSTIGEEKSWNPFMRVHEATVQRH 280

Query: 234 LNME 237
              E
Sbjct: 281 AGGE 284


>gi|170767803|ref|ZP_02902256.1| hydroxyacylglutathione hydrolase [Escherichia albertii TW07627]
 gi|170123291|gb|EDS92222.1| hydroxyacylglutathione hydrolase [Escherichia albertii TW07627]
          Length = 251

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N   R    +D  D   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLTNEAGR-CLIVDPGDAEPVLKAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  KLVEKFPQIVVYGPQETQDK--GTTLVVKDGETALVLGHEFSVIATPGHTLGHICY-FTK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQMTLPVILKNERQINVFLRTEDIDLINVINKE 231


>gi|332162779|ref|YP_004299356.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318606885|emb|CBY28383.1| hydroxyacylglutathione hydrolase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667009|gb|ADZ43653.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863687|emb|CBX73791.1| hydroxyacylglutathione hydrolase [Yersinia enterocolitica W22703]
          Length = 251

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 142/252 (56%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +  +L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADEQ-KHCVIVDPGESAPVLAVLSQGQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L + F    ++GP E ++K  G    ++ GD    G    ++IA PGHT+GHI Y+  
Sbjct: 63  ADLHRHFPEIPVYGPQETANK--GATIIVNGGDHLSIGGQNYQVIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA   
Sbjct: 119 SKPYLFCGDTLFSAGCGRLFEGTPAQMYASIQQLAQLPDETLICSAHEYTLANLKFARFI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  ++  +R++N  + P  + +E+K+N FLR ++  L++ + + +  +  +
Sbjct: 179 LPSDQDIATYQQQIMQLRAKNQPSLPVKLQIERKINVFLRCDDIDLQRKIGVMSPPDSLV 238

Query: 243 AVFTELRIRKNQ 254
           +VF+ELR +K++
Sbjct: 239 SVFSELRAQKDR 250


>gi|256020178|ref|ZP_05434043.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
 gi|293418306|ref|ZP_06660741.1| hydroxyacylglutathione hydrolase [Escherichia coli B088]
 gi|300819826|ref|ZP_07100012.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 107-1]
 gi|307314698|ref|ZP_07594296.1| hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|332281341|ref|ZP_08393754.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
 gi|291324834|gb|EFE64249.1| hydroxyacylglutathione hydrolase [Escherichia coli B088]
 gi|300527584|gb|EFK48646.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 107-1]
 gi|306905817|gb|EFN36342.1| hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|315059425|gb|ADT73752.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|323380016|gb|ADX52284.1| hydroxyacylglutathione hydrolase [Escherichia coli KO11]
 gi|323945580|gb|EGB41630.1| hydroxyacylglutathione hydrolase [Escherichia coli H120]
 gi|332103693|gb|EGJ07039.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
          Length = 251

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 129/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLKAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPPETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|167836208|ref|ZP_02463091.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis
           MSMB43]
          Length = 268

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 137/265 (51%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDG--RQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHRDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  I   ++ G+    GS  ++  +I  PGHT GHI
Sbjct: 65  AELLATAREGEPLAVFGPAHEA--IEHITRRVTGGERVRIGSPALEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+R  
Sbjct: 182 TLSNIQFALACEPENAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSIRAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  +        LA FT +R  KN+
Sbjct: 242 LETQLHEAAPDRLAAFTLMREWKNR 266


>gi|83720134|ref|YP_443300.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
 gi|167620416|ref|ZP_02389047.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis Bt4]
 gi|83653959|gb|ABC38022.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
          Length = 268

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 141/265 (53%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + ++ +  A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDGRHAV--AVDPGEAAPVRRHLDARGWRLTAILLTHHHGDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  + H ++ G+    GS   +  +I  PGHT GHI
Sbjct: 65  AELLATAREGEPLAVFGPAHEA--IEHLTHRVTGGERVRIGSPAFEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+R  
Sbjct: 182 TLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSIRAT 241

Query: 234 LNM---ENASN-LAVFTELRIRKNQ 254
           L     E A + LA FT +R  KN+
Sbjct: 242 LEAQLHEGAPDRLAAFTLMREWKNR 266


>gi|222111167|ref|YP_002553431.1| hydroxyacylglutathione hydrolase [Acidovorax ebreus TPSY]
 gi|221730611|gb|ACM33431.1| hydroxyacylglutathione hydrolase [Acidovorax ebreus TPSY]
          Length = 259

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 129/257 (50%), Gaps = 12/257 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++++ +  +   +D  D   + + LR  G  L  I  THHH DH    
Sbjct: 5   LPLPAFADNYIWMLYDAQRAVV--VDPGDAEPVLQALRSMGLPLEAILVTHHHGDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             L++    T++GP  E    P I   LS GDT         ++  PGHT GHI Y+   
Sbjct: 63  NALREATGATVYGPATEPMPEPLIR--LSGGDTLQVLGLTFSVLDVPGHTAGHIAYYCAD 120

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLFS GCGR+FE +  +M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 121 MEGEPLLLCGDTLFSGGCGRLFEGTPTQMQASLDTLAALPGNTRVCCAHEYTLSNLKFAR 180

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-----ME 237
           + +PHN  L +Y ++ +S R  +  T PS I++E+ +NPFLR    ++ +  +     ++
Sbjct: 181 AVEPHNAALLQYITECESRRRADQPTLPSRIAIERDINPFLRTRVATVAQAAHGFDALID 240

Query: 238 NASNLAVFTELRIRKNQ 254
                AV   LR  KN+
Sbjct: 241 PREPAAVLAALRQWKNE 257


>gi|16763644|ref|NP_459259.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167995090|ref|ZP_02576180.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|197264377|ref|ZP_03164451.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|81523908|sp|Q8ZRM2|GLO2_SALTY RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|16418761|gb|AAL19218.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|197242632|gb|EDY25252.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205327156|gb|EDZ13920.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261245486|emb|CBG23276.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267991948|gb|ACY86833.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301156882|emb|CBW16358.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911226|dbj|BAJ35200.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224915|gb|EFX49976.1| Hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323128576|gb|ADX16006.1| putative periplasmic fimbrial chaperone [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332987207|gb|AEF06190.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 251

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 132/250 (52%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F  
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSR 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|261340922|ref|ZP_05968780.1| hydroxyacylglutathione hydrolase [Enterobacter cancerogenus ATCC
           35316]
 gi|288316779|gb|EFC55717.1| hydroxyacylglutathione hydrolase [Enterobacter cancerogenus ATCC
           35316]
          Length = 252

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 133/253 (52%), Gaps = 12/253 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRA- 64
           I+I  + DN+  +I +   R    +D  +   I + + +  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVIVDDARRCII-VDPGEAAPILQAINDNNWQPEAILLTHHHNDHVGGV 62

Query: 65  NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L +F +  ++GP E   K  G+   + +G+          + ATPGHT GHIC  F 
Sbjct: 63  PALLAQFPDLAVYGPAETRDK--GVTQVVDEGEKVIILGLAFSVFATPGHTSGHIC--FY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE + A+M++SL+KI +  D T I   HEYT  N  FA S 
Sbjct: 119 SAPYLFCGDTLFSGGCGRLFEGTPAQMYQSLQKINALPDDTVICCAHEYTLGNMKFAASI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL-- 242
            P++  +Q Y  KVK +R++N  T P  +  E+++N FLR  +  L   ++ E  +NL  
Sbjct: 179 LPYDRAIQDYYQKVKELRAKNQKTLPVILKKEREINLFLRTNDVDLINEISQE--TNLQH 236

Query: 243 --AVFTELRIRKN 253
             A F  LR +K+
Sbjct: 237 PEARFAWLRSKKD 249


>gi|257139536|ref|ZP_05587798.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
          Length = 268

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 141/265 (53%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ + ++ +  A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDGRHAV--AVDPGEAAPVRRHLDARGWRLTAILLTHHHGDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  + H ++ G+    GS   +  +I  PGHT GHI
Sbjct: 65  AELLATAREGEPLAVFGPAHEA--IEHLTHRVTGGERVRIGSPAFEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+R  
Sbjct: 182 TLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSIRAT 241

Query: 234 LNM---ENASN-LAVFTELRIRKNQ 254
           L     E A + LA FT +R  KN+
Sbjct: 242 LEAHLHEGAPDRLAAFTLMREWKNR 266


>gi|167562349|ref|ZP_02355265.1| hydroxyacylglutathione hydrolase [Burkholderia oklahomensis EO147]
 gi|167574353|ref|ZP_02367227.1| hydroxyacylglutathione hydrolase [Burkholderia oklahomensis C6786]
          Length = 273

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 137/270 (50%), Gaps = 26/270 (9%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +    +  A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDGSDAV--AVDPGEAAPVRRYLDARGWRLTAILLTHHHGDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    +   +  +FGP  E+  I  +   L+ G+    GS  ++  +I  PGHT GHI
Sbjct: 65  AELLATSRGGESVAVFGPAHEA--IEHVTRRLAGGERVRIGSPALEFDVIDVPGHTRGHI 122

Query: 120 CY-----------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
            Y                H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++
Sbjct: 123 AYFQAAGAGPAGPANAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVH 181

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L  +  +  + R++N  T P+TI+ E+ VNPFLR ++ 
Sbjct: 182 CAHEYTLSNIKFALACEPDNAALAAWRDEASARRARNEPTLPTTIAHERAVNPFLRADSP 241

Query: 229 SLRKNLNME----NASNLAVFTELRIRKNQ 254
           S+R  L  +        LA FT +R  KN+
Sbjct: 242 SIRATLETQLHEAAPDRLAAFTLMREWKNR 271


>gi|123441270|ref|YP_001005257.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|160395514|sp|A1JKA9|GLO2_YERE8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|122088231|emb|CAL11020.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 251

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 141/252 (55%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADEQ-KHCVIVDPGESAPVLAALSQGQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L++ F    ++GP E ++K  G    ++ GD    G    ++IA PGHT+ HI Y+  
Sbjct: 63  ADLRRHFPEIPVYGPQETANK--GATIMVTGGDHLSIGGQNYQVIAVPGHTLEHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA   
Sbjct: 119 SKPYLFCGDTLFSAGCGRLFEGTPAQMYASIQQLAQLPDETLICSAHEYTLANLKFARFI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  ++  +R++N  + P  + +E+K+N FLR ++  L++ + + +  N  +
Sbjct: 179 LPSDQDIATYQQQIMQLRAKNQPSLPVKLQIERKINVFLRCDDIDLQRKIGVISPPNSLV 238

Query: 243 AVFTELRIRKNQ 254
           +VF+ELR +K++
Sbjct: 239 SVFSELRAQKDR 250


>gi|198244534|ref|YP_002214217.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|207855773|ref|YP_002242424.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|226724014|sp|B5FJ56|GLO2_SALDC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724015|sp|B5R447|GLO2_SALEP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|197939050|gb|ACH76383.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|206707576|emb|CAR31850.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|322614541|gb|EFY11470.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620059|gb|EFY16931.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623354|gb|EFY20193.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629348|gb|EFY26127.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632068|gb|EFY28822.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637194|gb|EFY33896.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640307|gb|EFY36967.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322645926|gb|EFY42446.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652375|gb|EFY48729.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652579|gb|EFY48929.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660389|gb|EFY56625.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664542|gb|EFY60735.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669405|gb|EFY65555.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670951|gb|EFY67084.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678810|gb|EFY74865.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681839|gb|EFY77864.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687965|gb|EFY83931.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323194319|gb|EFZ79514.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323197735|gb|EFZ82867.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203469|gb|EFZ88494.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206786|gb|EFZ91739.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323213395|gb|EFZ98196.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214688|gb|EFZ99439.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221459|gb|EGA05875.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226223|gb|EGA10439.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229989|gb|EGA14109.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233728|gb|EGA17817.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238578|gb|EGA22636.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244266|gb|EGA28275.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323252190|gb|EGA36043.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258049|gb|EGA41728.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259853|gb|EGA43484.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323265132|gb|EGA48631.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323272695|gb|EGA56102.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326621961|gb|EGE28306.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 251

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|156403564|ref|XP_001639978.1| predicted protein [Nematostella vectensis]
 gi|156227110|gb|EDO47915.1| predicted protein [Nematostella vectensis]
          Length = 256

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 129/247 (52%), Gaps = 11/247 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ + K +  A +D  +   +   ++E+G  LT +  THHH DH   N  L K  
Sbjct: 11  DNYMYLLVDPKTKEAAVVDPVEPEKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEGLVKLV 70

Query: 73  N-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH---- 127
           +  T++G  E   +I  +   +S  + F  GS  +K + TP HT GHIC+H   D     
Sbjct: 71  SGLTVYGGDE---RIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDAGKPT 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +  GDTLFS GCGR FE S  EM+ +L E + S  + T ++ GHEYT NN  +AL  +P
Sbjct: 128 AVFTGDTLFSGGCGRFFEGSPPEMYSALIEVLGSLPENTRVFCGHEYTVNNLKYALHVEP 187

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  +Q+  +  K  R+ N  T PSTI  E   NPF+R+   S++K+        + V  
Sbjct: 188 DNKAVQQRMAWAKEKRAHNEPTIPSTIGEEFSFNPFMRVREPSVQKHTG--ETDPVKVMG 245

Query: 247 ELRIRKN 253
            LR  K+
Sbjct: 246 VLRKEKD 252


>gi|62178827|ref|YP_215244.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615578|ref|YP_001589543.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167554225|ref|ZP_02347966.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168232192|ref|ZP_02657250.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168238650|ref|ZP_02663708.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168239995|ref|ZP_02664927.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261341|ref|ZP_02683314.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194444358|ref|YP_002039495.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448453|ref|YP_002044245.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469856|ref|ZP_03075840.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736047|ref|YP_002113278.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197248280|ref|YP_002145261.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|200389578|ref|ZP_03216189.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204926694|ref|ZP_03217896.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|238913719|ref|ZP_04657556.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|75484769|sp|Q57SZ8|GLO2_SALCH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|189041227|sp|A9MZ21|GLO2_SALPB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724013|sp|B5F8X0|GLO2_SALA4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724017|sp|B4TK83|GLO2_SALHS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724018|sp|B4SV37|GLO2_SALNS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724020|sp|B4TYG8|GLO2_SALSV RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|62126460|gb|AAX64163.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161364942|gb|ABX68710.1| hypothetical protein SPAB_03353 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403021|gb|ACF63243.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406757|gb|ACF66976.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194456220|gb|EDX45059.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194711549|gb|ACF90770.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197211983|gb|ACH49380.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197288601|gb|EDY27978.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|199602023|gb|EDZ00569.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204323359|gb|EDZ08554.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205321516|gb|EDZ09355.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205333378|gb|EDZ20142.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205339972|gb|EDZ26736.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349780|gb|EDZ36411.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|322713278|gb|EFZ04849.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 251

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|296158204|ref|ZP_06841036.1| hydroxyacylglutathione hydrolase [Burkholderia sp. Ch1-1]
 gi|295891540|gb|EFG71326.1| hydroxyacylglutathione hydrolase [Burkholderia sp. Ch1-1]
          Length = 263

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 137/260 (52%), Gaps = 16/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +    +   +D  +   +   L ++GW L+ I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWVVSDGHSAVV--VDPGEAAPVQAYLAKRGWRLSAILLTHHHQDHVGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
            +L       ++GP  E+  I  + H L +GD     +  ++  ++  PGHT GHI Y  
Sbjct: 65  ADLLNGQAVPVYGPAGEA--IEHLTHRLKNGDHVSIVAPALELSVLDVPGHTSGHIAYFQ 122

Query: 124 MND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             D     H  C GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT +N 
Sbjct: 123 AADPRGTPHVFC-GDTLFACGCGRLFEGTPKQMLASLDALAALPGATEVHCAHEYTLSNI 181

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            FAL+C+P N ELQ +  K   +R++ + T P+TI+ E+ VNPFLR  N     +L++ L
Sbjct: 182 RFALACEPANAELQAWRDKAGELRARGVPTLPTTIAHERAVNPFLRAGNPAVQATLQEQL 241

Query: 235 NMENASNLAVFTELRIRKNQ 254
           + +    L  FT +R  KN+
Sbjct: 242 HEKVPDRLTAFTLMREWKNR 261


>gi|77360891|ref|YP_340466.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123588755|sp|Q3IIR9|GLO2_PSEHT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|76875802|emb|CAI87023.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 257

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 112/219 (51%), Gaps = 5/219 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D      +   L +    L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTSNNTQAWVVDPGQAEPVLDYLAQHNLTLAGILITHHHYDHTDGVA 65

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L  +  N  ++GP   +S   GI   L+DG +    +    IIATPGHT+ HICY  +N
Sbjct: 66  KLVSENPNIAVYGP--TNSPFKGITQQLTDGQSITVLNTAFNIIATPGHTLDHICY--VN 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +     GDTLFS GCGR+FE S  +M+ S  K++       +Y  HEYT+ N  FA + +
Sbjct: 122 EQLAFTGDTLFSGGCGRLFEGSAEQMWHSFNKLRELPADCKVYCTHEYTQANLAFATAIE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           P N EL  Y  +V  +RS+N  T PSTI  E K+NPF+R
Sbjct: 182 PRNPELLAYSKRVDELRSKNEITLPSTIGQELKINPFMR 220


>gi|170681858|ref|YP_001742335.1| hydroxyacylglutathione hydrolase [Escherichia coli SMS-3-5]
 gi|218698841|ref|YP_002406470.1| hydroxyacylglutathione hydrolase [Escherichia coli IAI39]
 gi|226723990|sp|B7NKW6|GLO2_ECO7I RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723995|sp|B1LHM1|GLO2_ECOSM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|170519576|gb|ACB17754.1| hydroxyacylglutathione hydrolase [Escherichia coli SMS-3-5]
 gi|218368827|emb|CAR16575.1| putative hydroxyacylglutathione hydrolase [Escherichia coli IAI39]
          Length = 251

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|89094530|ref|ZP_01167469.1| Metallo-beta-lactamase superfamily protein [Oceanospirillum sp.
           MED92]
 gi|89081266|gb|EAR60499.1| Metallo-beta-lactamase superfamily protein [Oceanospirillum sp.
           MED92]
          Length = 257

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 125/253 (49%), Gaps = 9/253 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  +I +    + A +D  D   +   L E    LT I  THHH DHT     
Sbjct: 7   IPAFSDNYIWVIASPDSNMVAVVDPGDEAPVLAYLEENNLQLTAILITHHHNDHTGGVEA 66

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--N 125
           LK  F   ++GP   +S   GI H L+DGD+       + I A PGHT+ HI Y+     
Sbjct: 67  LKDRFKTPVYGP--ANSPFQGITHPLNDGDSIQLMGASVAIKAIPGHTLDHISYYSERHK 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
               C GDTLF  GCGR+FE +  +M  ++    S  D T +Y  HEY+  N  FA + +
Sbjct: 125 PQLFC-GDTLFLAGCGRLFEGTAKQMLNAMNYFASLPDDTEVYCTHEYSMANLSFAEAVE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS-LRKNLNMENAS---N 241
           P+N  ++    +    R Q+  T P++I+ EK +NPF+R ++   +   L    AS    
Sbjct: 184 PNNDAIKNAIRRCAEQREQDQPTLPTSIAEEKLINPFMRTQHEDVVSAALGFSRASLSNE 243

Query: 242 LAVFTELRIRKNQ 254
           + VF  +R  KNQ
Sbjct: 244 VEVFASIREWKNQ 256


>gi|56414619|ref|YP_151694.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363547|ref|YP_002143184.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|81360075|sp|Q5PFD6|GLO2_SALPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724019|sp|B5BDW7|GLO2_SALPK RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|56128876|gb|AAV78382.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095024|emb|CAR60570.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 251

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVDDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|271501674|ref|YP_003334700.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech586]
 gi|270345229|gb|ACZ77994.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech586]
          Length = 251

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 130/252 (51%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  + DN+  L+ N +      +D  D   + + L   G     I  THHH DHT   
Sbjct: 4   ISVPAFKDNYIWLLANDEND-CVIVDPGDAAPVLQALEHHGLSPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L   + +  I+GP E  +K  G+ H + +GD          I   PGHT GHI Y+  
Sbjct: 63  EQLAAHYPDIQIYGPQE--TKRCGVTHTVQEGDKITVAGSEFSIFFVPGHTAGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGRIFE +  +MFESL K+    D+T +   HEYT +N  FA   
Sbjct: 119 SHPYLFCGDTLFSAGCGRIFEGTAQQMFESLIKLADLPDETQVCCAHEYTLSNLAFAHHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNL 242
            P ++++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L  N +   + 
Sbjct: 179 WPEDVDIYDYLVKIRQLREKGESSLPSTLGRERRINIFLRYHDIDLKRKLSINSDTQGDW 238

Query: 243 AVFTELRIRKNQ 254
            +F  LR  K+Q
Sbjct: 239 QIFAHLRALKDQ 250


>gi|293392718|ref|ZP_06637037.1| hydroxyacylglutathione hydrolase [Serratia odorifera DSM 4582]
 gi|291424835|gb|EFE98045.1| hydroxyacylglutathione hydrolase [Serratia odorifera DSM 4582]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 136/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  ++ + +   T  +D  +   +   LR+       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWILDDQQGHCTI-VDPGEAQPVLDALRKLELTPDAILLTHHHHDHIGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L ++    ++GP E ++K  G    + DGD         ++IA PGHT+GH+   F 
Sbjct: 63  AQILAQYPALPVYGPHETANK--GATTLVEDGDIITVSGRKYRVIAVPGHTLGHVA--FY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE +  +M+ S +++    D T I   HEYT +N  FA + 
Sbjct: 119 SAPYLFCGDTLFSAGCGRLFEGTAEQMYYSFQQLSQLPDNTIICCAHEYTVSNLKFARAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + +++ Y  +V ++R++N  + P+T+ LE+++N FLR  +T L+K L  +       
Sbjct: 179 LPQDRQIETYQQQVMALRAKNQPSVPTTLQLEREINLFLRCHDTDLQKKLGFDRPPEHLH 238

Query: 243 AVFTELRIRKN 253
           +VF+ELR+RK+
Sbjct: 239 SVFSELRLRKD 249


>gi|205351592|ref|YP_002225393.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|226724016|sp|B5R5L1|GLO2_SALG2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|205271373|emb|CAR36166.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326626620|gb|EGE32963.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETKDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|299066484|emb|CBJ37672.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum CMR15]
          Length = 275

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 130/267 (48%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLVLGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK---IIATPGHTI 116
            L + +          + GP +ES  IP     + +GDT    SHP     ++  PGHT 
Sbjct: 70  ALVEAYPRDPSGAPLPVIGPADES--IPCRTQAVREGDTVIL-SHPAATFHVLDVPGHTR 126

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 127 GHVAYVGRLQGPGAPASLFC-GDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCA 185

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN--- 227
           HEYT +N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R      
Sbjct: 186 HEYTASNVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSNEPAV 245

Query: 228 -TSLRKNLNMENASNLAVFTELRIRKN 253
             S+ ++  +     +AVF  LR  KN
Sbjct: 246 AASVARHAGIGADDPVAVFAALREWKN 272


>gi|218688082|ref|YP_002396294.1| hydroxyacylglutathione hydrolase [Escherichia coli ED1a]
 gi|254798845|sp|B7MQ21|GLO2_ECO81 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218425646|emb|CAR06433.1| putative hydroxyacylglutathione hydrolase [Escherichia coli ED1a]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR EN  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTENIDLINVINEE 231


>gi|312960546|ref|ZP_07775052.1| Hydroxyacylglutathione hydrolase [Pseudomonas fluorescens WH6]
 gi|311285072|gb|EFQ63647.1| Hydroxyacylglutathione hydrolase [Pseudomonas fluorescens WH6]
          Length = 255

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 131/253 (51%), Gaps = 9/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-KGWFLTHIFNTHHHIDHTRAN 65
           A+  + DN+  L+ + K    A +D  D   +   L +  GW L+ I  THHH DH    
Sbjct: 6   ALPAFTDNYIWLLQDPKTHRCAVVDPGDAAPVQAWLEQNPGWTLSDILVTHHHHDHVGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK      ++GP  E  KIP  D  L D D          + + PGHT+GHI   F +
Sbjct: 66  EQLKNITGAKVYGPANE--KIPARDIALHDHDRITVLGWDFDVHSVPGHTLGHIA--FYH 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE +  +M  SL ++ +    T +Y  HEYT++N  FA + +
Sbjct: 122 PGVLFCGDTLFAAGCGRLFEGTPEQMHASLTRLAALPADTLVYCTHEYTQSNLKFAQAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SN 241
           PHN ++ +    V+ +R+++  T PS ++LE + NPFLR   TS+++  +  N     + 
Sbjct: 182 PHNADIAERMEAVRQLRARDEMTLPSDLALELRTNPFLRTAETSVKQKADERNGHDNRAG 241

Query: 242 LAVFTELRIRKNQ 254
             VF  LR  K++
Sbjct: 242 AEVFASLRAWKDK 254


>gi|168465314|ref|ZP_02699196.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195631914|gb|EDX50434.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL--A 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPDA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|332535812|ref|ZP_08411545.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332034790|gb|EGI71328.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 257

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 114/219 (52%), Gaps = 5/219 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D    + +   L E    L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTDNSNQAWVVDPGQAHPVLTYLAEHKLTLGGILITHHHYDHTDGVA 65

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L   + + +++GP   +S   G+ H L+DG +    +    I+ATPGHT+ HICY   N
Sbjct: 66  ELVDAYPDISVYGP--ANSPFKGVTHALTDGQSISVLNINFTILATPGHTLDHICY--TN 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D     GDTLFS GCGR+FE +  +M++S  K++       +Y  HEYT+ N  FA + +
Sbjct: 122 DELAFTGDTLFSGGCGRLFEGTPKQMWKSFNKLRELPASCSVYCTHEYTQANLAFAKAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           P N EL  Y  KV  +RS N  + P++I  E K+NPF+R
Sbjct: 182 PRNPELLAYSKKVDELRSNNQISLPTSIGQELKINPFMR 220


>gi|323975921|gb|EGB71016.1| hydroxyacylglutathione hydrolase [Escherichia coli TW10509]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRAEDIDLINVINEE 231


>gi|218547662|ref|YP_002381453.1| hydroxyacylglutathione hydrolase [Escherichia fergusonii ATCC
           35469]
 gi|331671741|ref|ZP_08372537.1| hydroxyacylglutathione hydrolase [Escherichia coli TA280]
 gi|226723997|sp|B7LW87|GLO2_ESCF3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218355203|emb|CAQ87810.1| putative hydroxyacylglutathione hydrolase [Escherichia fergusonii
           ATCC 35469]
 gi|331070730|gb|EGI42089.1| hydroxyacylglutathione hydrolase [Escherichia coli TA280]
          Length = 251

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|238794446|ref|ZP_04638056.1| Hydroxyacylglutathione hydrolase [Yersinia intermedia ATCC 29909]
 gi|238726241|gb|EEQ17785.1| Hydroxyacylglutathione hydrolase [Yersinia intermedia ATCC 29909]
          Length = 251

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 141/252 (55%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   + +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANPQ-KHCVIVDPGESAPVLAAVAQGQYIPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L++ F +  ++GP E ++K  G    ++ GD    G     IIA PGHT+GHI Y+  
Sbjct: 63  AELRRHFPDIPVYGPQETANK--GATVIVNGGDHLTIGGQNYTIIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++ +L  GDTLFS GCGR+FE +  +M+ S++++    D+T I   HEYT  N  FA   
Sbjct: 119 SEPYLFCGDTLFSAGCGRLFEGTPEQMYASIQRLALLPDETLICSAHEYTLANLKFARFI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-MENASNLA 243
            P + ++ +Y  ++  +R++NL + P  +  E+K+N FLR  +  L++ +  +   S+LA
Sbjct: 179 LPADEDIARYQQQIMQLRAKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGVISPPSSLA 238

Query: 244 -VFTELRIRKNQ 254
            VF+ELR +K++
Sbjct: 239 SVFSELRAQKDR 250


>gi|269140169|ref|YP_003296870.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda EIB202]
 gi|267985830|gb|ACY85659.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda EIB202]
 gi|304560002|gb|ADM42666.1| Hydroxyacylglutathione hydrolase [Edwardsiella tarda FL6-60]
          Length = 251

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 133/255 (52%), Gaps = 16/255 (6%)

Query: 6   IAISLYHDNFCILIHNHKYR---LTAAIDAPDT-YIISKMLREKGWFLTHIFNTHHHIDH 61
           I +    DN+  L+ N +++   +   + AP   Y+    +  K   LTH     HH DH
Sbjct: 4   IGLPALQDNYIWLLINPQHQCLIVDPGVAAPVLHYLTENRITPKAILLTH-----HHNDH 58

Query: 62  TRANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
                 + + +    ++GP E      G    ++DGDTF      I ++A PGHT+GH+ 
Sbjct: 59  IGGVAEIVQAYPELPVYGPAETQGL--GSTQIVADGDTFSLLGCQISVMALPGHTLGHVG 116

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  +  +L  GDTLFS GCGR+FE S  +MF+SL++I    D T +   HEYTE+N  F
Sbjct: 117 YY--SAPYLFCGDTLFSAGCGRLFEGSAQQMFDSLQRIMQLPDNTLVCCAHEYTESNLRF 174

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A    P N  ++ Y   V ++R++   T PST+ +E+++NPFLR  +  L++N+      
Sbjct: 175 ARHVLPQNRAIETYQQHVATLRAKQQPTVPSTLRIEREINPFLRCYDDDLQRNVGFPTQP 234

Query: 241 N--LAVFTELRIRKN 253
           N    VF  LR  K+
Sbjct: 235 NEIWRVFACLRDMKD 249


>gi|329849723|ref|ZP_08264569.1| hydroxyacylglutathione hydrolase [Asticcacaulis biprosthecum C19]
 gi|328841634|gb|EGF91204.1| hydroxyacylglutathione hydrolase [Asticcacaulis biprosthecum C19]
          Length = 250

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 127/244 (52%), Gaps = 13/244 (5%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGW-FLTHIFNTHHHIDHTRANLNLKKF 71
           DN+  L+ +    +TAAID P+   I   + E+G   L  I NTH H DH   N  ++  
Sbjct: 13  DNYGFLVTDEATGITAAIDTPEASRIIARVEERGLPGLDFILNTHWHPDHGGGNAEVQAH 72

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY--HFMNDHFL 129
           F+C I+G  E   + P +DH L DGD F  G   + ++   GHT+G I Y  H   + F 
Sbjct: 73  FHCPIYGAEEVRKRWP-LDHVLKDGDVFMLGETRLDVVGLGGHTLGVIGYFDHAGGNAF- 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
            V D +F LGCGR+FE +  + ++SL K+      T +Y  HEYT  N  FA S    + 
Sbjct: 131 -VSDVIFPLGCGRMFEGTPEQYWDSLLKLAELPGDTVLYSAHEYTLANLRFAESLG-LDA 188

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            LQ   + V++ R++  +T PST++ EK  NPFLR         L  + A+  A F ELR
Sbjct: 189 TLQARGNDVRARRARGEFTVPSTVAEEKATNPFLRY------PLLEKDFAAQAAKFGELR 242

Query: 250 IRKN 253
             K+
Sbjct: 243 AAKD 246


>gi|195440518|ref|XP_002068089.1| GK10504 [Drosophila willistoni]
 gi|194164174|gb|EDW79075.1| GK10504 [Drosophila willistoni]
          Length = 308

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 128/254 (50%), Gaps = 11/254 (4%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI ++K +  A +D  D  ++ K + E+   L  +  THHH DH   N  L K 
Sbjct: 56  QDNYMYLIIDNKTKEAAVVDPVDPDLVIKTVNEEKVTLKKVLTTHHHWDHAGGNEKLVKL 115

Query: 72  FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-------M 124
           +            +I  ++  +   DTF+ GS  +  ++TP HT GHICYH         
Sbjct: 116 WTSGELKVYGGDDRIGALNEKVRQNDTFNIGSLNVMCLSTPCHTTGHICYHVSAADDAAA 175

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
           +   +  GDTLF  GCGR FE +  EM+E+L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 176 DSGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDDTKVFCGHEYTLQNMSFARH 235

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-L 242
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+  ++++K+    N +N +
Sbjct: 236 VEPDNQLIQQRIEWAKLRRASQDPTVPSTIGEEKSWNPFMRVHESTVQKHTG--NTTNPI 293

Query: 243 AVFTELRIRKNQSK 256
               +LR  K+  K
Sbjct: 294 ETMGKLRKEKDNFK 307


>gi|212709213|ref|ZP_03317341.1| hypothetical protein PROVALCAL_00247 [Providencia alcalifaciens DSM
           30120]
 gi|212688125|gb|EEB47653.1| hypothetical protein PROVALCAL_00247 [Providencia alcalifaciens DSM
           30120]
          Length = 250

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 138/252 (54%), Gaps = 9/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I   +DN+  L+ N++  +   +D  ++  +  +L         I  THHH DHT+  
Sbjct: 4   IRIPALNDNYIWLLTNNQQCII--VDPAESEAVLAILTANHLTPVAILLTHHHNDHTQGV 61

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             +  ++    +FGP E  +++ G    +++GD         ++I  PGHT+GH+   F 
Sbjct: 62  KGIIAQYPKLPVFGPQE--TRVKGATEQVNEGDLVVIDDFKFQVIGLPGHTLGHV--GFY 117

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGRIFE +  +M++S++KI +  D+T I   HEYT +N  FA   
Sbjct: 118 QAPYLFCGDTLFSAGCGRIFEGTPEQMYQSIQKIAALPDETLICCAHEYTLSNLQFAHHI 177

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK--NLNMENASNL 242
            P N  +  Y  KV+++RS    + PST+  E+ +N FL+ +N  L++  N+N+ N S  
Sbjct: 178 WPENEIITNYSEKVRTLRSNQQASVPSTLKTERNINIFLQCDNPKLQQKLNINVTNPSLR 237

Query: 243 AVFTELRIRKNQ 254
           AVFT LR  K++
Sbjct: 238 AVFTLLRQLKDE 249


>gi|34496709|ref|NP_900924.1| hydroxyacylglutathione hydrolase [Chromobacterium violaceum ATCC
           12472]
 gi|34102564|gb|AAQ58929.1| hydroxyacylglutathione hydrolase [Chromobacterium violaceum ATCC
           12472]
          Length = 260

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 125/251 (49%), Gaps = 13/251 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  ++         A+D  +   + + L ++   L  +  THHH DH     +
Sbjct: 15  VGAFTDNYIWVLREGAR--AVAVDPGEAAPLLRHLEQEQLRLEAVLITHHHADHCGGLAD 72

Query: 68  -LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+ +    ++GP    + +PG+ H + +GD         +++  PGHT+ H+ Y  + D
Sbjct: 73  VLRAWPGIPVYGP----AGLPGVSHPVMEGDAVSLSMGRAEVLEVPGHTLDHLAY-LLED 127

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
              C GDTLF+ GCGR+FE +  +M  SL+K+      T +Y  HEYT +N  FAL+ D 
Sbjct: 128 ALFC-GDTLFAAGCGRLFEGTPGQMLASLKKLAGLPPNTKVYPAHEYTLSNLRFALAADQ 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SNL 242
           HN  L    S+  ++R + L T PSTI+LE   NPFLR    +LR+ L         S  
Sbjct: 187 HNPILAMRHSRDSALRDRGLPTLPSTIALETASNPFLRSGEPALREALRRRGGQPGDSEE 246

Query: 243 AVFTELRIRKN 253
             F  LR  KN
Sbjct: 247 TCFALLREWKN 257


>gi|253689507|ref|YP_003018697.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259492012|sp|C6DC67|GLO2_PECCP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|251756085|gb|ACT14161.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 251

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 134/251 (53%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEASPVLDALAQHALFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L K + N  +FGP +E++K  G    L +G+T    +    +I  PGHT GHI Y+  
Sbjct: 63  HELLKHYPNLPVFGP-KETAKC-GATSLLEEGNTVSLLNSEFSVIEVPGHTSGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           N  FL  GDTLFS GCGRIFE +  +M+ES++KI    D T I   HEYT +N  F+ + 
Sbjct: 119 NAPFLFCGDTLFSAGCGRIFEGTPRQMYESIQKIAVLPDDTVICCAHEYTLSNLRFSNAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNL 242
            P +  ++ Y  ++  +R ++  + P+T+ LE+++N FLR     L++ L+   EN  N 
Sbjct: 179 WPEDQSIEAYLHEISQIREKSQSSLPTTLGLERRINLFLRCHELDLKRKLSKEPENIENW 238

Query: 243 AVFTELRIRKN 253
            VF  LR +K+
Sbjct: 239 QVFEMLRSKKD 249


>gi|187479406|ref|YP_787431.1| hydroxyacylglutathione hydrolase [Bordetella avium 197N]
 gi|115423993|emb|CAJ50546.1| probable hydroxyacylglutathione hydrolase [Bordetella avium 197N]
          Length = 269

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 123/259 (47%), Gaps = 12/259 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+   +    + +   +D      +   L  +G  L  I  THHH DH    
Sbjct: 15  VPIEAFTDNYIWAVVCDGWAVV--VDPGQAQPVRDFLAARGLQLRAILLTHHHGDHVGGV 72

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKI--IATPGHTIGHICY-- 121
           L L       ++GP  E+  +P  D  L +GD  D     I +  +  PGHT GHI Y  
Sbjct: 73  LELLADATVPVYGPAHET--LPHCDVPLQEGDRVDIPDLGISLACLDVPGHTAGHIAYAG 130

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           H      L  GDTLF+ GCGR+FE +  +M  SLEK+ +  + T ++  HEYT  N  +A
Sbjct: 131 HLDGKPLLFCGDTLFAAGCGRLFEGTPEQMLASLEKLGTLPEDTQVFCAHEYTLANLRWA 190

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            + +P NL LQ++  + + MR+    T PS+I  E+  NPFLR +   +     +     
Sbjct: 191 TAVEPANLTLQQWQVQARQMRTDGRPTLPSSIGKERDTNPFLRTQQADVINAAKIWAGQT 250

Query: 242 LA----VFTELRIRKNQSK 256
           L+    VF  LR  KN  K
Sbjct: 251 LSSPVEVFAALRNWKNNFK 269


>gi|307132182|ref|YP_003884198.1| putative hydroxyacylglutathione hydrolase [Dickeya dadantii 3937]
 gi|306529711|gb|ADM99641.1| predicted hydroxyacylglutathione hydrolase [Dickeya dadantii 3937]
          Length = 251

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 131/252 (51%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  + DN+  L+ N + +    +D  +   + + L     F   I  THHH DHT   
Sbjct: 4   ISVPAFKDNYIWLLANDE-KQCVIVDPGEAAPVLQALEYHRLFPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + +    I+GP E  +K  G+ H + +GD          I   PGHT GHI YH  
Sbjct: 63  RQLAEHYPGIQIYGPQE--TKPCGVTHTVQEGDIIAAAGSEFSIFFVPGHTAGHIAYH-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGRIFE +  +MFESL K+    D+T +   HEYT +N  FA   
Sbjct: 119 SHPYLFCGDTLFSAGCGRIFEGTAQQMFESLIKLADLPDETQVCCAHEYTLSNLEFAHHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNL 242
            P + ++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L  N ++  + 
Sbjct: 179 WPEDADIHDYLLKIRQLREKGESSLPSTLGRERRINIFLRYHDIDLQRKLSINTDHKGDW 238

Query: 243 AVFTELRIRKNQ 254
            +F  LR  K++
Sbjct: 239 QIFAHLRAMKDR 250


>gi|82775598|ref|YP_401945.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae Sd197]
 gi|309787113|ref|ZP_07681725.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1617]
 gi|123563456|sp|Q32JQ1|GLO2_SHIDS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81239746|gb|ABB60456.1| probable hydroxyacylglutathione hydrolase [Shigella dysenteriae
           Sd197]
 gi|308924691|gb|EFP70186.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1617]
          Length = 251

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMEFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITQPVILKNERQINVFLRTEHIDLINVINEE 231


>gi|262198528|ref|YP_003269737.1| hydroxyacylglutathione hydrolase [Haliangium ochraceum DSM 14365]
 gi|262081875|gb|ACY17844.1| hydroxyacylglutathione hydrolase [Haliangium ochraceum DSM 14365]
          Length = 263

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 125/258 (48%), Gaps = 10/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          +D  +   +   L  +G  L  I+NTHHH DH   N
Sbjct: 4   VPVPCLKDNYAYLVICEATNAATVVDPSEAAPVLAALEREGVALQAIWNTHHHWDHVGGN 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH-PIKIIATPGHTIGHICYHF 123
             L ++F    + G   +  +IPG +  + DG+    G     +I+  PGHT G I Y  
Sbjct: 64  KELLQRFQEIDVVGHASDKDRIPGQNRFVEDGEEVSLGEELRAQILFNPGHTRGAISYQL 123

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                +  GDTLF  GCGR+FE +  +M  SL ++ +    T ++ GHEYT  N  FA +
Sbjct: 124 AAHDAVFTGDTLFLAGCGRLFEGTAEQMHSSLSRLAALPPTTRVFCGHEYTVANLRFAAA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM------- 236
            +P N  + +  ++V  +R     + P++I+LE+  NPFLR +   + +++         
Sbjct: 184 VEPDNQAVSERAAEVAKLREAGQPSVPASIALERVTNPFLRTDVAEVIESVRASEAAAQG 243

Query: 237 -ENASNLAVFTELRIRKN 253
            E++S  A+F  LR  K+
Sbjct: 244 EEDSSGAAIFAALRRWKD 261


>gi|320186400|gb|EFW61132.1| Hydroxyacylglutathione hydrolase [Shigella flexneri CDC 796-83]
          Length = 251

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I ++ DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPVFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|268592018|ref|ZP_06126239.1| hydroxyacylglutathione hydrolase [Providencia rettgeri DSM 1131]
 gi|291312410|gb|EFE52863.1| hydroxyacylglutathione hydrolase [Providencia rettgeri DSM 1131]
          Length = 251

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 135/252 (53%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +   +DN+ I +    ++    +D  +   + +++  K      I  THHH DHT   
Sbjct: 4   IRVPALNDNY-IWVLADSHQQCIIVDPAEAEPVLEIITAKRLTPVAILLTHHHNDHTGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L KF    +FGP E  SK  G    + +GD        +++I+  GHT  HI   F 
Sbjct: 63  KGILSKFTTLPVFGPKETQSK--GATEIVENGDKVIIDEFNLQVISLSGHTSEHI--GFY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGRIFE +  +MFES++KI +  D+T I   HEYT +N  FA   
Sbjct: 119 QAPYLFCGDTLFSAGCGRIFEGTPEQMFESIQKIAALPDETLICCAHEYTLSNLKFAHHI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK--NLNMENASNL 242
            P N  + +Y  K+  +R ++  T P+T+ +EKK+N FL+ +N  L+K  N+N++N    
Sbjct: 179 WPENEAITQYLQKITQIRDKHQPTVPTTLKIEKKINIFLQCDNPQLQKKLNINLQNPPLR 238

Query: 243 AVFTELRIRKNQ 254
           A+FT LR  K+Q
Sbjct: 239 AIFTLLRQLKDQ 250


>gi|194290092|ref|YP_002005999.1| hydroxyacylglutathione hydrolase [Cupriavidus taiwanensis LMG
           19424]
 gi|226723985|sp|B3R1Y0|GLO2_CUPTR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|193223927|emb|CAQ69936.1| Hydroxyacylglutathione hydrolase [Cupriavidus taiwanensis LMG
           19424]
          Length = 266

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 129/262 (49%), Gaps = 21/262 (8%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IH+      A +D  +   + + L + G  L  I  THHH DH      
Sbjct: 7   IPAFQDNYIWAIHDGH--CAAVVDPGEAAPVERFLAQSGLALGAIVITHHHGDHQGGVAG 64

Query: 68  L-------KKFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGH 118
           L              + GP  E  +I G    L +GD  T +  +  ++++  PGHT GH
Sbjct: 65  LLAAHPRAPSGGPLPVLGPAGE--RIGGRTQALREGDVATLEAPALTLRVLDVPGHTAGH 122

Query: 119 ICY----HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
           I Y            C GDTLF+ GCGR+FE + A+M  SL+K+ +    T +Y  HEYT
Sbjct: 123 IAYVADLGEAGPALFC-GDTLFASGCGRLFEGTPAQMLASLDKLAALPGDTRVYCAHEYT 181

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            +N  FA + +P N  L  + ++V+++R+ N  T P+TI+ E++VNPFLR    ++R  +
Sbjct: 182 RSNVRFARAVEPGNAALAAWEARVEALRATNQPTLPTTIAHERQVNPFLRSREPAVRAAV 241

Query: 235 NMEN---ASNLAVFTELRIRKN 253
           +      A +   F  LR  K+
Sbjct: 242 SAHGGTAADDAQNFGALRGWKD 263


>gi|115936511|ref|XP_001184959.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
          Length = 268

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 119/236 (50%), Gaps = 8/236 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+      + A ID  D   + +++ ++   LT I  TH H DH+  N
Sbjct: 4   LPIPYLKDNYAYLVIEKASNIAAVIDPGDAEAVQRVIEQQNVQLTAILTTHKHWDHSGGN 63

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             LK    N  ++G   E   +PG +H L DGD+F  G      + TPGHT+GH+ Y   
Sbjct: 64  QKLKSLHSNLAVYG--GERDGVPGCNHKLKDGDSFQIGGLKFTALFTPGHTVGHMVYLLD 121

Query: 125 ND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                  + L  GD LF  G GR+FE   + M  SL+KI    D T ++ GHEY  +N  
Sbjct: 122 RSDKNLPNSLFTGDILFLGGNGRMFEGPPSLMLSSLDKICQIPDDTLVWPGHEYAVDNLR 181

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           FA + DP N ++ +  + V+  R +   T+PST+  EK  NPFLR    S+ + ++
Sbjct: 182 FAHNIDPANEDVTRKLNYVEERRKERRITSPSTLGEEKSYNPFLRTSQDSILQQVD 237


>gi|323246570|gb|EGA30545.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
          Length = 244

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 131/246 (53%), Gaps = 8/246 (3%)

Query: 11  YHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKK 70
           + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH      L +
Sbjct: 2   FQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVKELLQ 60

Query: 71  FF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
            F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F + +  
Sbjct: 61  HFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSHPYLF 117

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
           C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  PH+ 
Sbjct: 118 C-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSILPHDS 176

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLAVFTE 247
            + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A F  
Sbjct: 177 FINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAW 236

Query: 248 LRIRKN 253
           LR +K+
Sbjct: 237 LRSKKD 242


>gi|325914920|ref|ZP_08177252.1| hydroxyacylglutathione hydrolase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538813|gb|EGD10477.1| hydroxyacylglutathione hydrolase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 255

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 123/253 (48%), Gaps = 10/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +     R           +I+   RE GW  + +  THHH DH     
Sbjct: 5   ALPAFDDNYIWALVAADGRAVVVDPGQAEPVIAAAERE-GWTPSAVLLTHHHGDHIGGVA 63

Query: 67  NLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L+ ++    +FGP  E  +IP     +   +         +++A PGHT  HI   F+ 
Sbjct: 64  ALQQRWPQLELFGP--EDQRIPADARRVGQNERLRLLGTSFEVLAVPGHTRSHIA--FVT 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DRHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-- 243
           P N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +       L+  
Sbjct: 180 PTNAALQRRQQEAQAMRQAARPTLPISLKSELATNPFLRTSRPEIRAAVAPRTTGALSSE 239

Query: 244 --VFTELRIRKNQ 254
             VF ELR  K++
Sbjct: 240 VDVFAELRHWKDE 252


>gi|78046643|ref|YP_362818.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|123771464|sp|Q3BWP5|GLO2_XANC5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|78035073|emb|CAJ22718.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 255

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 128/254 (50%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQHQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ ++ +  +FGP +E  +IP   H +  G+         +++  PGHT  HI   F+
Sbjct: 63  AELQQRWPDLELFGPADE--RIPADAHQVGHGERLRLLDVEFQVLQVPGHTRSHIA--FV 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            D +L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  
Sbjct: 119 ADGYLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA- 243
           DP N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +    A  L+ 
Sbjct: 179 DPTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTGRPEIRAAVAPRAAGELSS 238

Query: 244 ---VFTELRIRKNQ 254
              VF ELR  K++
Sbjct: 239 EVDVFAELRRWKDE 252


>gi|121594111|ref|YP_986007.1| hydroxyacylglutathione hydrolase [Acidovorax sp. JS42]
 gi|120606191|gb|ABM41931.1| Hydroxyacylglutathione hydrolase [Acidovorax sp. JS42]
          Length = 259

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 129/257 (50%), Gaps = 12/257 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++++ +  +   +D  D   + + LR  G  L  I  THHH DH    
Sbjct: 5   LPLPAFADNYIWMMYDAQRAVV--VDPGDAEPVLQALRSMGLPLEAILVTHHHGDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++    T++GP  E    P I   LS GDT         ++  PGHT GHI Y+  N
Sbjct: 63  NALREATGATVYGPATEPMPEPLIR--LSGGDTLQALGLTFSVLDVPGHTAGHIAYYCAN 120

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLFS GCGR+FE +  +M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 121 MEGEPLLLCGDTLFSGGCGRLFEGTPTQMQASLDTLAALPGNTRVCCAHEYTLSNLKFAR 180

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-----ME 237
           + +P N  L +Y ++ +S R  +  T PS I++E+ +NPFLR    ++ +  +     ++
Sbjct: 181 AVEPRNAALLQYITECESRRRADQPTLPSRIAIERDINPFLRTRVATVAQAAHGFDALID 240

Query: 238 NASNLAVFTELRIRKNQ 254
                AV   LR  KN+
Sbjct: 241 PREPAAVLAALRQWKNE 257


>gi|323191551|gb|EFZ76811.1| hydroxyacylglutathione hydrolase [Escherichia coli RN587/1]
          Length = 251

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|301021448|ref|ZP_07185472.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 69-1]
 gi|300398084|gb|EFJ81622.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 69-1]
          Length = 251

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQVVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|152995728|ref|YP_001340563.1| hydroxyacylglutathione hydrolase [Marinomonas sp. MWYL1]
 gi|189041223|sp|A6VVZ9|GLO2_MARMS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|150836652|gb|ABR70628.1| Hydroxyacylglutathione hydrolase [Marinomonas sp. MWYL1]
          Length = 257

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 134/252 (53%), Gaps = 9/252 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  ++DN+  +I +       A+D     ++     E    LT I  THHH DHT     
Sbjct: 6   LPAFNDNYIWIIQDKDSSGIWAVDPGKADVVLNFCHEYQKTLTGILITHHHKDHTGGVAE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND- 126
           LK+  NC ++GP E  +++  + H + DGD     S    +IATPGHT+ H+CY    + 
Sbjct: 66  LKQHSNCPVYGP-EHLTEL--VTHPVDDGDRILVFSKVFTVIATPGHTLDHLCYFSEQET 122

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF  GCGRI E ++ +M  ++ KI    + T IY  HEYT  N  FALS +P
Sbjct: 123 PILLSGDTLFKGGCGRIMEGTHEQMLAAMIKISGLPNDTLIYGTHEYTLANYRFALSLEP 182

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASN- 241
           +N +L +     + +R++   T P+ +S+EKK NPFLR    +L+    + LN   A N 
Sbjct: 183 NNKDLIESNITCQKLRTEEKPTLPTKLSIEKKTNPFLRSHIEALKIQAAQQLNEIPAENP 242

Query: 242 LAVFTELRIRKN 253
           +  F+++R  K+
Sbjct: 243 IGAFSQVRRAKD 254


>gi|15799888|ref|NP_285900.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 EDL933]
 gi|15829462|ref|NP_308235.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128199|ref|NP_414748.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89107087|ref|AP_000867.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K-12 substr. W3110]
 gi|168750160|ref|ZP_02775182.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757205|ref|ZP_02782212.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168769975|ref|ZP_02794982.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776184|ref|ZP_02801191.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168782937|ref|ZP_02807944.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789655|ref|ZP_02814662.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC869]
 gi|168800386|ref|ZP_02825393.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC508]
 gi|170079843|ref|YP_001729163.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. DH10B]
 gi|195938584|ref|ZP_03083966.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806395|ref|ZP_03248732.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814459|ref|ZP_03255788.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821120|ref|ZP_03261440.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396752|ref|YP_002268815.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217324780|ref|ZP_03440864.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14588]
 gi|238899605|ref|YP_002925401.1| putative hydroxyacylglutathione hydrolase [Escherichia coli BW2952]
 gi|254791339|ref|YP_003076176.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256024149|ref|ZP_05438014.1| hydroxyacylglutathione hydrolase [Escherichia sp. 4_1_40B]
 gi|261223757|ref|ZP_05938038.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255833|ref|ZP_05948366.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281029|ref|YP_003497847.1| Hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           CB9615]
 gi|300949356|ref|ZP_07163368.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 116-1]
 gi|300958301|ref|ZP_07170444.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 175-1]
 gi|301029639|ref|ZP_07192701.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 196-1]
 gi|301645473|ref|ZP_07245410.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 146-1]
 gi|307136807|ref|ZP_07496163.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|331640662|ref|ZP_08341809.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|81175337|sp|P0AC85|GLO2_ECO57 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81175338|sp|P0AC84|GLO2_ECOLI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723989|sp|B5Z0I6|GLO2_ECO5E RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723992|sp|B1XD76|GLO2_ECODH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|259492009|sp|C4ZRU9|GLO2_ECOBW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|12512940|gb|AAG54508.1|AE005196_6 probable hydroxyacylglutathione hydrolase [Escherichia coli O157:H7
           str. EDL933]
 gi|1552782|gb|AAB08634.1| hypothetical protein [Escherichia coli]
 gi|1786406|gb|AAC73317.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. MG1655]
 gi|4902949|dbj|BAA77883.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K12 substr. W3110]
 gi|13359664|dbj|BAB33631.1| probable hydroxyacylglutathione hydrolase [Escherichia coli O157:H7
           str. Sakai]
 gi|169887678|gb|ACB01385.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|187768448|gb|EDU32292.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015572|gb|EDU53694.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999617|gb|EDU68603.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355703|gb|EDU74122.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361052|gb|EDU79471.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189370765|gb|EDU89181.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC869]
 gi|189377313|gb|EDU95729.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726196|gb|EDZ75797.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735736|gb|EDZ84423.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741243|gb|EDZ88925.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158152|gb|ACI35585.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209745504|gb|ACI71059.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745506|gb|ACI71060.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745508|gb|ACI71061.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745510|gb|ACI71062.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745512|gb|ACI71063.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|217321001|gb|EEC29425.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14588]
 gi|238862490|gb|ACR64488.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           BW2952]
 gi|254590739|gb|ACT70100.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. TW14359]
 gi|260450591|gb|ACX41013.1| hydroxyacylglutathione hydrolase [Escherichia coli DH1]
 gi|290760902|gb|ADD54863.1| Hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           CB9615]
 gi|299877466|gb|EFI85677.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 196-1]
 gi|300315007|gb|EFJ64791.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 175-1]
 gi|300451239|gb|EFK14859.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 116-1]
 gi|301076262|gb|EFK91068.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 146-1]
 gi|315134897|dbj|BAJ42056.1| hydroxyacylglutathione hydrolase [Escherichia coli DH1]
 gi|315616890|gb|EFU97507.1| hydroxyacylglutathione hydrolase [Escherichia coli 3431]
 gi|320190267|gb|EFW64917.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320638232|gb|EFX07960.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           G5101]
 gi|320643616|gb|EFX12760.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H- str.
           493-89]
 gi|320650352|gb|EFX18829.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H- str. H
           2687]
 gi|320654627|gb|EFX22628.1| hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|326338812|gb|EGD62631.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           1044]
 gi|326342397|gb|EGD66177.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           1125]
 gi|331040036|gb|EGI12244.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|332341540|gb|AEE54874.1| hydroxyacylglutathione hydrolase GloB [Escherichia coli UMNK88]
          Length = 251

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|331651117|ref|ZP_08352142.1| hydroxyacylglutathione hydrolase [Escherichia coli M718]
 gi|331050858|gb|EGI22910.1| hydroxyacylglutathione hydrolase [Escherichia coli M718]
          Length = 251

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|157159673|ref|YP_001456991.1| hydroxyacylglutathione hydrolase [Escherichia coli HS]
 gi|166990455|sp|A7ZWF4|GLO2_ECOHS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|157065353|gb|ABV04608.1| hydroxyacylglutathione hydrolase [Escherichia coli HS]
          Length = 251

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|320173692|gb|EFW48881.1| Hydroxyacylglutathione hydrolase [Shigella dysenteriae CDC 74-1112]
          Length = 251

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSII 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|324111226|gb|EGC05209.1| hydroxyacylglutathione hydrolase [Escherichia fergusonii B253]
          Length = 251

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPRETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|110640427|ref|YP_668155.1| hydroxyacylglutathione hydrolase [Escherichia coli 536]
 gi|191171362|ref|ZP_03032911.1| hydroxyacylglutathione hydrolase [Escherichia coli F11]
 gi|215485368|ref|YP_002327799.1| hydroxyacylglutathione hydrolase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|300990973|ref|ZP_07179423.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 200-1]
 gi|306813368|ref|ZP_07447561.1| hydroxyacylglutathione hydrolase [Escherichia coli NC101]
 gi|312964726|ref|ZP_07778977.1| hydroxyacylglutathione hydrolase [Escherichia coli 2362-75]
 gi|123344357|sp|Q0TLC5|GLO2_ECOL5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798843|sp|B7UJA8|GLO2_ECO27 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110342019|gb|ABG68256.1| probable hydroxyacylglutathione hydrolase [Escherichia coli 536]
 gi|190908296|gb|EDV67886.1| hydroxyacylglutathione hydrolase [Escherichia coli F11]
 gi|215263440|emb|CAS07760.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|222032037|emb|CAP74776.1| hydroxyacylglutathione hydrolase [Escherichia coli LF82]
 gi|300305639|gb|EFJ60159.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 200-1]
 gi|305854131|gb|EFM54570.1| hydroxyacylglutathione hydrolase [Escherichia coli NC101]
 gi|312290747|gb|EFR18625.1| hydroxyacylglutathione hydrolase [Escherichia coli 2362-75]
 gi|312944815|gb|ADR25642.1| hydroxyacylglutathione hydrolase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324011827|gb|EGB81046.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 60-1]
          Length = 251

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|85058567|ref|YP_454269.1| putative hydroxyacylglutathione hydrolase [Sodalis glossinidius
           str. 'morsitans']
 gi|123519977|sp|Q2NVG1|GLO2_SODGM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|84779087|dbj|BAE73864.1| putative hydroxyacylglutathione hydrolase [Sodalis glossinidius
           str. 'morsitans']
          Length = 250

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 131/250 (52%), Gaps = 7/250 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+HN   R    +D  D   + + L +       +  THHH DH    
Sbjct: 4   ISIPALADNYIWLLHNDDRR-CLVVDPGDATPVLQALADHRLTPVAVLLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + F   ++GP E  SK  G    +++GD+     H   I+A PGHT+GHI   F +
Sbjct: 63  SELLQHFPVPVYGPEETRSK--GATQIVNEGDSLTLLDHTFSIMALPGHTLGHIG--FYS 118

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS G GR+FE +  +M+ES +K+   S  T I   HEYT +N  FA +  
Sbjct: 119 APWLFCGDTVFSAGSGRLFEGTPRQMYESFQKVNQLSSATLICAAHEYTLSNLNFAAALL 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P +  +  Y  K+K +R +N  + P+ + LE+++N FLR  + +L+  LN+  A +    
Sbjct: 179 PQDSVITDYQRKIKELRLKNQPSMPTKLHLERQINLFLRCHDVNLQNKLNVHPAPSEEWR 238

Query: 244 VFTELRIRKN 253
           VF  LR +K+
Sbjct: 239 VFAALREKKD 248


>gi|207723986|ref|YP_002254384.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           MolK2]
 gi|206589194|emb|CAQ36156.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           MolK2]
          Length = 275

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NL-------KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKI---IATPGHTI 116
            L              + GP+ ES  IP     + +GDT    +HP  I   +  PGHT 
Sbjct: 70  ALVDAHPRDPSGAPLPVIGPVGES--IPCRTQSVREGDTVTL-AHPAAIFHVLDVPGHTR 126

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 127 GHVAYVGRLQGQDAPASLFC-GDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCA 185

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN--- 227
           HEYT +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +    
Sbjct: 186 HEYTASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTV 245

Query: 228 -TSLRKNLNMENASNLAVFTELRIRKN 253
             S+ ++  +     +AVF  LR  KN
Sbjct: 246 AASVARHAGIGTDDPVAVFAALREWKN 272


>gi|300919148|ref|ZP_07135681.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 115-1]
 gi|300413746|gb|EFJ97056.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 115-1]
 gi|309700414|emb|CBI99703.1| probable hydroxyacylglutathione hydrolase [Escherichia coli ETEC
           H10407]
          Length = 251

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|325496138|gb|EGC93997.1| hydroxyacylglutathione hydrolase [Escherichia fergusonii ECD227]
          Length = 251

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPRETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|323938755|gb|EGB35001.1| hydroxyacylglutathione hydrolase [Escherichia coli E1520]
 gi|323963757|gb|EGB59259.1| hydroxyacylglutathione hydrolase [Escherichia coli M863]
 gi|327254931|gb|EGE66541.1| hydroxyacylglutathione hydrolase [Escherichia coli STEC_7v]
          Length = 251

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|74310827|ref|YP_309246.1| hydroxyacylglutathione hydrolase [Shigella sonnei Ss046]
 gi|157157699|ref|YP_001461377.1| hydroxyacylglutathione hydrolase [Escherichia coli E24377A]
 gi|187731163|ref|YP_001879009.1| hydroxyacylglutathione hydrolase [Shigella boydii CDC 3083-94]
 gi|191167021|ref|ZP_03028843.1| hydroxyacylglutathione hydrolase [Escherichia coli B7A]
 gi|193067563|ref|ZP_03048530.1| hydroxyacylglutathione hydrolase [Escherichia coli E110019]
 gi|194432716|ref|ZP_03065001.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1012]
 gi|260853417|ref|YP_003227308.1| putative hydroxyacylglutathione hydrolase [Escherichia coli O26:H11
           str. 11368]
 gi|260866355|ref|YP_003232757.1| putative hydroxyacylglutathione hydrolase [Escherichia coli O111:H-
           str. 11128]
 gi|300926568|ref|ZP_07142354.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 182-1]
 gi|301326096|ref|ZP_07219492.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 78-1]
 gi|309797927|ref|ZP_07692307.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 145-7]
 gi|331666453|ref|ZP_08367333.1| hydroxyacylglutathione hydrolase [Escherichia coli TA271]
 gi|331675870|ref|ZP_08376587.1| hydroxyacylglutathione hydrolase [Escherichia coli H591]
 gi|123618007|sp|Q3Z5F1|GLO2_SHISS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166990454|sp|A7ZHU8|GLO2_ECO24 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724031|sp|B2U350|GLO2_SHIB3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|73854304|gb|AAZ87011.1| probable hydroxyacylglutathione hydrolase [Shigella sonnei Ss046]
 gi|157079729|gb|ABV19437.1| hydroxyacylglutathione hydrolase [Escherichia coli E24377A]
 gi|187428155|gb|ACD07429.1| hydroxyacylglutathione hydrolase [Shigella boydii CDC 3083-94]
 gi|190902914|gb|EDV62641.1| hydroxyacylglutathione hydrolase [Escherichia coli B7A]
 gi|192958975|gb|EDV89411.1| hydroxyacylglutathione hydrolase [Escherichia coli E110019]
 gi|194418978|gb|EDX35062.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1012]
 gi|257752066|dbj|BAI23568.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O26:H11 str. 11368]
 gi|257762711|dbj|BAI34206.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O111:H- str. 11128]
 gi|300417426|gb|EFK00737.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 182-1]
 gi|300847156|gb|EFK74916.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 78-1]
 gi|308118467|gb|EFO55729.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 145-7]
 gi|320179849|gb|EFW54795.1| Hydroxyacylglutathione hydrolase [Shigella boydii ATCC 9905]
 gi|323157953|gb|EFZ44055.1| hydroxyacylglutathione hydrolase [Escherichia coli EPECa14]
 gi|323165911|gb|EFZ51693.1| hydroxyacylglutathione hydrolase [Shigella sonnei 53G]
 gi|323176524|gb|EFZ62116.1| hydroxyacylglutathione hydrolase [Escherichia coli 1180]
 gi|324115456|gb|EGC09398.1| hydroxyacylglutathione hydrolase [Escherichia coli E1167]
 gi|331066298|gb|EGI38176.1| hydroxyacylglutathione hydrolase [Escherichia coli TA271]
 gi|331076430|gb|EGI47707.1| hydroxyacylglutathione hydrolase [Escherichia coli H591]
 gi|332093753|gb|EGI98808.1| hydroxyacylglutathione hydrolase [Shigella boydii 3594-74]
 gi|332095030|gb|EGJ00065.1| hydroxyacylglutathione hydrolase [Shigella boydii 5216-82]
 gi|332097576|gb|EGJ02555.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 155-74]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|300905645|ref|ZP_07123391.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 84-1]
 gi|301305769|ref|ZP_07211855.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 124-1]
 gi|300402537|gb|EFJ86075.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 84-1]
 gi|300838944|gb|EFK66704.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 124-1]
 gi|315253526|gb|EFU33494.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 85-1]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIATNNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|331645381|ref|ZP_08346485.1| hydroxyacylglutathione hydrolase [Escherichia coli M605]
 gi|281177432|dbj|BAI53762.1| putative hydroxyacylglutathione hydrolase [Escherichia coli SE15]
 gi|320197301|gb|EFW71917.1| Hydroxyacylglutathione hydrolase [Escherichia coli WV_060327]
 gi|330910058|gb|EGH38568.1| hydroxyacylglutathione hydrolase [Escherichia coli AA86]
 gi|331045543|gb|EGI17669.1| hydroxyacylglutathione hydrolase [Escherichia coli M605]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLRKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|227329799|ref|ZP_03833823.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 135/251 (53%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEAPPVLNALDQHALFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + + N  +FGP +E++K  G  + + +G+T    +    +I  PGHT GHI Y+  
Sbjct: 63  GELLRHYPNLPVFGP-KETAKC-GATYLVEEGNTVSLLNSEFSVIEVPGHTSGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           N  FL  GDTLFS GCGRIFE +  +M+ES++KI    D T +   HEYT +N  F+ + 
Sbjct: 119 NAPFLFCGDTLFSAGCGRIFEGTPRQMYESIQKIAKLPDDTVVCCAHEYTLSNLRFSNTI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNL 242
            P +  ++ Y  ++  +R ++  + P+T+ LE+++N FLR     L++ L+   EN  N 
Sbjct: 179 LPEDANIEAYLHEISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKLSKEPENIENW 238

Query: 243 AVFTELRIRKN 253
            VF  LR +K+
Sbjct: 239 QVFEMLRSKKD 249


>gi|194427628|ref|ZP_03060176.1| hydroxyacylglutathione hydrolase [Escherichia coli B171]
 gi|194414398|gb|EDX30672.1| hydroxyacylglutathione hydrolase [Escherichia coli B171]
          Length = 251

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+ I + N +      +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNY-IWVLNDEAGCCLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|297518677|ref|ZP_06937063.1| hydroxyacylglutathione hydrolase [Escherichia coli OP50]
          Length = 242

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+    D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSVLPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|193063154|ref|ZP_03044245.1| hydroxyacylglutathione hydrolase [Escherichia coli E22]
 gi|218552787|ref|YP_002385700.1| hydroxyacylglutathione hydrolase [Escherichia coli IAI1]
 gi|218693674|ref|YP_002401341.1| hydroxyacylglutathione hydrolase [Escherichia coli 55989]
 gi|260842438|ref|YP_003220216.1| putative hydroxyacylglutathione hydrolase [Escherichia coli O103:H2
           str. 12009]
 gi|226723991|sp|B7M211|GLO2_ECO8A RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798844|sp|B7LHB8|GLO2_ECO55 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|192931062|gb|EDV83665.1| hydroxyacylglutathione hydrolase [Escherichia coli E22]
 gi|218350406|emb|CAU96091.1| putative hydroxyacylglutathione hydrolase [Escherichia coli 55989]
 gi|218359555|emb|CAQ97095.1| putative hydroxyacylglutathione hydrolase [Escherichia coli IAI1]
 gi|257757585|dbj|BAI29082.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O103:H2 str. 12009]
 gi|323160259|gb|EFZ46216.1| hydroxyacylglutathione hydrolase [Escherichia coli E128010]
          Length = 251

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|146310409|ref|YP_001175483.1| hydroxyacylglutathione hydrolase [Enterobacter sp. 638]
 gi|166990456|sp|A4W6V2|GLO2_ENT38 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145317285|gb|ABP59432.1| Hydroxyacylglutathione hydrolase [Enterobacter sp. 638]
          Length = 251

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 87/251 (34%), Positives = 130/251 (51%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ + K R    +D  +   + K + E GW    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVLADDKDR-CVIVDPGEAAPVLKAIEENGWQPEAILLTHHHNDHVGGV 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L  KF +  ++GP E  +K  G    + +G           + ATPGHT GHIC  F 
Sbjct: 63  PALCAKFPHLEVYGPQETQNK--GTTCVVDEGQNVLILEWEFSVFATPGHTSGHIC--FY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDT+FS GCGR+FE +  +M++S +KI +  ++T I   HEYT  N  FA S 
Sbjct: 119 SSPYLFCGDTMFSGGCGRLFEGTPEQMYQSFQKINALPEETIICCAHEYTLANMKFAASI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA- 243
            P +  +Q Y  KVK +R++NL T P  +  E+++N FLR ++  L   +N E       
Sbjct: 179 LPEDRAIQDYYHKVKELRAKNLSTLPVILKNEREINLFLRTDDIDLINKINQETKLQQPE 238

Query: 244 -VFTELRIRKN 253
             F  LR +K+
Sbjct: 239 QRFAWLRSKKD 249


>gi|329296919|ref|ZP_08254255.1| hydroxyacylglutathione hydrolase [Plautia stali symbiont]
          Length = 251

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 136/251 (54%), Gaps = 8/251 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I    DN+   +++ + R    +D  +   + + +R   W    I  THHH DH     
Sbjct: 5   SIPALQDNYIWTLNDEQGR-CLIVDPGEARPVLEKIRANHWQPQAILLTHHHHDHVSGVG 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + +    ++GP E + K  G    LSDGD F       ++IATPGHT+GHI Y F +
Sbjct: 64  ELLEHYPQLKVYGPQETADK--GARTILSDGDEFTLLGLNFRVIATPGHTLGHISY-FSS 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDT+FS GCGR+FE +  +MFES + +      T I   HEYT +N  FA +  
Sbjct: 121 PYLFC-GDTMFSGGCGRLFEGTAQKMFESFQSLNQLPADTLICCAHEYTLSNMKFAAAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P + ++     ++K +R++N  T P+ ++LE+++N FLR ++  L+K+L  N+ +     
Sbjct: 180 PQDPKILARYQQIKDLRAENRITLPTKLALEREINLFLRTQDPDLQKDLGINVSSTPLWQ 239

Query: 244 VFTELRIRKNQ 254
            F +LR +K++
Sbjct: 240 TFADLREKKDR 250


>gi|238899158|ref|YP_002924840.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|259492011|sp|C4K7Z9|GLO2_HAMD5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|229466918|gb|ACQ68692.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 249

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 126/226 (55%), Gaps = 5/226 (2%)

Query: 30  IDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKFFNCTIFGPLEESSKIPG 88
           +D  +   +  +L  KG     I  THHH DH      L ++F +  ++GP E + K  G
Sbjct: 27  VDPGEASPVESVLTYKGLLPQAILLTHHHQDHLGGVPQLLRRFPDIPVYGPKETNKK--G 84

Query: 89  IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSY 148
               L +GD     S    +I  PGHT+GHI Y+  +  +L  GDTLFS GCGR+FE + 
Sbjct: 85  ATILLKEGDQLFICSQTFSVIEVPGHTLGHIAYY--SAPYLFCGDTLFSAGCGRLFEGTA 142

Query: 149 AEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT 208
            +M++S++K+    D+T I  GHEYT +N  FA S  P + ++  Y  + + ++++N  T
Sbjct: 143 DQMYDSIQKLIQLPDETLICAGHEYTLSNLKFARSILPDDPQIALYQKQAEQLKAKNQPT 202

Query: 209 NPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKNQ 254
            P+ + LE++VN FLR + + L+K +       L+VF+ LR  K++
Sbjct: 203 LPALLKLERQVNLFLRCKESFLQKKMGTHKHDPLSVFSTLREMKDR 248


>gi|163854935|ref|YP_001629233.1| hydroxyacylglutathione hydrolase [Bordetella petrii DSM 12804]
 gi|163258663|emb|CAP40962.1| probable hydroxyacylglutathione hydrolase [Bordetella petrii]
          Length = 429

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 132/258 (51%), Gaps = 13/258 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+   I        A +D  +   + ++L  +G  L  I  THHH DH    L 
Sbjct: 176 LPAFSDNYIWAIVRDGQ--VAVVDPGEAGPVLELLARRGLQLRAILLTHHHGDHVGGVLE 233

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGHICYHFM- 124
           L +    T++GP +E  ++P  D  LS+GD  T       + ++  PGHT GHI Y+   
Sbjct: 234 LLRHAPATVYGPAQE--RLPHCDVRLSEGDRVTLPELDLDLSVLDVPGHTAGHIAYYGRA 291

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLF+ GCGR+FE + A+M  SLEK  +    T +   HEYT  N  +A+
Sbjct: 292 AGRQPLLFCGDTLFAGGCGRLFEGTPAQMHASLEKFAALPADTQVCCAHEYTLANLRWAM 351

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P N  LQ++  + + +R Q   T PST+ LE+  NPFLR +  ++ +   +++    
Sbjct: 352 AVEPANRTLQQWYQRAQQLREQGRPTLPSTLRLEQDTNPFLRTQQANVAQAAAVQSGRVL 411

Query: 240 -SNLAVFTELRIRKNQSK 256
            + +AVF  LR  KN  K
Sbjct: 412 DTPVAVFAALREWKNDFK 429


>gi|302878566|ref|YP_003847130.1| hydroxyacylglutathione hydrolase [Gallionella capsiferriformans
           ES-2]
 gi|302581355|gb|ADL55366.1| hydroxyacylglutathione hydrolase [Gallionella capsiferriformans
           ES-2]
          Length = 257

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 87/250 (34%), Positives = 123/250 (49%), Gaps = 11/250 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   IHN    +   +D  D   +   L E    LT IF TH H DH     
Sbjct: 6   ALPAFQDNYIWAIHNDSEAVV--VDPGDAVPVLAYLAENNLKLTGIFCTHRHHDHVGGIE 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGHICYHFM 124
            L+  +N  ++G   E  K P I H L +G+     +  +   I+  PGH   HI +   
Sbjct: 64  KLRAVYNVAVYGRRHE--KNPHITHALLEGEQVRLDAFGLVFDIMEIPGHLDDHIAFFAQ 121

Query: 125 N--DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           N     L  GD LF  GCG+ FE S A++  SL++I    + T  Y  HEYT +N  FA 
Sbjct: 122 NAVPPLLFCGDVLFGAGCGKSFEGSVAQLHHSLQRISMLPEATLAYCAHEYTASNLRFAA 181

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN---MENA 239
            C+P N  L+   +    +R+ NL T PST++LEK  NPFLR   T++ ++L    + + 
Sbjct: 182 VCEPDNAALKIRIADTARLRAANLSTVPSTLALEKATNPFLRCTETAIIRSLQQRGLTDT 241

Query: 240 SNLAVFTELR 249
           S  AVF  LR
Sbjct: 242 SEAAVFAALR 251


>gi|328868145|gb|EGG16525.1| hydroxyacylglutathione hydrolase [Dictyostelium fasciculatum]
          Length = 258

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 132/254 (51%), Gaps = 3/254 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  L+ +      AAID  +   + +  ++    +T I +THHH DH   N
Sbjct: 4   IVVPILSDNYSYLLVDETTNKAAAIDCAEPNKVVEAAKQHNVEITSILSTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K+  N      +    +I  I   +++ +T   G+  +K+ ++P HT GH+ Y+  +
Sbjct: 64  KQMKELLNNHSLPVIGGDDRIESITQKVNNNETIKVGALNVKVFSSPAHTTGHVLYYVED 123

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEK-IKSFSDKTHIYFGHEYTENNAYFAL 182
             +  L  GDTLF  GCGR+FE    +M+++L + I    + T ++ GHEYT NN  FA 
Sbjct: 124 EKERNLFTGDTLFIGGCGRLFEGDPTQMYDALYRVIGQLPEDTKLWVGHEYTVNNLLFAK 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           S +P N ++ +     K  R+ NL T PSTI+ E+  NPF+R+    +   ++  ++S  
Sbjct: 184 SLEPDNQDINQMLEWSKQQRTNNLPTIPSTIAKERTFNPFMRVHLNGIFNGIDYSSSSPQ 243

Query: 243 AVFTELRIRKNQSK 256
            +  ++R  K+  K
Sbjct: 244 QILGQIRKLKDNFK 257


>gi|320660195|gb|EFX27705.1| hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str. USDA
           5905]
          Length = 251

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  +VK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRQVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|320665446|gb|EFX32508.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 251

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    +F THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAMFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|170021440|ref|YP_001726394.1| hydroxyacylglutathione hydrolase [Escherichia coli ATCC 8739]
 gi|188492268|ref|ZP_02999538.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194438202|ref|ZP_03070294.1| hydroxyacylglutathione hydrolase [Escherichia coli 101-1]
 gi|253774766|ref|YP_003037597.1| hydroxyacylglutathione hydrolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160326|ref|YP_003043434.1| hydroxyacylglutathione hydrolase [Escherichia coli B str. REL606]
 gi|300927904|ref|ZP_07143464.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 187-1]
 gi|312970310|ref|ZP_07784491.1| hydroxyacylglutathione hydrolase [Escherichia coli 1827-70]
 gi|189041220|sp|B1IPU6|GLO2_ECOLC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169756368|gb|ACA79067.1| hydroxyacylglutathione hydrolase [Escherichia coli ATCC 8739]
 gi|188487467|gb|EDU62570.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194422866|gb|EDX38861.1| hydroxyacylglutathione hydrolase [Escherichia coli 101-1]
 gi|242376042|emb|CAQ30727.1| glyoxalase II [Escherichia coli BL21(DE3)]
 gi|253325810|gb|ACT30412.1| hydroxyacylglutathione hydrolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972227|gb|ACT37898.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli B str.
           REL606]
 gi|253976436|gb|ACT42106.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           BL21(DE3)]
 gi|300464059|gb|EFK27552.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 187-1]
 gi|310336959|gb|EFQ02097.1| hydroxyacylglutathione hydrolase [Escherichia coli 1827-70]
 gi|323963575|gb|EGB59132.1| hydroxyacylglutathione hydrolase [Escherichia coli H489]
 gi|323972504|gb|EGB67710.1| hydroxyacylglutathione hydrolase [Escherichia coli TA007]
          Length = 251

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+    D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSVLPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|317402506|gb|EFV83073.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans C54]
          Length = 266

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 117/232 (50%), Gaps = 9/232 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+   I        A +D  +   + + L  +G  L  I  THHH DH    
Sbjct: 18  LPLPAFTDNYIWAIVRDGQ--AAVVDPGEAGPVLQWLAREGLRLRAILLTHHHGDHVGGV 75

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGHICY-- 121
           L L +  + T++GP  E  K+P  D  L +GD        +   ++  PGHT GHI Y  
Sbjct: 76  LELSRIGDITVYGPARE--KLPRCDVPLVEGDRVVLPELDLDLAVLDVPGHTAGHIAYTG 133

Query: 122 -HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                   L  GDTLF+ GCGR+FE + A+M +SLEK       T ++  HEYT  N  +
Sbjct: 134 RAAGKQPVLFCGDTLFAGGCGRLFEGTPAQMSDSLEKFSVLPPDTQVFCAHEYTLANLRW 193

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           A++ +P N  LQ++  + + +R++ L T PSTI  E+  NPFLR +   + +
Sbjct: 194 AMAVEPANRTLQQWYQRARQLRAEGLPTLPSTIGQERATNPFLRTQQADVVR 245


>gi|53725584|ref|YP_102528.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 23344]
 gi|67639725|ref|ZP_00438562.1| hydroxyacylglutathione hydrolase [Burkholderia mallei GB8 horse 4]
 gi|121600990|ref|YP_992610.1| hydroxyacylglutathione hydrolase [Burkholderia mallei SAVP1]
 gi|124384900|ref|YP_001026589.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10229]
 gi|126440113|ref|YP_001058511.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|126448564|ref|YP_001080127.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10247]
 gi|167002804|ref|ZP_02268594.1| hydroxyacylglutathione hydrolase [Burkholderia mallei PRL-20]
 gi|167738049|ref|ZP_02410823.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           14]
 gi|217423726|ref|ZP_03455227.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 576]
 gi|254178061|ref|ZP_04884716.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 10399]
 gi|254180215|ref|ZP_04886814.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|254199439|ref|ZP_04905805.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|254205752|ref|ZP_04912104.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|254358848|ref|ZP_04975121.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|52429007|gb|AAU49600.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 23344]
 gi|121229800|gb|ABM52318.1| hydroxyacylglutathione hydrolase [Burkholderia mallei SAVP1]
 gi|124292920|gb|ABN02189.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10229]
 gi|126219606|gb|ABN83112.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 668]
 gi|126241434|gb|ABO04527.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10247]
 gi|147749035|gb|EDK56109.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|147753195|gb|EDK60260.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|148027975|gb|EDK85996.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|160699100|gb|EDP89070.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 10399]
 gi|184210755|gb|EDU07798.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|217393584|gb|EEC33605.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 576]
 gi|238520323|gb|EEP83784.1| hydroxyacylglutathione hydrolase [Burkholderia mallei GB8 horse 4]
 gi|243061563|gb|EES43749.1| hydroxyacylglutathione hydrolase [Burkholderia mallei PRL-20]
          Length = 268

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 137/265 (51%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDG--RQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHRDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  I   ++ G+    G+  ++  +I  PGHT GHI
Sbjct: 65  AELLAGAREGEPIAVFGPAHEA--IEHITRRVAGGERVRIGAPALEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  +  + R++   T P+TI+ E  VNPFLR ++ S+R  
Sbjct: 182 TLSNIQFALACEPGNAALAAWRDEALARRARGEPTLPTTIAHECAVNPFLRADSASIRAT 241

Query: 234 LNM---ENASN-LAVFTELRIRKNQ 254
           L     E A + LA FT +R  KN+
Sbjct: 242 LEARLHEAAPDRLAAFTLMREWKNR 266


>gi|291613975|ref|YP_003524132.1| hydroxyacylglutathione hydrolase [Sideroxydans lithotrophicus ES-1]
 gi|291584087|gb|ADE11745.1| hydroxyacylglutathione hydrolase [Sideroxydans lithotrophicus ES-1]
          Length = 253

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 127/254 (50%), Gaps = 11/254 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+    + +   +D  +  ++   L+     L  I  TH H DH    
Sbjct: 5   IPIPALQDNYIWLLRRDNHAVI--VDPGEAALVLDYLQANSLQLDAILCTHRHHDHVDGI 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGS--HPIKIIATPGHTIGHICYHF 123
             L+  +N  + G      K P I H L +GD     +      II  PGH   HI   F
Sbjct: 63  EELRGVYNVPVHG--RSHPKNPHITHDLREGDRLWLETLDAEFAIIEVPGHLDDHIA--F 118

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
           +    +  GD +F  GCG+ FE + A++  SL+++ +  D T +Y  HEYT  N  FAL+
Sbjct: 119 IAPRVVFCGDVMFGGGCGKNFEGTPAQLLHSLQRLAALPDDTQVYCAHEYTSYNLPFALA 178

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN---MENAS 240
           C+P N ++Q+  +  +S+R +NL T P TI+LEK  NPFLR  +  L + L    + + S
Sbjct: 179 CEPDNPDVQRRIADTRSLRERNLSTVPFTIALEKATNPFLRCSSPELVRTLQARGLADTS 238

Query: 241 NLAVFTELRIRKNQ 254
            LAVFT LR  +++
Sbjct: 239 ELAVFTALREWRDR 252


>gi|218703461|ref|YP_002410980.1| hydroxyacylglutathione hydrolase [Escherichia coli UMN026]
 gi|293403291|ref|ZP_06647382.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1412]
 gi|298378905|ref|ZP_06988786.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1302]
 gi|300900032|ref|ZP_07118229.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 198-1]
 gi|331661583|ref|ZP_08362506.1| hydroxyacylglutathione hydrolase [Escherichia coli TA143]
 gi|226723993|sp|B7N874|GLO2_ECOLU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218430558|emb|CAR11424.1| putative hydroxyacylglutathione hydrolase [Escherichia coli UMN026]
 gi|284919982|emb|CBG33037.1| probable hydroxyacylglutathione hydrolase [Escherichia coli 042]
 gi|291429144|gb|EFF02164.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1412]
 gi|298280018|gb|EFI21522.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1302]
 gi|300356437|gb|EFJ72307.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 198-1]
 gi|331060005|gb|EGI31969.1| hydroxyacylglutathione hydrolase [Escherichia coli TA143]
          Length = 251

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+      H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTRVVKDGEIAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|166795234|ref|NP_001107642.1| probable hydrolase PNKD isoform 1 [Bos taurus]
 gi|160419155|sp|A7YY46|PNKD_BOVIN RecName: Full=Probable hydrolase PNKD
 gi|154425585|gb|AAI51299.1| PNKD protein [Bos taurus]
 gi|296490311|gb|DAA32424.1| probable hydrolase PNKD isoform 1 [Bos taurus]
          Length = 385

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 119/236 (50%), Gaps = 8/236 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++S  IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHQDCRVYGSPQDS--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYEGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L 
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALG 355


>gi|117622494|ref|YP_851407.1| hydroxyacylglutathione hydrolase [Escherichia coli APEC O1]
 gi|218557148|ref|YP_002390061.1| hydroxyacylglutathione hydrolase [Escherichia coli S88]
 gi|237707794|ref|ZP_04538275.1| hydroxyacylglutathione hydrolase [Escherichia sp. 3_2_53FAA]
 gi|160386242|sp|A1A7Q3|GLO2_ECOK1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723988|sp|B7MBI8|GLO2_ECO45 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|115511618|gb|ABI99692.1| putative hydroxyacylglutathione hydrolase [Escherichia coli APEC
           O1]
 gi|218363917|emb|CAR01582.1| putative hydroxyacylglutathione hydrolase [Escherichia coli S88]
 gi|226899004|gb|EEH85263.1| hydroxyacylglutathione hydrolase [Escherichia sp. 3_2_53FAA]
 gi|294493353|gb|ADE92109.1| hydroxyacylglutathione hydrolase [Escherichia coli IHE3034]
 gi|307628306|gb|ADN72610.1| hydroxyacylglutathione hydrolase [Escherichia coli UM146]
 gi|315289704|gb|EFU49097.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 110-3]
 gi|323958796|gb|EGB54495.1| hydroxyacylglutathione hydrolase [Escherichia coli H263]
          Length = 251

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|91209280|ref|YP_539266.1| hydroxyacylglutathione hydrolase [Escherichia coli UTI89]
 gi|122424930|sp|Q1RFX9|GLO2_ECOUT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91070854|gb|ABE05735.1| probable hydroxyacylglutathione hydrolase [Escherichia coli UTI89]
          Length = 251

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|300936083|ref|ZP_07151025.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 21-1]
 gi|300458758|gb|EFK22251.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 21-1]
          Length = 251

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHI Y+F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHI-YYFSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|224582102|ref|YP_002635900.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|254798849|sp|C0Q6N0|GLO2_SALPC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|224466629|gb|ACN44459.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
          Length = 251

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K + E  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+ ++F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHV-FYFSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KVK +R +   T P  +  E+K+N FLR EN  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTENIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|324009118|gb|EGB78337.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 57-2]
          Length = 251

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+    D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSVLPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|149711093|ref|XP_001491335.1| PREDICTED: paroxysmal nonkinesigenic dyskinesia [Equus caballus]
          Length = 385

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 118/236 (50%), Gaps = 8/236 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDIQARLAVAVDPSDPQAVQASIEKEGVALVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  E+   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHQDCRVYGSPEDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L 
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALG 355


>gi|300691209|ref|YP_003752204.1| hydroxyacylglutathione hydrolase [Ralstonia solanacearum PSI07]
 gi|299078269|emb|CBJ50917.2| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum PSI07]
          Length = 275

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 130/267 (48%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK---IIATPGHTI 116
            L + +          + GP  ES  IP     + +GDT    SHP     ++  PGHT 
Sbjct: 70  ALVEAYPRDPSGAPLPVIGPAGES--IPCRTQSVREGDTVTL-SHPAATFHVLDVPGHTR 126

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 127 GHVAYVGRLQGPDARASLFC-GDTLFATGCGRLFEGTPAQMRLSLSKLAALPPDTRVYCA 185

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN--- 227
           HEYT +N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R +    
Sbjct: 186 HEYTASNVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSDEPAV 245

Query: 228 -TSLRKNLNMENASNLAVFTELRIRKN 253
             S+ ++  +     +A+F  LR  KN
Sbjct: 246 VASVARHAGIGTDDPVALFAALREWKN 272


>gi|207742896|ref|YP_002259288.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           IPO1609]
 gi|206594291|emb|CAQ61218.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           IPO1609]
          Length = 275

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NL-------KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKI---IATPGHTI 116
            L              + GP+ ES  IP     + +GDT    +HP  I   +  PGHT 
Sbjct: 70  ALVDAHPRDPSGAPLPVIGPVGES--IPCRTQSVREGDTVTL-AHPAAIFHVLDVPGHTR 126

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 127 GHVAYVGRLQGQDAPASLFC-GDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCA 185

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN--- 227
           HEYT +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +    
Sbjct: 186 HEYTASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTV 245

Query: 228 -TSLRKNLNMENASNLAVFTELRIRKN 253
             S+ ++  +     +AVF  LR  KN
Sbjct: 246 AASVARHAGIGMDDPVAVFAALREWKN 272


>gi|83747773|ref|ZP_00944807.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum UW551]
 gi|83725545|gb|EAP72689.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum UW551]
          Length = 342

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 79  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 136

Query: 67  NL-------KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKI---IATPGHTI 116
            L              + GP+ ES  IP     + +GDT    +HP  I   +  PGHT 
Sbjct: 137 ALVDAHPRDPSGAPLPVIGPVGES--IPCRTQSVREGDTVTL-AHPAAIFHVLDVPGHTR 193

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 194 GHVAYVGRLQGQDAPASLFC-GDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCA 252

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN--- 227
           HEYT +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +    
Sbjct: 253 HEYTASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTV 312

Query: 228 -TSLRKNLNMENASNLAVFTELRIRKN 253
             S+ ++  +     +AVF  LR  KN
Sbjct: 313 AASVARHAGIGMDDPVAVFAALREWKN 339


>gi|218682991|ref|ZP_03530592.1| hydroxyacylglutathione hydrolase [Rhizobium etli CIAT 894]
          Length = 134

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 92/132 (69%)

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           HF++D  L   DTLF+LGCGR+FE   A+M+ SL+K+    D+T +YFGHEYT +NA FA
Sbjct: 1   HFVDDKLLFAADTLFALGCGRLFERPAADMWHSLQKLAVLPDETAVYFGHEYTLSNARFA 60

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP N  L+    +++++R+   +T P+T+ LEK+ NPFLR  + ++R+NL ME  +N
Sbjct: 61  LTVDPGNERLKSRAGEIEALRADGKFTIPTTLGLEKETNPFLRAADPAIRRNLLMEGKTN 120

Query: 242 LAVFTELRIRKN 253
             VF E+R RK+
Sbjct: 121 EEVFAEIRKRKD 132


>gi|209917399|ref|YP_002291483.1| hydroxyacylglutathione hydrolase [Escherichia coli SE11]
 gi|226723994|sp|B6HZS5|GLO2_ECOSE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|209910658|dbj|BAG75732.1| putative hydroxyacylglutathione hydrolase [Escherichia coli SE11]
 gi|324020676|gb|EGB89895.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 117-3]
          Length = 251

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S+ K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSINKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|170078470|ref|YP_001735108.1| hydroxyacylglutathione hydrolase [Synechococcus sp. PCC 7002]
 gi|226724034|sp|B1XQ70|GLO2_SYNP2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169886139|gb|ACA99852.1| hydroxyacylglutathione hydrolase [Synechococcus sp. PCC 7002]
          Length = 259

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 136/256 (53%), Gaps = 10/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  ++DN+  L+ +      A +D  D  ++ + L ++   L  I  THHH DH   N
Sbjct: 4   IRLPAFNDNYIFLLVDRATGDCAVVDPGDAKVVLEYLSKEDLTLKTILITHHHADHVGGN 63

Query: 66  LNLKKFFNCTIFGPLE---ESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             L   F        E   +  +IPG    L  G+  D  +  ++I+  PGHT GHI Y+
Sbjct: 64  RQLLSHFPAAAVYGSEIDLQKRRIPGQTVSLKAGNHLDLFNRTVEILFVPGHTQGHIAYY 123

Query: 123 FM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           F      +   L  GDTLF+ GCGR+ E + A++F SL++I    D T+I+  HEYT  N
Sbjct: 124 FPPLQPEDSGDLFCGDTLFANGCGRLLEGTPAQLFASLQQICDLPDNTNIWCAHEYTLKN 183

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             F+L+ DP N  LQ+   +V++ R +   T P+ ++LEK+ NPFLR  +  L+ NL   
Sbjct: 184 IKFSLTVDPENEALQRRFQQVQTQRQRQKPTIPTVLALEKQTNPFLRCSDRQLQANLKTT 243

Query: 238 NASNLAVFTELRIRKN 253
           +   L VFT+LR +++
Sbjct: 244 DP--LRVFTKLRGKRD 257


>gi|227884791|ref|ZP_04002596.1| hydroxyacylglutathione hydrolase [Escherichia coli 83972]
 gi|300988190|ref|ZP_07178591.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 45-1]
 gi|301050547|ref|ZP_07197420.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 185-1]
 gi|331656202|ref|ZP_08357164.1| hydroxyacylglutathione hydrolase [Escherichia coli TA206]
 gi|331681593|ref|ZP_08382229.1| hydroxyacylglutathione hydrolase [Escherichia coli H299]
 gi|227838232|gb|EEJ48698.1| hydroxyacylglutathione hydrolase [Escherichia coli 83972]
 gi|300297755|gb|EFJ54140.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 185-1]
 gi|300407504|gb|EFJ91042.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 45-1]
 gi|307552059|gb|ADN44834.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli ABU
           83972]
 gi|315292138|gb|EFU51490.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 153-1]
 gi|315300181|gb|EFU59418.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 16-3]
 gi|331054450|gb|EGI26459.1| hydroxyacylglutathione hydrolase [Escherichia coli TA206]
 gi|331081167|gb|EGI52329.1| hydroxyacylglutathione hydrolase [Escherichia coli H299]
          Length = 251

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + D +T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDSETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|225710232|gb|ACO10962.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
          Length = 269

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 137/262 (52%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++ + I I   + DN+  +I + K R    +D  D  +++K ++E    LT I  THHH 
Sbjct: 13  LSGMTIEILPAFKDNYMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHHW 72

Query: 60  DHTRANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DH   N+ +K+ F +  I+G      +I G+ H +S GD     S       TP HT GH
Sbjct: 73  DHAGGNMKMKEMFPDIKIYG---GDDRIDGLTHKVSSGDVIHIDSLQFHCHFTPCHTQGH 129

Query: 119 ICYHFMN-DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTEN 176
           ICYHF   +  +  GDTLF  GCGR FE +  EM ++L E + S  ++T +Y GHEY+ N
Sbjct: 130 ICYHFSGLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEYSLN 189

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQN--LYTNPSTISLEKKVNPFLRIENTSLRKNL 234
           N  F    +P N  +    +  K  RS++    T PSTI  EK +NPF+R++  S+++  
Sbjct: 190 NLRFGAHVEPDNKVISDKIAWCKEKRSRDNPEPTVPSTIGEEKSINPFMRVDVESVQR-- 247

Query: 235 NMENASNLAVFTELRIRKNQSK 256
           + + +  +     LR  K+  K
Sbjct: 248 HTKTSDPIETMKALRDEKDNFK 269


>gi|17546234|ref|NP_519636.1| hydroxyacylglutathione hydrolase [Ralstonia solanacearum GMI1000]
 gi|17428531|emb|CAD15217.1| putative hydroxyacylglutathione hydrolase protein [Ralstonia
           solanacearum GMI1000]
          Length = 284

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 128/267 (47%), Gaps = 26/267 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 21  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 78

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK---IIATPGHTI 116
            L + +          + GP +ES  IP     + +GDT    SHP     ++  PGHT 
Sbjct: 79  ALVEAYPRDPSGAPLPVIGPADES--IPCRTQAVREGDTVTL-SHPAATFHVLDVPGHTR 135

Query: 117 GHICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
           GH+ Y              C GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  
Sbjct: 136 GHVAYVGRLQGPDAPASLFC-GDTLFATGCGRLFEGTPAQMRLSLSKLAALPPDTRVYCA 194

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT  N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R    ++
Sbjct: 195 HEYTAANVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSNEPAV 254

Query: 231 RKNLNMENA----SNLAVFTELRIRKN 253
             ++           +AVF  LR  KN
Sbjct: 255 AASVAQHAGIGVDDPVAVFAALREWKN 281


>gi|194749789|ref|XP_001957319.1| GF10361 [Drosophila ananassae]
 gi|190624601|gb|EDV40125.1| GF10361 [Drosophila ananassae]
          Length = 305

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 127/253 (50%), Gaps = 12/253 (4%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  LI + K R  A +D  +  ++ K + E+   L  +  THHH DH   N  L K 
Sbjct: 56  QDNYMYLIVDSKTREAAIVDPVEPELVIKTVEEEKVTLNKVLTTHHHWDHAGGNEKLVKL 115

Query: 72  F--NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM----- 124
           +     ++G      +I  ++H +   D+   G+  ++ ++TP HT GHICYH       
Sbjct: 116 WPKELEVYGG---DDRIGALNHKVQQDDSLTIGNLKVRCLSTPCHTTGHICYHVTAADGT 172

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALS 183
            +  +  GDTLF  GCGR FE +  EM+++L  K+ +  D T ++ GHEYT  N  FA  
Sbjct: 173 GEGAVFTGDTLFQGGCGRFFEGTPEEMYDALCTKLSALPDNTKVFCGHEYTLQNMSFARH 232

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+        ++
Sbjct: 233 VEPDNEIIQQRIEWAKHRRASQDPTVPSTIGEEKTWNPFMRVHEATVQKHAGGAT-DPIS 291

Query: 244 VFTELRIRKNQSK 256
           V   LR  K+  K
Sbjct: 292 VMGSLRKEKDTFK 304


>gi|196002599|ref|XP_002111167.1| hypothetical protein TRIADDRAFT_54858 [Trichoplax adhaerens]
 gi|190587118|gb|EDV27171.1| hypothetical protein TRIADDRAFT_54858 [Trichoplax adhaerens]
          Length = 337

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 134/262 (51%), Gaps = 15/262 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I++  DN+  LI +H  +L   +D  +  ++ + L+ +   L  I  TH H DH+  N  
Sbjct: 76  IAILDDNYAYLIIDHNLKLGILVDPSEPRLVQEALKAEDINLAAILITHGHWDHSGGNTI 135

Query: 68  LKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L K + +  I+G  E++  +P + H + DGD+   G+    +I TPGHT+GH+ Y     
Sbjct: 136 LHKLYPDIAIYGNSEDN--VPNLTHFVKDGDSIKIGTLVFDVIGTPGHTLGHVMYTLNRK 193

Query: 127 H-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  +  GD LF  GCGRIFE + A M +SL+++    DKT ++ GHEY  +N  FA
Sbjct: 194 EQGEPSSVFSGDHLFLAGCGRIFEGNGAMMLKSLDRLLELDDKTLVWPGHEYATSNLKFA 253

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ +P N  + +  +   S+R+    T PSTI  EK  NPFLR     + K L     ++
Sbjct: 254 IAVEPSNKAIIEKLTWADSLRNNCESTCPSTIGEEKSYNPFLRSHIPEISKTLGCPEQTD 313

Query: 242 -------LAVFTELRIRKNQSK 256
                    V + LR +KN  K
Sbjct: 314 YHNQNHRAEVVSLLRSKKNSFK 335


>gi|238755081|ref|ZP_04616428.1| Hydroxyacylglutathione hydrolase [Yersinia ruckeri ATCC 29473]
 gi|238706641|gb|EEP99011.1| Hydroxyacylglutathione hydrolase [Yersinia ruckeri ATCC 29473]
          Length = 271

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 138/251 (54%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + R    +D  +   +   L+EK W    I  THHH DH    
Sbjct: 24  ISIPAFQDNYIWLLVNRQQR-CLIVDPGEASPVLAELKEKKWTPEAILLTHHHHDHVGGV 82

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
           + L   + N  ++GP E + K  G    ++DGD          IIA PGHT+GHI Y+  
Sbjct: 83  VELLNHYPNLPVYGPQETAHK--GATIIVNDGDQLSLCGLDFTIIAVPGHTLGHIAYY-- 138

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE +  +M+ S++++ +  D T I   HEYT +N  FA + 
Sbjct: 139 SAPYLFCGDTLFSGGCGRLFEGTPQQMYASIQQLTALPDDTLICCAHEYTLSNLNFARTV 198

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P +  ++ Y  +++ +R++N  + PST+ LE+++N FLR  +  L++ L     SN   
Sbjct: 199 LPEDRRIETYQQQIRILRAKNQSSLPSTLQLEREINVFLRCNDVDLQRKLGFHPLSNDYS 258

Query: 243 AVFTELRIRKN 253
            VF ELR RK+
Sbjct: 259 LVFAELRARKD 269


>gi|239996322|ref|ZP_04716846.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii ATCC 27126]
          Length = 263

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 128/254 (50%), Gaps = 13/254 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   I+N    +   +D  D   +   ++ KG  L+ +  THHH DHT     
Sbjct: 15  IPAFTDNYIWCIYNESSAIV--VDPGDAEPVLTFIKAKGLTLSAVLITHHHRDHTGGIAK 72

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHFM 124
           L     +  + GP    + I GI   +S GDT         ++++  PGHT+ HI + F 
Sbjct: 73  LVSAVPDLPVIGP--RGNHIRGITKSVSQGDTVSLPVFKMALQVMEVPGHTLDHIAF-FG 129

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +    C GDTLFS GCGR+FE S  +M  SL K+K   D T ++  HEYT+ N  FAL+ 
Sbjct: 130 HGALFC-GDTLFSAGCGRLFEGSPEQMHHSLNKLKRLPDTTKVFCTHEYTQANVQFALAV 188

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--EN--AS 240
           +P N  L  Y   V   R+Q   T PS +  +K +NPFLR    S++       EN  A 
Sbjct: 189 EPDNKALCDYAQWVAEKRAQGQPTLPSNLKEQKNINPFLRAHELSVKTAAEAYCENNLAD 248

Query: 241 NLAVFTELRIRKNQ 254
           ++AVF  +R  K++
Sbjct: 249 DVAVFAAVRRWKDE 262


>gi|167902188|ref|ZP_02489393.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei NCTC
           13177]
          Length = 270

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 136/267 (50%), Gaps = 23/267 (8%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDG--RQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHRDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP----IKIIATPGHTIG 117
             L    ++     +FGP  E+  I  I   ++ G+    G+        +I  PGHT G
Sbjct: 65  AELLAGAREGEPIAVFGPAHEA--IEHITRRVAGGERVRIGAPAPALEFDVIDVPGHTRG 122

Query: 118 HICYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           HI Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  H
Sbjct: 123 HIAYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAH 181

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT +N  FAL+C+P N  L  +  +V + R++   T P+TI+ E  VNPFLR ++ S+R
Sbjct: 182 EYTLSNIQFALACEPGNAALAAWRDEVLARRARGEPTLPTTIAHECAVNPFLRADSASIR 241

Query: 232 KNLNM---ENASN-LAVFTELRIRKNQ 254
             L     E A + LA FT +R  KN+
Sbjct: 242 ATLEARLHEAAPDRLAAFTLMREWKNR 268


>gi|196000472|ref|XP_002110104.1| hypothetical protein TRIADDRAFT_20939 [Trichoplax adhaerens]
 gi|190588228|gb|EDV28270.1| hypothetical protein TRIADDRAFT_20939 [Trichoplax adhaerens]
          Length = 260

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 131/259 (50%), Gaps = 15/259 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I    DN+  L+ + K    A +D  +   +   +  +   LT +  THHH DH   N 
Sbjct: 5   VIPALQDNYMYLLTDPKTNQAAIVDPVEPEKVLAAVNNRKVDLTTVITTHHHWDHAGGND 64

Query: 67  NLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            L    +    ++G  E   +I  +   LS G+ F+ GS  IK +ATP HT GHICY F+
Sbjct: 65  KLVGMVSKKLKVYGGDE---RIGSLTEKLSGGEEFNIGSLVIKSLATPCHTSGHICY-FV 120

Query: 125 ND------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENN 177
           +D        +  GDTLF  GCGR FE + A+M+ +L  I       T +Y GHEY+ +N
Sbjct: 121 SDPNSQESAVVFTGDTLFVGGCGRFFEGTPAQMYNALCNILGKLPSSTRVYCGHEYSASN 180

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA+  +P N+++QK    VK  R+  L T PSTI+ E   NPF+R+   ++RK+   +
Sbjct: 181 LIFAIHVEPDNVDIQKKLEWVKKQRANRLVTVPSTIAEELSYNPFMRVNTNNVRKHTGKK 240

Query: 238 NASNLAVFTELRIRKNQSK 256
             S +     LR  KN  K
Sbjct: 241 --SGIEAMGYLREEKNNFK 257


>gi|59006535|emb|CAB70870.2| hypothetical protein [Homo sapiens]
          Length = 325

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 130/264 (49%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 62  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 121

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 122 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 179

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 180 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 239

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 240 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 299

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR+ K+  K
Sbjct: 300 PTGDDDYSRAQLLEELRLLKDMHK 323


>gi|296116638|ref|ZP_06835248.1| hydroxyacylglutathione hydrolase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976850|gb|EFG83618.1| hydroxyacylglutathione hydrolase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 242

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 120/231 (51%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I +  DN+   + +        +D  +   I   +   G  L  IF THHH DH  A   
Sbjct: 8   IPILEDNYAWFLRDPVTGACGVVDPAEEAPIIAAIAAYGGRLDRIFLTHHHADHIAAADV 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L+  +   + G   ++ ++P +D  + DGD    G+    +I TPGHT GH+ Y F    
Sbjct: 68  LRARYGALVIGAAADAHRLPPLDIAVKDGDNVALGAADAVVIDTPGHTRGHVSYFFPATP 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFS+GCGR+FE +  EMF SL +I +  D   I  GHEYT +NA FA+  DP 
Sbjct: 128 ALFCGDTLFSMGCGRLFEGTADEMFHSLRRIAALPDDMLICCGHEYTLSNARFAMHVDPA 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
           N+ + +    V+++R++++ T P T+  E++ NPFLR  +      L  E 
Sbjct: 188 NVAVAERMHAVQALRARDMPTLPVTLGEERRTNPFLRACDARALATLRQEK 238


>gi|328789071|ref|XP_623458.3| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           isoform 1 [Apis mellifera]
          Length = 302

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 121/224 (54%), Gaps = 8/224 (3%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KK 70
            DN+  LI +   +  A +D  D   ++  +++    LT +  THHH DH   N+ L KK
Sbjct: 57  QDNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHAGGNIKLCKK 116

Query: 71  FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH--- 127
           F N  ++G  E   +I  +   +   D F+ G   ++ ++TP HT GHICY+   +    
Sbjct: 117 FNNLQVYGGDE---RIEALTCKVKHNDIFNIGKLQVQCLSTPCHTTGHICYYITENQDVP 173

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +  GDTLF  GCGR FE +  +M+++L E + S  ++T +Y GHEYT NN  FA   +P
Sbjct: 174 AVFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNLKFAKHVEP 233

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
            N  +++    V+  R +N  + PSTI  EK  NPF+R+   S+
Sbjct: 234 ENEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSV 277


>gi|225709962|gb|ACO10827.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
          Length = 269

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 136/262 (51%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++ + I I   + DN+  +I + K R    +D  D  +++K ++E    LT I  THHH 
Sbjct: 13  LSGMTIEILPAFKDNYMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHHW 72

Query: 60  DHTRANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DH   N+ +K+ F +  I+G      +I G+ H +S GD     S       TP HT GH
Sbjct: 73  DHAGGNMKMKEMFPDIKIYG---GDDRIDGLTHKVSSGDVIHIDSLQFHCHFTPCHTQGH 129

Query: 119 ICYHFMN-DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTEN 176
           ICYHF   +  +  GDTLF  GCGR FE +  EM ++L E + S  ++T +Y GHEY+ N
Sbjct: 130 ICYHFSGLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEYSLN 189

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQN--LYTNPSTISLEKKVNPFLRIENTSLRKNL 234
           N  F    +P N  +    +  K  RS +    T PSTI  EK +NPF+R++  S+++  
Sbjct: 190 NLRFGAHVEPDNKVISDKIAWCKGKRSGDNPEPTVPSTIGEEKSINPFMRVDVESVQR-- 247

Query: 235 NMENASNLAVFTELRIRKNQSK 256
           + + +  +     LR  K+  K
Sbjct: 248 HTKTSDPIETMKALRDEKDNFK 269


>gi|330816258|ref|YP_004359963.1| Hydroxyacylglutathione hydrolase [Burkholderia gladioli BSR3]
 gi|327368651|gb|AEA60007.1| Hydroxyacylglutathione hydrolase [Burkholderia gladioli BSR3]
          Length = 268

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 129/265 (48%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +    +  A+D  D   + + L  +GW L  I  THHH DH    
Sbjct: 7   VPVPAFEDNYIWLVSDGSDAV--AVDPGDAAPVRRYLEARGWRLAAILLTHHHADHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L           ++GP  E   I  +   L+ G     G   ++  +   PGHT GHI
Sbjct: 65  AELLAHAADAGPVPVYGPAGED--IAQVSEPLAGGARVRIGKPALEFEVFDVPGHTRGHI 122

Query: 120 CY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +   +T ++  HEY
Sbjct: 123 AYFQAAGAGHPAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGETQVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +     + R++   T P+TI+ E+ VNPFLR ++ ++   
Sbjct: 182 TLSNIRFALACEPDNAALAAWRDDASARRARGEPTLPTTIAHERAVNPFLRADSAAIAAT 241

Query: 234 LNME----NASNLAVFTELRIRKNQ 254
           L  E     A  LA FT +R  KN+
Sbjct: 242 LEAELHEAPADRLAAFTLMREWKNR 266


>gi|24111643|ref|NP_706153.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 301]
 gi|30061764|ref|NP_835935.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 2457T]
 gi|82542805|ref|YP_406752.1| hydroxyacylglutathione hydrolase [Shigella boydii Sb227]
 gi|110804259|ref|YP_687779.1| hydroxyacylglutathione hydrolase [Shigella flexneri 5 str. 8401]
 gi|81723766|sp|Q83MC1|GLO2_SHIFL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123147256|sp|Q0T802|GLO2_SHIF8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123560514|sp|Q325T4|GLO2_SHIBS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24050416|gb|AAN41860.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 2a
           str. 301]
 gi|30040006|gb|AAP15740.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 2a
           str. 2457T]
 gi|81244216|gb|ABB64924.1| probable hydroxyacylglutathione hydrolase [Shigella boydii Sb227]
 gi|110613807|gb|ABF02474.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 5 str.
           8401]
 gi|281599563|gb|ADA72547.1| Hydroxyacylglutathione hydrolase [Shigella flexneri 2002017]
 gi|313646731|gb|EFS11190.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 2457T]
 gi|332761995|gb|EGJ92267.1| hydroxyacylglutathione hydrolase [Shigella flexneri 4343-70]
 gi|332764636|gb|EGJ94866.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-671]
 gi|332768611|gb|EGJ98792.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2930-71]
 gi|333008971|gb|EGK28430.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-218]
 gi|333022176|gb|EGK41416.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-304]
          Length = 251

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +I TPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVITTPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE +  +M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTALQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIF 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINGINEE 231


>gi|119944272|ref|YP_941952.1| hydroxyacylglutathione hydrolase [Psychromonas ingrahamii 37]
 gi|226724011|sp|A1SS88|GLO2_PSYIN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|119862876|gb|ABM02353.1| Hydroxyacylglutathione hydrolase [Psychromonas ingrahamii 37]
          Length = 256

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 130/254 (51%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  LI + + +    +D  D   +  +L ++   +  I  THHH DH    
Sbjct: 5   ITIKAFEDNYIWLIKDSQSQHCIIVDPGDAAPVLTILEDQKLIVDAILLTHHHYDHIGGV 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDF--GSHPIKIIATPGHTIGHICYHF 123
             L    +  I   +    K+      +++ DT  F  G   ++++  PGHT+ H+   F
Sbjct: 65  DALLSARDEKI--SIYSKKKLFDRCRLVNESDTLSFFDGKLSLQVMEVPGHTLDHVA--F 120

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            ND  L  GDTLFS GCGR+FE S+ +MF+++ ++    + T +Y  HEYT+NN  FA  
Sbjct: 121 YNDELLFCGDTLFSGGCGRVFEGSFEQMFKAVSRLALLPENTKVYCAHEYTQNNLIFAHQ 180

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS----LRKNLNMENA 239
            +P N  L  Y  +V   R Q   T PSTI LEK++NPFLR +  +    L+ +L  E  
Sbjct: 181 IEPKNKALLNYIQQVSKKRQQGQPTIPSTIGLEKEINPFLRCQQQTVINKLQSHLGKELN 240

Query: 240 SNLAVFTELRIRKN 253
             L+ F+ LR  K+
Sbjct: 241 DPLSCFSALRQYKD 254


>gi|320201193|gb|EFW75776.1| Hydroxyacylglutathione hydrolase [Escherichia coli EC4100B]
          Length = 251

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S  K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSFNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|253996676|ref|YP_003048740.1| hydroxyacylglutathione hydrolase [Methylotenera mobilis JLW8]
 gi|253983355|gb|ACT48213.1| hydroxyacylglutathione hydrolase [Methylotenera mobilis JLW8]
          Length = 262

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 124/251 (49%), Gaps = 5/251 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRA- 64
           I I  ++DN+  LIHN   R    +D  D   +   L++    L  I  THHH DH    
Sbjct: 12  IPIPAFNDNYLWLIHNQ--RKAIVVDPGDAAPVINTLKKLNLDLQTILITHHHQDHIGGV 69

Query: 65  NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            L L+ + N  +F P  E         G              K+I  PGHT+GHI Y+  
Sbjct: 70  ELLLRTYPNAEVFAPKLEHYPFKHTPVGEPQQVYLGDWVSSAKVIDVPGHTLGHIAYYIE 129

Query: 125 ND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           +D   +L  GDT+F  GCGR+FE + A+M  SL+K+ +    T +Y  HEYT +N  FAL
Sbjct: 130 HDAQQWLFCGDTMFGAGCGRLFEGTPAQMQASLQKLTALPASTQVYCTHEYTLHNISFAL 189

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P N  L K     K+  +    T PS ++LE   NPFLR     ++ +L+ EN + L
Sbjct: 190 TLEPGNASLIKRQQDAKARITSGQPTLPSNLALELATNPFLRCHMPEIQASLHTENTNLL 249

Query: 243 AVFTELRIRKN 253
             F+ +R  +N
Sbjct: 250 QTFSAMRGLRN 260


>gi|161504626|ref|YP_001571738.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189041226|sp|A9MPF3|GLO2_SALAR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160865973|gb|ABX22596.1| hypothetical protein SARI_02741 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 251

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 133/250 (53%), Gaps = 8/250 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  +++N + R    +D  +   + K + +  W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLNNDEGR-CVIVDPGEAAPVLKAIDDHKWIPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT     +   I ATPGHT+GHICY F +
Sbjct: 64  ELLQHFPQMTVYGPTETQDK--GATHLVGDGDTVLVLGYNFSIFATPGHTLGHICY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE +  +M++SL KI +  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTALQMYQSLMKINTLPDDTLICSAHEYTLANLKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           PH+  + +Y  KV  +R +   T P  +  E+K+N FLR E+  L   +N E       A
Sbjct: 180 PHDSFINEYYRKVNELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEA 239

Query: 244 VFTELRIRKN 253
            F  LR +K+
Sbjct: 240 RFAWLRSKKD 249


>gi|26246156|ref|NP_752195.1| hydroxyacylglutathione hydrolase [Escherichia coli CFT073]
 gi|81478436|sp|Q8FKY7|GLO2_ECOL6 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|26106553|gb|AAN78739.1|AE016755_239 Probable hydroxyacylglutathione hydrolase [Escherichia coli CFT073]
          Length = 251

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L KKF    ++GP E   K  G    + D +T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVKKFPQIVVYGPQETQDK--GTTQVVKDSETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|304413389|ref|ZP_07394862.1| putative hydroxyacylglutathione hydrolase [Candidatus Regiella
           insecticola LSR1]
 gi|304284232|gb|EFL92625.1| putative hydroxyacylglutathione hydrolase [Candidatus Regiella
           insecticola LSR1]
          Length = 258

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 136/252 (53%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ + +      +D  +   +  +L ++   +  I  THHH DH    
Sbjct: 11  ISIPALQDNYIWLLIDEQDH-CIIVDPGEASPVLAILNKRHLIVDAILLTHHHQDHLDGV 69

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L K F    ++GP E   K  G    + +GD    G     +IA PGHT+GHI Y+  
Sbjct: 70  PELLKHFPQIPVYGPRETEKK--GATKLIEEGDDLIIGRQNFSVIAVPGHTLGHIAYY-- 125

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           N  +L  GDTLFS GCGR+FE +  +M+ SL+KI    D T I  GHEYT +N  FA S 
Sbjct: 126 NAPYLFCGDTLFSAGCGRLFEGTGDQMYRSLQKIMQLPDDTLICGGHEYTLSNLAFARSI 185

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-LNMENASNLA 243
              + +++ Y  KV  +R++   + P+T+  E+++N FLR +   L+K  L  ++ ++L+
Sbjct: 186 LAEDKKIEAYQKKVMQLRAEKQPSLPTTLQWEREINIFLRCDEIELQKRVLGGKSLTSLS 245

Query: 244 -VFTELRIRKNQ 254
            VF+ LR+ K++
Sbjct: 246 LVFSALRMMKDR 257


>gi|296101377|ref|YP_003611523.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055836|gb|ADF60574.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 252

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 127/233 (54%), Gaps = 6/233 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+ I +     R    +D  +   + + ++E GW    I  THHH DHT   
Sbjct: 4   ISIPAFEDNY-IWVLVDDARRCVIVDPGEAAPVLQAIKENGWQPEAILLTHHHHDHTGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ +F +  ++GP E   K  GI   + +G           + ATPGHT+GH+C++  
Sbjct: 63  PELRARFPHLVVYGPAEAQDK--GITQVVEEGKNILIREWEFSVFATPGHTLGHLCFY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE +  +M++SL+KI +  D T I   HEYT  N  F+ S 
Sbjct: 119 SKPYLFCGDTLFSGGCGRLFEGTPTQMYQSLQKINALPDDTVICCAHEYTLGNMKFSASI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
            P + E+Q Y  KVK +R++N  T P  +  E+K+N FLR ++  L   +N E
Sbjct: 179 LPEDREIQDYYQKVKELRAKNQKTLPVILKNERKINLFLRTDDIDLINKINQE 231


>gi|238790136|ref|ZP_04633913.1| Hydroxyacylglutathione hydrolase [Yersinia frederiksenii ATCC
           33641]
 gi|238721805|gb|EEQ13468.1| Hydroxyacylglutathione hydrolase [Yersinia frederiksenii ATCC
           33641]
          Length = 251

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 137/252 (54%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  + + +  ML +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADSQ-KHCVIVDPGEAHPVLAMLNQGDYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L++ + N  ++GP E ++K  G    +   D          + A PGHT+GHI Y+  
Sbjct: 63  AELRRHYPNIPVYGPQETANK--GATVIVKGDDDLVIAGQNYHVFAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA   
Sbjct: 119 SKPYLFCGDTLFSAGCGRLFEGTAAQMYSSIQQLAQLPDETLICSAHEYTLANLKFARFI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNL 242
            P + ++  Y  ++  +R++NL + P  + +E+K+N FLR  +  L++ + +     S +
Sbjct: 179 LPSDHDIATYQQQIMQLRAKNLPSLPVKLQIERKINVFLRCNDVDLQRKIGVISPPESLV 238

Query: 243 AVFTELRIRKNQ 254
           +VF+ELR +K++
Sbjct: 239 SVFSELRAQKDR 250


>gi|91793376|ref|YP_563027.1| hydroxyacylglutathione hydrolase [Shewanella denitrificans OS217]
 gi|123166083|sp|Q12MM2|GLO2_SHEDO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91715378|gb|ABE55304.1| Hydroxyacylglutathione hydrolase [Shewanella denitrificans OS217]
          Length = 258

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 124/255 (48%), Gaps = 12/255 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  ++          +D      +   +      L  +  TH H DH     
Sbjct: 6   AIPAFNDNYFWIVRQADSNFAYVVDPGVAQPVIDYILAHDLILAGVLITHKHADHVGGIQ 65

Query: 67  NLKKFF--NCTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYH 122
            L+ F+  +  ++GP  E   I GI H + D  T         ++II  PGHT+GH  Y 
Sbjct: 66  GLQDFYQNSLPVYGPKAEG--IAGITHEIIDERTLCLPHLEANVEIIPVPGHTLGHHAY- 122

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
            + D   C GDTLFS+GCGRIFE S A+M  SL K+ S      IY  HEYT++N  FAL
Sbjct: 123 LIEDAIFC-GDTLFSVGCGRIFEGSAAQMLASLTKLASLPAHCKIYCAHEYTQSNINFAL 181

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNLNMEN 238
           +  P+N  L +Y S V   R+ N+ + PS +S E  VNPFLR       T++    N E 
Sbjct: 182 TVTPNNPNLLQYASWVAKARADNIPSLPSFLSTELAVNPFLRCHTYEVKTAVASQFNTEI 241

Query: 239 ASNLAVFTELRIRKN 253
              L  FT LR  K+
Sbjct: 242 NDELQTFTLLRKWKD 256


>gi|301755764|ref|XP_002913715.1| PREDICTED: probable hydrolase PNKD-like [Ailuropoda melanoleuca]
          Length = 385

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 118/236 (50%), Gaps = 8/236 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRWHQDCRVYGNPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L 
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALG 355


>gi|157147192|ref|YP_001454511.1| hydroxyacylglutathione hydrolase [Citrobacter koseri ATCC BAA-895]
 gi|166990453|sp|A8AKR2|GLO2_CITK8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|157084397|gb|ABV14075.1| hypothetical protein CKO_02971 [Citrobacter koseri ATCC BAA-895]
          Length = 251

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 129/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N++ R    +D  +   +   ++EK W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLSNNEGR-CLIVDPGEAAPVLNAIKEKNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F +  ++GP E   K  G    + DGD+     H   I ATPGHT+GHICY F +
Sbjct: 64  ELLQHFPHVVVYGPAETQDK--GTTRVVKDGDSALVLGHEFSIFATPGHTLGHICY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+KI +  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKISALPDDTLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+  + +Y  KV  +R++N  T P  +  E+K N FLR E+  L   +N E
Sbjct: 180 PHDSFINEYYRKVNELRAKNQITLPVILKNERKNNIFLRTEDPDLINEINKE 231


>gi|109100966|ref|XP_001089254.1| PREDICTED: probable hydrolase PNKD [Macaca mulatta]
 gi|90080856|dbj|BAE89909.1| unnamed protein product [Macaca fascicularis]
          Length = 385

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 360 PTGDDDCSRAQLLEELRRLKDMHK 383


>gi|145589205|ref|YP_001155802.1| hydroxyacylglutathione hydrolase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047611|gb|ABP34238.1| Hydroxyacylglutathione hydrolase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 269

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 120/233 (51%), Gaps = 15/233 (6%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IHN K  L   +D  D   + + L++ G  LT I  THHH DHT   L 
Sbjct: 12  IPAFDDNYIWCIHNGKSALV--VDPGDAVPVLEYLKQSGLRLTGILITHHHADHTGGILA 69

Query: 68  LKKFF--NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGHICYHF 123
           L      +  + GP    S IPG        D  +  S  I  ++   PGHT+ HI Y F
Sbjct: 70  LLDALGKDIPVIGP--AGSNIPGRTQIAKADDKIEITSPRISLQVYEVPGHTLSHIAY-F 126

Query: 124 MN------DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            N      +  L  GDTLF+ GCGR+FE +  +M +SL K  S    T +Y  HEYT +N
Sbjct: 127 ANMQANVVEPMLFCGDTLFASGCGRLFEGTPTQMTQSLAKFASLPKNTLVYCTHEYTLSN 186

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
             FAL+ +P+N+ L  +  + +++R Q L T P+T+  E +VNPF+R +   +
Sbjct: 187 IRFALAVEPNNVNLISWDEQARALRDQGLPTLPTTVGQELQVNPFMRCDQAEV 239


>gi|333009685|gb|EGK29135.1| hydroxyacylglutathione hydrolase [Shigella flexneri VA-6]
 gi|333010752|gb|EGK30178.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-272]
 gi|333021251|gb|EGK40504.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-227]
          Length = 251

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +I TPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVITTPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE +  +M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTALQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIF 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEE 231


>gi|323948754|gb|EGB44654.1| hydroxyacylglutathione hydrolase [Escherichia coli H252]
          Length = 251

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 127/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+++N FLR E   L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEYIDLINVINEE 231


>gi|50122264|ref|YP_051431.1| hydroxyacylglutathione hydrolase [Pectobacterium atrosepticum
           SCRI1043]
 gi|81644255|sp|Q6D1V5|GLO2_ERWCT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49612790|emb|CAG76240.1| probable hydroxyacylglutathione hydrolase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 251

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N   R    +D  +   +   L +       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKANR-CVIVDPGEASPVLNALDQNALLPEAILLTHHHNDHVGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L  + N  +FGP +E++K  G  + + +G+T    +    +I  PGHT GHI Y+  
Sbjct: 63  SEILNHYPNLPVFGP-KETAKC-GATYLVEEGNTVSLLNSEFSVIEVPGHTSGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           N  FL  GDTLFS GCGRIFE +  +M+ES++KI    D T +   HEYT +N  F+   
Sbjct: 119 NAPFLFCGDTLFSAGCGRIFEGTPKQMYESIQKIAELPDDTVVCCAHEYTLSNLRFSNDI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNL 242
            P + +++ Y  K+  +R ++  + P+T+ LE+++N FLR     L++ ++   EN  N 
Sbjct: 179 WPEDPDIESYLHKISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKISNEPENIENW 238

Query: 243 AVFTELRIRKN 253
            VF  LR +K+
Sbjct: 239 QVFKMLRSKKD 249


>gi|195378620|ref|XP_002048081.1| GJ11540 [Drosophila virilis]
 gi|194155239|gb|EDW70423.1| GJ11540 [Drosophila virilis]
          Length = 305

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 123/241 (51%), Gaps = 12/241 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI + K    A +D  D  ++ K +RE+   L  +  THHH 
Sbjct: 44  LDSMQVKILPALQDNYMYLIVDSKTHEAAVVDPVDPELVIKTVREENLKLNKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           DH   N  L K +     ++G      +I  +   +   DTF  G+  ++ ++TP HT G
Sbjct: 104 DHAGGNEKLVKLWTGELQVYG---GDDRIGAMTRKVRQDDTFTIGNLNVRCLSTPCHTSG 160

Query: 118 HICYHFM--NDH---FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGH 171
           HICYH    N H    +  GDTLF  GCGR FE +  EM+++L  K+ +  D T ++ GH
Sbjct: 161 HICYHVTASNSHDPGAVFTGDTLFQGGCGRFFEGTPQEMYDALCAKLSALPDDTKVFCGH 220

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+  T+++
Sbjct: 221 EYTLQNMSFARHVEPDNKCIQTRIEWAKLRRASKDPTVPSTIGEEKSWNPFMRVHETTVQ 280

Query: 232 K 232
           +
Sbjct: 281 Q 281


>gi|27479699|gb|AAO17226.1| GloB [Photorhabdus luminescens]
          Length = 250

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 135/252 (53%), Gaps = 9/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I +  DN+  L+ +   R    +D  ++  +   L+  GW    I  THHH DH    
Sbjct: 4   ISIPVLSDNYIWLLCDEN-RHVVIVDPTESQPVLDTLKSHGWIPDAILLTHHHHDHVGGV 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             +  +F    ++GP E  SK  G    +  GD+  FG    +II  PGHT+GHI   F 
Sbjct: 63  PGIIDRFPELPVYGPKETESK--GATMIVCGGDSIHFGHFSFQIIDVPGHTLGHIA--FY 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGR+FE +  +M+ SL KI    D T I   HEYT +N  FA + 
Sbjct: 119 QAPYLFCGDTLFSGGCGRLFEGTAEQMYASLSKIAELPDDTLICCAHEYTVSNMKFAHAV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNL- 242
            P N  + +Y  KV  MR  N  T P+T+  EKK+N FL+ ++  L++N+ +  N+  L 
Sbjct: 179 LP-NQTISEYQQKVTQMRESNQPTVPTTLQTEKKINIFLKCDDVDLQRNIGIVPNSQPLS 237

Query: 243 AVFTELRIRKNQ 254
           AVF +LR RK+Q
Sbjct: 238 AVFCQLRRRKDQ 249


>gi|281340234|gb|EFB15818.1| hypothetical protein PANDA_001557 [Ailuropoda melanoleuca]
          Length = 332

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 118/236 (50%), Gaps = 8/236 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 69  LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 128

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 129 RDLSRWHQDCRVYGNPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 186

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 187 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 246

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L 
Sbjct: 247 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALG 302


>gi|315126183|ref|YP_004068186.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas sp. SM9913]
 gi|315014697|gb|ADT68035.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas sp. SM9913]
          Length = 257

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 114/219 (52%), Gaps = 5/219 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D   +  +++ L +    L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTEHNNQAWVVDPGQSAPVTEHLAQYNLTLGGILITHHHYDHTDGVA 65

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L K++ N  ++GP   +S   GI   L++  T         II TPGHT+ HICY  +N
Sbjct: 66  QLVKQYPNVEVYGP--SNSPFKGITEPLNEDQTITVLGTSFNIITTPGHTLDHICY--VN 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D     GDTLFS GCGR+FE +  +M+ S  K+ +      +Y  HEYT+ N  FA + +
Sbjct: 122 DALAFTGDTLFSGGCGRLFEGTPEQMWHSFNKLSALPSDCKVYCTHEYTQANLAFAKAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           P N EL  Y  +V  +R+++  T PSTI  E K+NPF+R
Sbjct: 182 PRNPELLAYSQQVDELRNKDEITLPSTIGHELKINPFMR 220


>gi|297669417|ref|XP_002812893.1| PREDICTED: probable hydrolase PNKD isoform 1 [Pongo abelii]
          Length = 385

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 300 FAGVVEPDNLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 360 PTGDDDCSRAQLLEELRRLKDMHK 383


>gi|298704758|emb|CBJ28354.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 255

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 85/253 (33%), Positives = 128/253 (50%), Gaps = 8/253 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DNF  L+ +    +TAA+D  +   + K+  ++G  ++ +  TH H DH   N
Sbjct: 4   IVVPVLDDNFAYLLSD-AAGVTAAVDPAEADKVLKVANDQGLTISKVLTTHKHHDHAGGN 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             + ++     I G   E  ++ G    + DGDT   G   +K I T GHT+GHICY+  
Sbjct: 63  NAIARRITGLEIVGG--EIDRVQGATRTVKDGDTLRVGGISVKCIHTSGHTMGHICYYAT 120

Query: 125 NDHFLCV--GDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFA 181
                 V  GDTLF  G GR FE +  EM  SL +K+     +T +Y GHEYT +N  FA
Sbjct: 121 EGEQKAVFTGDTLFVGGAGRFFEGTPEEMQHSLGDKLGKLPPETLVYCGHEYTSSNYLFA 180

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS- 240
            S DP N +L++  +       +  +T PSTI+ E   NPF+R    S++    + + S 
Sbjct: 181 QSLDPENEDLKREVAIASERLRKGEHTVPSTIAKELATNPFMRAHEPSIQARAGLGDGST 240

Query: 241 NLAVFTELRIRKN 253
             AV  ++R  KN
Sbjct: 241 TAAVLGKIRKMKN 253


>gi|297669419|ref|XP_002812894.1| PREDICTED: probable hydrolase PNKD isoform 2 [Pongo abelii]
          Length = 361

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 98  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 157

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 158 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 215

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 216 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 275

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 276 FAGVVEPDNLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 335

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 336 PTGDDDCSRAQLLEELRRLKDMHK 359


>gi|238921065|ref|YP_002934580.1| hydroxyacylglutathione hydrolase, [Edwardsiella ictaluri 93-146]
 gi|259492010|sp|C5BEP2|GLO2_EDWI9 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|238870634|gb|ACR70345.1| hydroxyacylglutathione hydrolase, putative [Edwardsiella ictaluri
           93-146]
          Length = 251

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 131/255 (51%), Gaps = 16/255 (6%)

Query: 6   IAISLYHDNFCILIHNHKYR---LTAAIDAPDT-YIISKMLREKGWFLTHIFNTHHHIDH 61
           I +    DN+  L+ N +++   +   + AP   Y+    +  K   LTH     HH DH
Sbjct: 4   IGLPTLQDNYIWLLINPQHQCLIVDPGVAAPVLHYLTENRITPKAILLTH-----HHNDH 58

Query: 62  TRANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
                 + + +    ++GP E   +  G    ++D DT       I I+A PGHT+GH+ 
Sbjct: 59  VGGVAEIVQAYPEMPVYGPAETQGQ--GCTQVVADNDTLSLLGCQISIMALPGHTLGHMA 116

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  +  +L  GDTLFS GCGR+FE S  +MF+SL++I    D T +   HEYTE+N  F
Sbjct: 117 YY--SAPYLFCGDTLFSAGCGRLFEGSAQQMFDSLQRIIQLPDNTLVCCAHEYTESNLRF 174

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A    P N E++ Y   V  +R++   T PST+ +E ++NPFLR  +  L++N+      
Sbjct: 175 ARHVLPKNREIETYQQHVTILRAKQQPTVPSTLRIEMEINPFLRCYDYDLQRNVGFPTQP 234

Query: 241 N--LAVFTELRIRKN 253
           N    VF  LR  K+
Sbjct: 235 NEIWRVFACLRNMKD 249


>gi|296205570|ref|XP_002749825.1| PREDICTED: probable hydrolase PNKD [Callithrix jacchus]
          Length = 385

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 127/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRMERKGTCPSTLGEERSYNPFLRTHCLELQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 360 PTGDDECSRAQLLEELRRLKDMHK 383


>gi|113868432|ref|YP_726921.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
 gi|113527208|emb|CAJ93553.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
          Length = 268

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 120/237 (50%), Gaps = 18/237 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IH+      A +D  +   + + L + G  L  I  THHH DH      
Sbjct: 9   IPAFQDNYIWAIHDGHS--AAVVDPGEAAPVERFLAQSGLALGAIVITHHHGDHQGGVAE 66

Query: 68  LKKFFNCT-------IFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIGH 118
           L      T       + GP  E  +I G    L +GD  T +  +  ++++  PGHT GH
Sbjct: 67  LLAAHPRTSSGAPMPVLGPAGE--RIGGRTRALREGDVVTLETPALTLRVLDVPGHTAGH 124

Query: 119 ICY----HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
           I Y            C GDTLF+ GCGR+FE + A+M +SL+K+ +    T +Y  HEYT
Sbjct: 125 IAYVGDLGEAGPAVFC-GDTLFASGCGRLFEGTPAQMLDSLDKLAALPGDTRVYCAHEYT 183

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
            +N  FA + +P N  L  +  +V ++R+ +  T P+TI+ E++VNPFLR    ++R
Sbjct: 184 RSNVRFARAVEPANAALAAWEQRVDALRAADQPTLPTTIAHEREVNPFLRSREPAVR 240


>gi|304311302|ref|YP_003810900.1| Putative hydroxyacylglutathione hydrolase GloB [gamma
           proteobacterium HdN1]
 gi|301797035|emb|CBL45248.1| Putative hydroxyacylglutathione hydrolase GloB [gamma
           proteobacterium HdN1]
          Length = 288

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 127/263 (48%), Gaps = 14/263 (5%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++S  I A+  + DN+  L+HN +  +   +D  D   +   L      L+ I+ THHH 
Sbjct: 28  LSSFQIKALPAFQDNYVWLLHNTQSAVV--VDPGDAGPVLSALNASALSLSEIWITHHHA 85

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD-FGSHPIKIIATPGHTIGH 118
           DH      L+  F   I      +S +PG      DGD F  FG H +++   PGHTI H
Sbjct: 86  DHIGGVAELQTAFPSVIIR-TPAASTLPGNAISQQDGDEFSLFGQHTVQVWHLPGHTIDH 144

Query: 119 ICYHFMND----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
           I Y         H  C GDTLF  GCGR+F  +  +++ SL++I      T IY  HEYT
Sbjct: 145 IVYLLKAAGEPIHLFC-GDTLFGAGCGRLFGGTANQLYTSLQRISQLPSDTKIYCAHEYT 203

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE----NTSL 230
           ++N  FA + +P N  LQ     V + R++   T P +++ E   NPFLRI      TS+
Sbjct: 204 QSNLRFAQAVEPENGALQSRIQTVTAQRARGEKTVPLSLAEELATNPFLRISVPTVTTSI 263

Query: 231 RKNLNMENASNLAVFTELRIRKN 253
            K+  +       +F  LR  K+
Sbjct: 264 LKHFIISVTQPTELFAFLRKWKD 286


>gi|195127700|ref|XP_002008306.1| GI13415 [Drosophila mojavensis]
 gi|193919915|gb|EDW18782.1| GI13415 [Drosophila mojavensis]
          Length = 301

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI + K +  A +D  D  ++ K ++E    L  +  THHH 
Sbjct: 40  LDSMQVKILPALQDNYMYLIVDSKTKEAAVVDPVDPELVIKTVKESNVKLNKVLTTHHHW 99

Query: 60  DHTRANLNLKKFFN--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           DH   N  L K ++    ++G  E   +I  ++H +   +TF  G+  ++ ++TP HT G
Sbjct: 100 DHAGGNERLVKMWDGKLEVYGGDE---RIGAMNHKVCQDETFTIGTLKVRCLSTPCHTSG 156

Query: 118 HICYHFMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGH 171
           HICY+    +      +  GDTLF  GCGR FE +  EM+++L  K+ +  D T ++ GH
Sbjct: 157 HICYYVTATNGNEAGAVFTGDTLFQGGCGRFFEGTPEEMYDALCAKLSALPDDTKVFCGH 216

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+   +++
Sbjct: 217 EYTLQNMSFARHVEPDNKNVQNRIEWAKLRRATKDPTVPSTIGEEKLWNPFMRVHEATVQ 276

Query: 232 KNLNMENASNLAVFTELRIRKNQSK 256
            +  + +A+ +     LR  K+  K
Sbjct: 277 NHAGI-SANPIGTMEALRKEKDNFK 300


>gi|238759157|ref|ZP_04620325.1| Hydroxyacylglutathione hydrolase [Yersinia aldovae ATCC 35236]
 gi|238702573|gb|EEP95122.1| Hydroxyacylglutathione hydrolase [Yersinia aldovae ATCC 35236]
          Length = 251

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 136/252 (53%), Gaps = 8/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADSQ-KQCVIVDPGESAPVLAALSQDQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L + F N  ++GP E + K  G    +  GD+         IIA PGHT+GHI Y+  
Sbjct: 63  ADLCRHFPNIPVYGPQETADK--GATEIVKGGDSLTINGRNHTIIAVPGHTLGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE +  +M+ S++++    D T I   HEYT  N  FA   
Sbjct: 119 SKPYLFCGDTLFSAGCGRLFEGTPEQMYASIQQLAQLPDDTLICSAHEYTLANLKFARFI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P + ++  Y  K+  +R++N  + P  + +E+++N FLR  +  L++ + + +  +  +
Sbjct: 179 LPADHDIATYQQKIMQLRAKNQPSLPVKLQIEREINVFLRCNDIDLQRKIGVMSPPDSLI 238

Query: 243 AVFTELRIRKNQ 254
           +VF+ELR +K++
Sbjct: 239 SVFSELRAQKDR 250


>gi|22209034|gb|AAH36457.1| Paroxysmal nonkinesigenic dyskinesia [Homo sapiens]
          Length = 385

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 360 PTGDDDYSRAQLLEELRRLKDMHK 383


>gi|326317359|ref|YP_004235031.1| hydroxyacylglutathione hydrolase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374195|gb|ADX46464.1| Hydroxyacylglutathione hydrolase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 258

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 125/257 (48%), Gaps = 12/257 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+   R  A +D  +   + + L+  G  L  I  THHH DH    
Sbjct: 2   LPLPAFTDNYIWMLHDG--RSAAVVDPGEAGPVLQALQRHGLALQAILVTHHHGDHVGGV 59

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     ++GP  ES  IP     L+DG T         +I  PGHT GHI Y+  +
Sbjct: 60  AALREATGALVYGPARES--IPQPAQPLADGGTLQVLGLQFSVIDVPGHTAGHIAYYAAD 117

Query: 126 DH---FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +   +T +   HEYT +N  FA 
Sbjct: 118 AAGGPLLFCGDTLFSGGCGRLFEGTPAQMQHSLDRLGALPPETRVCCAHEYTLSNLAFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-----E 237
           + +P N  L +Y    +++R+    T PS +  E  VNPFLR     + +         +
Sbjct: 178 AVEPGNTALLQYSHDCEALRAAGQPTLPSRLGTEHAVNPFLRTREPGVARAAQAFAPGTD 237

Query: 238 NASNLAVFTELRIRKNQ 254
            A   +V   LR  KN+
Sbjct: 238 TADPASVLAALRQWKNE 254


>gi|109898214|ref|YP_661469.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas atlantica T6c]
 gi|109700495|gb|ABG40415.1| Hydroxyacylglutathione hydrolase [Pseudoalteromonas atlantica T6c]
          Length = 257

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 132/261 (50%), Gaps = 14/261 (5%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+SL I  I  + DN+   + N +      +D  D   + K        LT I  THHH 
Sbjct: 1   MSSLKIRPIKAFEDNYIWCLINGE--TCTVVDPGDAKPVIKFCSRNNLTLTDILITHHHS 58

Query: 60  DHTRA-NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTI 116
           DHT   N  L+ F N  ++GP  ++ +I  I   L  GDT    S  +  K++  PGHT+
Sbjct: 59  DHTGGVNDLLQAFENVNVYGP--QNPQIQSITQRLQAGDTVQLPSLDVEFKVLEVPGHTL 116

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            HI Y  +    L  GDTLFS GCGR+FE +  +M++SL ++ + +D T +Y  HEYT  
Sbjct: 117 DHIAY--VGSCGLFCGDTLFSAGCGRLFEGTPQQMYQSLGQLTALADDTKVYCTHEYTLA 174

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P+N  L  Y    +S R     T PSTI  +K +NPFLR  +  + ++   
Sbjct: 175 NIKFAQAAEPNNEALLNYKGWAESQRVDLKPTLPSTIGQQKAINPFLRASSKEVIQHAEH 234

Query: 237 ENASNLA----VFTELRIRKN 253
                LA    VFT LR  K+
Sbjct: 235 YAGRTLATPESVFTALRAWKD 255


>gi|94311144|ref|YP_584354.1| beta-lactamase-like protein [Cupriavidus metallidurans CH34]
 gi|226724012|sp|Q1LL91|GLO2_RALME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|93354996|gb|ABF09085.1| hydroxyacylglutathione hydrolase [Cupriavidus metallidurans CH34]
          Length = 266

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 127/263 (48%), Gaps = 23/263 (8%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+   IH+      A +D  +   + + L ++G  L  I  THHH DH     +
Sbjct: 7   IPAFQDNYIWAIHDGHS--AAVVDPGEAAPVEQFLAQRGLALGAIVITHHHGDHQGGVSD 64

Query: 68  L-------KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI---KIIATPGHTIG 117
           L              + GP  +  +I      + +GDT     HP    +++  PGHT G
Sbjct: 65  LLARHPSGPNGEPLPVIGP--QGERIGHRTQAVREGDTVTL-RHPAVTFRVLDVPGHTAG 121

Query: 118 HICY----HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           H+ Y            C GDTLF+ GCGR+FE + A+M  SL+K+ +    T +Y  HEY
Sbjct: 122 HVAYVGDLPGAGPVVFC-GDTLFASGCGRLFEGTPAQMLASLDKLAALPGDTRVYCAHEY 180

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FA + +P N +L  + ++V  +R     T P+T++ E+ VNPFLR   +++R+ 
Sbjct: 181 TRSNVRFAQAVEPANPDLAAWAARVDILREAGTPTVPTTVAHERAVNPFLRSRESTVRQA 240

Query: 234 LNMENA---SNLAVFTELRIRKN 253
           +  +      + A F  LR  K+
Sbjct: 241 VRAQGGDVSGDAAAFGALRGWKD 263


>gi|116642887|ref|NP_056303.3| probable hydrolase PNKD isoform 1 precursor [Homo sapiens]
 gi|158563846|sp|Q8N490|PNKD_HUMAN RecName: Full=Probable hydrolase PNKD; AltName:
           Full=Myofibrillogenesis regulator 1; Short=MR-1;
           AltName: Full=Paroxysmal nonkinesiogenic dyskinesia
           protein; AltName: Full=Trans-activated by hepatitis C
           virus core protein 2
 gi|119591008|gb|EAW70602.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_a [Homo sapiens]
 gi|119591012|gb|EAW70606.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_a [Homo sapiens]
 gi|158260757|dbj|BAF82556.1| unnamed protein product [Homo sapiens]
 gi|168269718|dbj|BAG09986.1| myofibrillogenesis regulator 1 isoform 1 [synthetic construct]
          Length = 385

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 360 PTGDDDYSRAQLLEELRRLKDMHK 383


>gi|6330255|dbj|BAA86498.1| KIAA1184 protein [Homo sapiens]
          Length = 380

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 117 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 176

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 177 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 234

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 235 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 294

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 295 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 354

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 355 PTGDDDYSRAQLLEELRRLKDMHK 378


>gi|21703352|ref|NP_072094.1| probable hydrolase PNKD isoform 2 [Homo sapiens]
 gi|12804161|gb|AAH02937.1| Paroxysmal nonkinesigenic dyskinesia [Homo sapiens]
 gi|37182625|gb|AAQ89113.1| AWQG2491 [Homo sapiens]
 gi|117644974|emb|CAL37953.1| hypothetical protein [synthetic construct]
 gi|117645160|emb|CAL38046.1| hypothetical protein [synthetic construct]
 gi|119591009|gb|EAW70603.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_b [Homo sapiens]
          Length = 361

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 98  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 157

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 158 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 215

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 216 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 275

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 276 FAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 335

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 336 PTGDDDYSRAQLLEELRRLKDMHK 359


>gi|262276483|ref|ZP_06054292.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
 gi|262220291|gb|EEY71607.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
          Length = 252

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 137/252 (54%), Gaps = 10/252 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  ++DN+  L+ N        +D  D   +   L +    L  +  THHH DH     
Sbjct: 6   SIPAFNDNYIWLLKNDDNH-CVVVDPGDAAPVLSTLNQMKLTLDGVLVTHHHHDHIGGIQ 64

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L+K F + TI+GP  +S + P + H L DGD F   +     I  PGHT+ HI Y+   
Sbjct: 65  QLQKAFPDLTIYGP--DSDRFPMVTHPLKDGDRFTLFNTLFTTIQVPGHTLDHIAYY--A 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  L  GDTLFS GCGR+FE +  +M +SL ++ S  D T ++  HEYT +N  FA + +
Sbjct: 121 EGMLFSGDTLFSGGCGRLFEGTPTQMHQSLTRLASLPDDTQVFCAHEYTLSNLEFAHAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-- 243
           P+N+ L  Y    K +R++N  T PS+I LEK++NPFLR    S+ K+  ++ AS+L   
Sbjct: 181 PNNIALNDYIIDAKKVRAKNQPTLPSSIGLEKRINPFLRSHIDSV-KDAVVQRASDLTDI 239

Query: 244 -VFTELRIRKNQ 254
             F  LR  K++
Sbjct: 240 ETFAALRRWKDE 251


>gi|293413467|ref|ZP_06656116.1| hydroxyacylglutathione hydrolase [Escherichia coli B185]
 gi|291433525|gb|EFF06498.1| hydroxyacylglutathione hydrolase [Escherichia coli B185]
          Length = 251

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 126/232 (54%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+      H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTRVVKDGEIAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+L +  Y  KVK +R++N  T P  +  E+ +N FLR E+  L   +N E
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERHINVFLRTEDIDLINVINEE 231


>gi|121998366|ref|YP_001003153.1| hydroxyacylglutathione hydrolase [Halorhodospira halophila SL1]
 gi|226723999|sp|A1WXD9|GLO2_HALHL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|121589771|gb|ABM62351.1| Hydroxyacylglutathione hydrolase [Halorhodospira halophila SL1]
          Length = 255

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 124/260 (47%), Gaps = 10/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MTS +   +L  DN+  +  +       A+D  D  ++   L +    L  +  THHH D
Sbjct: 1   MTSADPLAALA-DNYIWMARDASGTTAFAVDPGDAAVVEAWLHDHQLRLAAVLVTHHHGD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDF-GSHPIKIIATPGHTIGHI 119
           HT     L +     +FGP  E+  IP +DH ++ G+ F   G    +++  PGHT GHI
Sbjct: 60  HTGGVAELAERHRVPVFGPATET--IPTVDHPITGGEHFSLEGFGEFRVLDCPGHTAGHI 117

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y  + +  L  GD LF+ GCGR+FE +  +M  SL+ + +    T +  GHEYT  N  
Sbjct: 118 AY--LWEGHLFSGDALFAGGCGRVFEGTAGQMHASLQHLAALPADTRVCCGHEYTVKNLE 175

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA   DP N  L +     +  R+    T PST++ E   NPFLR +   LR+       
Sbjct: 176 FAHCADPKNDRLAQRLQAARDARAAGQPTVPSTLAEELATNPFLRTDCPELRRAAQDWCG 235

Query: 240 SNL----AVFTELRIRKNQS 255
            +L     VF  LR  K+ +
Sbjct: 236 RDLDQAYEVFATLRRWKDTT 255


>gi|324515767|gb|ADY46309.1| Hydroxyacylglutathione hydrolase [Ascaris suum]
          Length = 256

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 126/247 (51%), Gaps = 10/247 (4%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+ +   R  A +D  D   I   ++  G  L+    THHH DH      L   +
Sbjct: 11  DNYMYLLIDENTRQAAIVDPVDVPAIRSAVQSAGAELSAALVTHHHWDHAGETAGLSNSY 70

Query: 73  N--CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN---DH 127
                I+G  +  SK+    + + DGD F  GS  +  + TP HT GHICY+ ++     
Sbjct: 71  GNRLAIYGGDDRISKL---TNKVKDGDKFKIGSLEVTCLFTPCHTRGHICYYVVDTSGKK 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +  GDTLF  GCGR FE +  EM  +L EK+ S  D T +Y GHEYT  N  FA S +P
Sbjct: 128 AVFTGDTLFIGGCGRFFEGNATEMHSALNEKLASLPDDTEVYCGHEYTVTNLRFAHSVEP 187

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N E+ K  +  K+ + ++  T PSTI  EK+ NPF+R+  +   + L  ++   +AV  
Sbjct: 188 SNEEVSKKLAWSKAKQERHEPTVPSTIGEEKRFNPFMRVAVSEELQKL-AKSTDPVAVMA 246

Query: 247 ELRIRKN 253
            +R  KN
Sbjct: 247 VIREMKN 253


>gi|187929118|ref|YP_001899605.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|187726008|gb|ACD27173.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
          Length = 279

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 137/266 (51%), Gaps = 24/266 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIG 117
            L   +          + GP +ES  IP     + +GD  T    +   ++I  PGHT G
Sbjct: 74  ELLAAYPENPEGAPLQVIGPADES--IPCRTQAVREGDVVTLTQPAATFRVIDVPGHTSG 131

Query: 118 HICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           H+ Y      +  +    C GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  H
Sbjct: 132 HVAYVGRLQGNAASASLFC-GDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAH 190

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT--- 228
           EYT +N  FA + +P N +L  +  +V ++R++   T P+T+  E+  NPF+R ++    
Sbjct: 191 EYTASNVRFARAVEPGNADLAAWEDEVAALRAEGRSTVPTTVGHERATNPFMRSDDANVT 250

Query: 229 -SLRKNLNMENASNLAVFTELRIRKN 253
            ++ ++  ++    +AVF  LR  KN
Sbjct: 251 QAVARHAGIDADDPVAVFAALRQWKN 276


>gi|297538711|ref|YP_003674480.1| hydroxyacylglutathione hydrolase [Methylotenera sp. 301]
 gi|297258058|gb|ADI29903.1| hydroxyacylglutathione hydrolase [Methylotenera sp. 301]
          Length = 260

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 125/251 (49%), Gaps = 7/251 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+HN      A +D  D   +   L      LT I  THHH DH    
Sbjct: 12  IPIPAFKDNYIWLVHNDAQ--GAVVDPGDAAPVIAALNHLKLTLTTILITHHHHDHIGGV 69

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYH 122
             L + F    ++ P  E      I   +S+ ++       I   I+  PGHT GHI Y+
Sbjct: 70  AELLEAFPQAIVYAPALEQYAFEHI--AISEQNSVHLKDLNISFSILDLPGHTSGHIAYY 127

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 +  GDTLF  GCGR+FE +  +M+ SL+K+ +    T +Y  HEYT +N  FAL
Sbjct: 128 SAQHKLIFCGDTLFGAGCGRLFEGTPTQMYHSLQKLAALPSATKVYCTHEYTMHNINFAL 187

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P N  L +     + +R  N+ + PSTI LE   NPFLR  +  ++ ++ + NAS +
Sbjct: 188 TFEPSNQILIERHKNTQKLRDSNIPSLPSTIELELATNPFLRCNHQEIKSSIQLTNASEI 247

Query: 243 AVFTELRIRKN 253
             FT+LR  +N
Sbjct: 248 ETFTKLRELRN 258


>gi|198282701|ref|YP_002219022.1| hydroxyacylglutathione hydrolase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667304|ref|YP_002424893.1| hydroxyacylglutathione hydrolase, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247222|gb|ACH82815.1| hydroxyacylglutathione hydrolase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519517|gb|ACK80103.1| hydroxyacylglutathione hydrolase, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 250

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 114/206 (55%), Gaps = 10/206 (4%)

Query: 52  IFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIAT 111
           I  THHH DHT     L ++F   ++G    + +IPG+ H +++G      +  + ++  
Sbjct: 48  ILCTHHHADHTGGVEALAQYFGIPVYG---ANRRIPGLTHAVAEG-RLTLDAETLTVLEV 103

Query: 112 PGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           PGHT  HI Y + N   L  GDTLF+ GCGR+FE + A+MF SL+++ +  D T +Y  H
Sbjct: 104 PGHTRDHIAYWWEN--VLFCGDTLFAAGCGRLFEGTAAQMFHSLQRLAALPDHTAVYCAH 161

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   DP N  + +   +  + R++N  T PS ++LE+  NPFLR    +L 
Sbjct: 162 EYTLTNLRFAAQADPDNPVIVQRQKEAIAQRARNEPTLPSDMALERASNPFLRCREPALI 221

Query: 232 KNLNMENASN----LAVFTELRIRKN 253
           ++ N  + +     + VF+ LR  K+
Sbjct: 222 RSANAFDPATGDDPVRVFSALRRWKD 247


>gi|254491233|ref|ZP_05104414.1| metallo-beta-lactamase superfamily protein [Methylophaga
           thiooxidans DMS010]
 gi|224463746|gb|EEF80014.1| metallo-beta-lactamase superfamily protein [Methylophaga
           thiooxydans DMS010]
          Length = 256

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 128/257 (49%), Gaps = 18/257 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  LI     +    +D  D   + + + +       I  THHH DH      
Sbjct: 7   VPAFQDNYIWLIQAKNSQKILIVDPGDAIPVIEAINQHNLQPVAILITHHHADHIGGIPA 66

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF----DFGSHPIKIIATPGHTIGHICYHF 123
           L + FN  ++GP  E+  IP I H L+  D      DF     +++ TPGHT GHICY  
Sbjct: 67  LLEQFNVPVYGPAAEN--IPMISHPLNALDELHIDPDFPC--FQVLDTPGHTAGHICYLA 122

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            N  F   GDTLF+ GCGR+   +  ++F+SL+++ +    T IY  HEYTE N  FA +
Sbjct: 123 ANKLF--CGDTLFAGGCGRLLGGTATDLFDSLQRLSNLPADTEIYCAHEYTEANLRFAKA 180

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN------ME 237
            + +N +L     + +  R  N  T PS ++ E   NPFLR  N ++++         ++
Sbjct: 181 VEKNNRDLDSRIKQTRQQREDNQATVPSLLAEELATNPFLRSHNPNVKRAAEHYAGHPLD 240

Query: 238 NASNLAVFTELRIRKNQ 254
           NA   AVFT LR  K+Q
Sbjct: 241 NAE--AVFTTLRQWKDQ 255


>gi|317490805|ref|ZP_07949241.1| hydroxyacylglutathione hydrolase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920352|gb|EFV41675.1| hydroxyacylglutathione hydrolase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 251

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 127/251 (50%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D      +   L E       I  THHH DH    
Sbjct: 4   ISIPAMQDNYIWLLANEQ-RECLIVDPGVASPVLHYLTENKLTPKAILLTHHHNDHVGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L+ + + T++GP E  +   G    +   D          ++  PGHT+GHI Y+ M
Sbjct: 63  GEILQNYPDITVYGPQETVNH--GCTQQVQGHDEITVLGLNFSVLDVPGHTLGHIAYYAM 120

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGRIFE +  +M+ SL+ I    D T I   HEYTE+N  FA   
Sbjct: 121 P--YLFCGDTLFSAGCGRIFEGTPEQMYASLQLIAQLPDNTLICCAHEYTESNLRFARYV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P N E++ Y  +VK +R ++  + PS + +EK++NPFLR  +  L++N+  EN  N   
Sbjct: 179 LPENKEIETYQKQVKELRLKHQPSVPSLLKIEKEINPFLRCYDNDLQRNIGFENHPNETW 238

Query: 243 AVFTELRIRKN 253
            VF  LR  K+
Sbjct: 239 QVFARLRDMKD 249


>gi|227112972|ref|ZP_03826628.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 251

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/251 (34%), Positives = 133/251 (52%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEAPPVLNALVQHSLVPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
           + L K + N  +FGP +E++K  G    + +G+T    +    +I  PGHT GHI Y+  
Sbjct: 63  IELLKHYPNLPVFGP-KETAKC-GATCLVEEGNTVSLLNSEFSVIEVPGHTSGHIAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  FL  GDTLFS GCGRI E    +M+ES++KI  F D T +   HEYT +N  F+ + 
Sbjct: 119 SAPFLFCGDTLFSAGCGRILEGEPRQMYESIQKIAEFPDDTIVCCAHEYTLSNLRFSNTI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNL 242
            P +  ++ Y  ++  +R ++  T P+T+ LE+++N FLR     L+K L+ E  N  N 
Sbjct: 179 LPEDPIIEAYLHEISQIREKSQSTLPTTLGLERRINLFLRCHEIDLKKKLSKEPANIENW 238

Query: 243 AVFTELRIRKN 253
            VF  LR +K+
Sbjct: 239 QVFEILRSKKD 249


>gi|291616380|ref|YP_003519122.1| GloB [Pantoea ananatis LMG 20103]
 gi|291151410|gb|ADD75994.1| GloB [Pantoea ananatis LMG 20103]
          Length = 273

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 128/228 (56%), Gaps = 7/228 (3%)

Query: 30  IDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL-KKFFNCTIFGPLEESSKIPG 88
           +D  +   + + ++  GW    I  THHH DHT     L + F +  ++GP E + K  G
Sbjct: 49  VDPGEAQPVLEKIKANGWQPEAILLTHHHNDHTGGVKTLCEHFPDIAVYGPQETADK--G 106

Query: 89  IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSY 148
               +S+GD F+      ++IATPGHT+GHI Y+  +  +L  GDTLFS GCGR+FE + 
Sbjct: 107 ATIRVSEGDKFNVLGLSFEVIATPGHTLGHISYY--SSPYLFCGDTLFSGGCGRLFEGTP 164

Query: 149 AEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT 208
            +MFES +K     + T +   HEYT +N  FA +  PH+ ++     K+K +R++N  T
Sbjct: 165 EQMFESFQKFNQLPEDTLVCCAHEYTLSNLKFAAAILPHDPQITAEYHKIKDLRAENRIT 224

Query: 209 NPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LAVFTELRIRKNQ 254
            P+ ++ E+ +N FLR ++  L+  L++++        F  LR +K++
Sbjct: 225 LPTKLAHERVINLFLRTQDPDLQHALSVDSEVEPVWKTFAVLREKKDR 272


>gi|326436903|gb|EGD82473.1| hypothetical protein PTSG_03122 [Salpingoeca sp. ATCC 50818]
          Length = 257

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 121/251 (48%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + + L  DN+  L+ +   R  AAID  +   +     E    + ++  TH H DH   N
Sbjct: 4   VVVPLLSDNYGYLLVDKATREAAAIDPVEPKKVLAAAEENNADIKYVLTTHSHWDHAGGN 63

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              K+   + TIFG   + +    +D  + D D+ D GS  + ++ATP HT GH+CY+  
Sbjct: 64  AEFKRLRPSVTIFGGRGDGAD--AVDQEVWDDDSLDIGSIKVSVLATPCHTPGHVCYYAT 121

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFA 181
             +D  +  GDTLF  GCG   + +   M+++L  K+    D T +Y GHEYT  N  FA
Sbjct: 122 AGDDRAVFTGDTLFIGGCGNFNQGTPQMMYDALYTKLGRLPDDTRVYVGHEYTVKNLTFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  +  R    YT PSTI  EK  NPF+R   T +       +A  
Sbjct: 182 RVVEPDNRAVQEKLAWAEEQRQAGQYTVPSTIGEEKAFNPFMRCHETPVHAYCGTADA-- 239

Query: 242 LAVFTELRIRK 252
           +     +R RK
Sbjct: 240 VTALATVRERK 250


>gi|307545284|ref|YP_003897763.1| hydroxyacylglutathione hydrolase [Halomonas elongata DSM 2581]
 gi|307217308|emb|CBV42578.1| hydroxyacylglutathione hydrolase [Halomonas elongata DSM 2581]
          Length = 255

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 123/252 (48%), Gaps = 11/252 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+          +D  D   + + L  +G  L  I  THHH DHT     
Sbjct: 7   IPAFSDNYIWLLRQDTSDSVCVVDPGDAAPVIEWLEREGLTLGTILITHHHPDHTGGLAE 66

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-D 126
           L + ++  + GP   +  I GID  + DGD         +++  PGHT+ HI +      
Sbjct: 67  LIQRYSPRVIGP--HNPSITGIDERVGDGDEIRVMGRLFEVLELPGHTLDHIAFFTAGIP 124

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GD LFS GCGR+FE S  +M +SL ++ +  ++  ++  HEYT  N  FA + DP
Sbjct: 125 PLLFSGDVLFSAGCGRLFEGSPEQMHQSLSRLDNLPEEALVFAAHEYTLANLRFAKAADP 184

Query: 187 HN---LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-- 241
            N   +E +  C + + +    L   PST+  E+++NPFLR     +R+      A++  
Sbjct: 185 GNKDVIEAENECLRARELERPTL---PSTLGRERRINPFLRCGEEGVRRAAAEHGATDTE 241

Query: 242 LAVFTELRIRKN 253
           LA FT LR  K+
Sbjct: 242 LATFTTLRAWKD 253


>gi|281200796|gb|EFA75013.1| hydroxyacylglutathione hydrolase [Polysphondylium pallidum PN500]
          Length = 285

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 117/224 (52%), Gaps = 7/224 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  L+ +      AAID+ +   +  + +     +  I  THHH DH   N
Sbjct: 23  IVVPVLQDNYSYLLVDELTNKAAAIDSVEPEKVLSVAKSNNLTIESILTTHHHWDHAGGN 82

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             +K+   N  I+G      ++  I + + D D  + G   ++++ +P HT GH+ Y+  
Sbjct: 83  KKMKELLPNVPIYG---GDDRVEAISNKVGDNDIINVGELKVRVLFSPAHTSGHVLYYVN 139

Query: 125 NDHFLCV--GDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFA 181
            D   CV  GDTLF  GCGR+FE S A+M+ +L E I    + T +Y GHEYT  N  FA
Sbjct: 140 KDDSSCVFTGDTLFIGGCGRLFEGSAAQMYHALYEVIGKLPNDTLVYCGHEYTYKNLLFA 199

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            + +PHN +L +     +  + +   T PST+ LEK  NPF+R+
Sbjct: 200 KTLEPHNKDLLEMLEFSEKQKEKGQPTVPSTVGLEKSFNPFMRV 243


>gi|148241938|ref|YP_001227095.1| hydroxyacylglutathione hydrolase [Synechococcus sp. RCC307]
 gi|147850248|emb|CAK27742.1| Hydroxyacylglutathione hydrolase [Synechococcus sp. RCC307]
          Length = 307

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 112/211 (53%), Gaps = 9/211 (4%)

Query: 49  LTHIFNTHHHIDHTRANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK 107
           L+ +  THHH DH      L  ++    ++    + ++IP    GL  GD     + P++
Sbjct: 98  LSVVLQTHHHKDHIGGTPALLSRWPGAQVWAAASDRARIPFQTDGLRGGDQRLLFNRPVQ 157

Query: 108 IIATPGHTIGHICYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFS 162
           ++  PGHT  HI + F           C GDTLF+ GCGR+FE +  +M  SL+++    
Sbjct: 158 VLEVPGHTRDHIAFFFPASGGEGPELFC-GDTLFAGGCGRLFEGTAEQMLRSLDQLSGLP 216

Query: 163 DKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPF 222
           + T I+  HEYTE N  FA++ +P N  LQ+   +V++MR+    T PS+++LE+  NPF
Sbjct: 217 EATRIWCAHEYTEANLRFAITQEPGNPALQERFQQVQAMRAAGEATVPSSVALERATNPF 276

Query: 223 LRIENTSLRKNLNMENASNLAVFTELRIRKN 253
           LR    SL++       +   V  E+R RK+
Sbjct: 277 LRCREASLQQVSGCCEPA--LVLAEIRRRKD 305


>gi|55725426|emb|CAH89577.1| hypothetical protein [Pongo abelii]
          Length = 350

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 129/264 (48%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 87  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 146

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 147 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 204

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 205 GEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLG 264

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    ++  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 265 FAGVVEPDNLARERKMQWMQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPG 324

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               ++ S   +  ELR  K+  K
Sbjct: 325 PTGDDDCSRAQLLEELRRLKDMHK 348


>gi|290476063|ref|YP_003468960.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Xenorhabdus
           bovienii SS-2004]
 gi|289175393|emb|CBJ82196.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Xenorhabdus
           bovienii SS-2004]
          Length = 251

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 114/189 (60%), Gaps = 6/189 (3%)

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK++ +  ++GP E  SK  G  H + + DT + G +   I+  PGHT+GHI   F    
Sbjct: 66  LKQYADLPVYGPEETRSK--GTTHIVHEHDTIETGHYCFHIMELPGHTLGHIA--FYQAP 121

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
           +L  GDTLFS GCGR+FE +  +MF SLEKI S  D+T I   HEYT  N  FA +  P 
Sbjct: 122 YLFCGDTLFSGGCGRLFEGTAEQMFSSLEKIMSLPDETLICCAHEYTAANMKFARAVLPE 181

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NASNL-AVF 245
           N  +  Y +K+ S+R  N  T P+T+ +EKKVN FL   N  L+KN+ ++ N+  L +VF
Sbjct: 182 NETIHDYYNKIISIRENNKPTVPTTLQIEKKVNVFLNCHNIDLQKNIGIKPNSKPLSSVF 241

Query: 246 TELRIRKNQ 254
            +LRI K++
Sbjct: 242 QQLRIYKDR 250


>gi|21241844|ref|NP_641426.1| hydroxyacylglutathione hydrolase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|81804427|sp|Q8PNI0|GLO2_XANAC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|21107225|gb|AAM35962.1| hydroxyacylglutathione hydrolase [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 255

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 128/254 (50%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALVAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ ++ +  +FGP +E  +IP   H +  G+         ++I  PGHT  HI   F+
Sbjct: 63  AELQQRWPDLALFGPADE--RIPTNAHHVGRGERLRLLDVEFQVIKVPGHTRSHIA--FL 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            D  L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  
Sbjct: 119 ADGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----AS 240
           DP N  LQ+   + ++MR     T P ++  E   NPFLR  +  +R  +        +S
Sbjct: 179 DPTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTSHPEIRAAVAPRAASALSS 238

Query: 241 NLAVFTELRIRKNQ 254
            + +F ELR  K++
Sbjct: 239 EVDIFAELRRWKDE 252


>gi|329894917|ref|ZP_08270716.1| Hydroxyacylglutathione hydrolase [gamma proteobacterium IMCC3088]
 gi|328922646|gb|EGG29981.1| Hydroxyacylglutathione hydrolase [gamma proteobacterium IMCC3088]
          Length = 252

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 111/225 (49%), Gaps = 3/225 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+   +H    R    +D  D   +   L + G  L  I  THHH DHT   
Sbjct: 4   VPIPAFTDNYIWCLHLDSRR-AIVVDPGDADAVHTYLSDNGLELAGILVTHHHFDHTGGI 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L    +  + GP  ++S   G+   + D       S  I ++A PGHT+ HI Y+   
Sbjct: 63  EALTNARSIPVIGP--QNSPFDGLTQRVGDHSQLILESLDIHVLAVPGHTLDHIAYYLPE 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE ++ +M  SL  ++     T +Y  HEYT  N  FAL+ D
Sbjct: 121 HKALFCGDTLFSGGCGRVFEGTFEQMRNSLASLRELPASTRVYCAHEYTAANLRFALAVD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           P N  LQ   ++V  +R  N  T P+T+  E + NPFLR +  ++
Sbjct: 181 PANPALQARVAEVSRLRGLNEPTLPTTLEEECRSNPFLRWDAPAI 225


>gi|294637715|ref|ZP_06715992.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda ATCC 23685]
 gi|291089145|gb|EFE21706.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda ATCC 23685]
          Length = 251

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 131/251 (52%), Gaps = 8/251 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  L+ N + R    +D      +   L E       I  THHH DH    
Sbjct: 4   IGLPVLQDNYIWLLINPQ-RHCLIVDPGVAAPVLHYLTENRITPKAILLTHHHNDHVGGV 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             + + + +  ++GP E  ++  G +  ++D D        + ++A PGHT+GH+ Y+  
Sbjct: 63  AEIVQAYPDLPVYGPAE--TRAAGCNQVVADNDRLSLLGLEVTVLAVPGHTLGHVAYY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           +  +L  GDTLFS GCGR+FE +  +MF+SL++I    D T +   HEYTE+N  FA   
Sbjct: 119 SAPYLFCGDTLFSAGCGRLFEGTAQQMFDSLQRILQLPDNTLVCCAHEYTESNLRFARHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--L 242
            P N  ++ Y     ++R+++  T P+T+ +EK++NPFLR  +  L++N+      N   
Sbjct: 179 LPQNRLIETYQQHAAALRAKHQPTVPTTLQIEKEINPFLRCYDDDLQRNVGFPTQPNEIW 238

Query: 243 AVFTELRIRKN 253
            VF  LR  K+
Sbjct: 239 RVFACLRDMKD 249


>gi|309782459|ref|ZP_07677183.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
 gi|308918796|gb|EFP64469.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
          Length = 279

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 136/265 (51%), Gaps = 22/265 (8%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGD--TFDFGSHPIKIIATPGHTIG 117
            L   +          + GP  ES  IP     + +GD  T    +   ++I  PGHT G
Sbjct: 74  ELLDAYPQNPEGAPLPVIGPAHES--IPCRTQAVREGDVVTLTQPAATFRVIDVPGHTSG 131

Query: 118 HICY--HFMNDHF---LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           H+ Y  H   +     L  GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  HE
Sbjct: 132 HVAYVGHLQGNAASASLFCGDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAHE 191

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT---- 228
           YT +N  FA + +P N +L  +  +V ++R++   T P+TI  E+  NPF+R ++     
Sbjct: 192 YTASNVRFARAVEPGNADLAAWEDEVTALRAEGRSTVPTTIGHERATNPFIRSDDANVTQ 251

Query: 229 SLRKNLNMENASNLAVFTELRIRKN 253
           ++ ++  ++    +AVF  LR  KN
Sbjct: 252 AVARHAGIDADDPVAVFAALRQWKN 276


>gi|85713109|ref|ZP_01044143.1| Probable hydroxyacylglutathione hydrolase GloB [Idiomarina baltica
           OS145]
 gi|85693057|gb|EAQ31021.1| Probable hydroxyacylglutathione hydrolase GloB [Idiomarina baltica
           OS145]
          Length = 252

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 123/225 (54%), Gaps = 5/225 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  LI + + R+   +D  D   + + L+     +     THHH DHT     
Sbjct: 6   VKAFDDNYIWLIESTQDRVVV-VDPGDDKPVIEWLKANKKDIAGYLITHHHHDHTGGLEA 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  F  T +GP  ++  I GID+ + +GDT         ++ATPGHT+ HI ++   D 
Sbjct: 65  LKARFPATSYGP--DNPAIKGIDYAVMEGDTVQIAGLRFDVLATPGHTLDHISFY--GDT 120

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLFS GCGR+FE +      SL+K++    +T ++  HEYT+ N  FA   +P 
Sbjct: 121 ALFCGDTLFSGGCGRMFEGTPELFVSSLDKLRRLPGETRVFCAHEYTQANLTFASLVEPD 180

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           N  L+ Y  K+K MR  +  T PST+ LE  +NPFLR + +++R+
Sbjct: 181 NAVLKSYLEKIKLMRQNDQITLPSTLQLELAINPFLRFDQSAVRQ 225


>gi|294666556|ref|ZP_06731797.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603700|gb|EFF47110.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 255

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 127/254 (50%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ ++ +  +FGP +E  +IP   H +  G+         +++  PGHT  HI   F+
Sbjct: 63  AELQQRWPDLELFGPADE--RIPANAHQVGHGERLRLLDVEFQVLEVPGHTRSHIA--FV 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  
Sbjct: 119 AAGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----AS 240
           DP N  LQ+   + ++MR     T P ++  E   NPFLRI    +R  +        +S
Sbjct: 179 DPTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRISRPEIRAAVAPRAAGALSS 238

Query: 241 NLAVFTELRIRKNQ 254
            + VF ELR  K++
Sbjct: 239 EVDVFAELRRWKDE 252


>gi|119775019|ref|YP_927759.1| hydroxyacylglutathione hydrolase [Shewanella amazonensis SB2B]
 gi|226724021|sp|A1S6T3|GLO2_SHEAM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|119767519|gb|ABM00090.1| Hydroxyacylglutathione hydrolase [Shewanella amazonensis SB2B]
          Length = 258

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 111/207 (53%), Gaps = 13/207 (6%)

Query: 27  TAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNC-----TIFGPLE 81
              +D  D   +   L+     LT +  THHH DH      L+ +        T++G + 
Sbjct: 25  AVVVDPGDAMPVINTLQRLNLQLTAVLLTHHHRDHNGGINQLRDWAKSNGQSFTVYGAVT 84

Query: 82  ESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLG 139
                   D    DGDT D    + P+++++ PGHT+ H+   F+ D+ L  GDTLFS G
Sbjct: 85  SDYS----DVLCRDGDTVDISGLTSPVRVLSVPGHTLDHLA--FVVDNALFCGDTLFSGG 138

Query: 140 CGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVK 199
           CGR+FE    ++++SL K+ S  D T +Y  HEYT +N  FAL+ +P N  LQ Y  +V 
Sbjct: 139 CGRLFEGDAGQLYDSLAKLASLPDDTLVYCAHEYTLSNLRFALAVEPQNQCLQDYVKQVN 198

Query: 200 SMRSQNLYTNPSTISLEKKVNPFLRIE 226
           ++R  N  + PST+  EK +NPFLR++
Sbjct: 199 NLREANKPSLPSTLGTEKAINPFLRVD 225


>gi|296283438|ref|ZP_06861436.1| hydroxyacylglutathione hydrolase, putative [Citromicrobium
           bathyomarinum JL354]
          Length = 177

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 98/173 (56%), Gaps = 2/173 (1%)

Query: 81  EESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGC 140
           +E  K+  ID  ++ GD    G H  ++I   GHT GHI +H  +D    VGD++F+LGC
Sbjct: 5   QEVEKLSPIDRVVAHGDAVTLGEHTAQVIDVSGHTNGHIAFHLPSDGIAFVGDSVFALGC 64

Query: 141 GRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKS 200
           GR+FE    + + SL +IK+   +T +Y  HEYT  NA FAL  DP N  LQ Y  ++ +
Sbjct: 65  GRMFEGEPQQFWGSLARIKALPPETTLYCAHEYTAANAKFALHADPENAALQAYVQEIDA 124

Query: 201 MRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKN 253
            R+Q+  T P+ +S E + NPFLR +   ++     E+ ++   F  LR  K+
Sbjct: 125 KRAQDEPTVPTVLSRELETNPFLRADAPEMQARWGGESPAD--TFAALRAAKD 175


>gi|254496528|ref|ZP_05109399.1| hydroxyacylglutathione hydrolase GloB [Legionella drancourtii
           LLAP12]
 gi|254354267|gb|EET12931.1| hydroxyacylglutathione hydrolase GloB [Legionella drancourtii
           LLAP12]
          Length = 254

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 133/255 (52%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  +I +    +   +D  D   + + ++     L  I  THHH DH    
Sbjct: 4   IPIPAFTDNYIWVILDKDAGVFDCVDPGDAEPVLQFMQAHQLKLRSILLTHHHHDHIGGV 63

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L K    C ++GP     +IP I+H + +  T   G H  +I+  PGHT  HI Y+  
Sbjct: 64  GTLIKHVPTCLVYGP--HDPRIPYINHPVKEHQTIHVGRHTFQILFNPGHTSSHISYYEP 121

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
           ++ +L  GDTLFS GCGR+F+ +  E+ +S++  KS    T ++  HEYT  N  FA + 
Sbjct: 122 HEGWLFCGDTLFSAGCGRVFDGTLNELHQSMQLFKSLPPTTKVFCAHEYTLQNLRFARTV 181

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS---N 241
           +P+N   Q Y  K+++  +    T PST+ +E+ +NPFLR +   ++      +A+   +
Sbjct: 182 EPNNQFTQNYLKKIQTQSTS--CTLPSTLEIEQLINPFLRTDAPEVQAYAQHHDATAKDS 239

Query: 242 LAVFTELRIRKNQSK 256
           L VF  LR +KN+ K
Sbjct: 240 LDVFRILREQKNKFK 254


>gi|311103918|ref|YP_003976771.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans A8]
 gi|310758607|gb|ADP14056.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans A8]
          Length = 273

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 130/261 (49%), Gaps = 15/261 (5%)

Query: 6   IAISLYHDNF-CILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRA 64
           + +  ++DN+   ++H  +    A +D  D   + + L   G  L  I  THHH DH   
Sbjct: 18  LPLPAFNDNYIWAIVHGGE---AAVVDPGDAGPVLQWLDRTGLRLRAILLTHHHGDHVGG 74

Query: 65  NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYH 122
              L +    T++GP  E  ++P  D  L++GD        +   ++  PGHT GHI Y+
Sbjct: 75  VPELSRIEGITVYGPAHE--QLPRCDVRLAEGDRVAIPELDLDLTVLDVPGHTAGHIAYY 132

Query: 123 FM---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE + A+M +SL K       T ++  HEYT  N  
Sbjct: 133 GRAAGQQPVLFCGDTLFAGGCGRLFEGTPAQMHDSLGKFAVLPPDTQVFCAHEYTLANLR 192

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKNLN 235
           +AL+ DP N  LQ++  + + +R++ L T PSTI  E+  NPFLR +   +     +   
Sbjct: 193 WALAVDPANRSLQQWHQQAQQLRAEGLPTLPSTIGQERAANPFLRTQEVEVVHAAERWAG 252

Query: 236 MENASNLAVFTELRIRKNQSK 256
             +A+ + VF  LR  KN  K
Sbjct: 253 HSHATPVEVFASLRKWKNDFK 273


>gi|241663326|ref|YP_002981686.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
 gi|240865353|gb|ACS63014.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
          Length = 279

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 135/266 (50%), Gaps = 24/266 (9%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHDG--RVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFN-------CTIFGPLEESSKIPGIDHGLSDGDTFDFG--SHPIKIIATPGHTIG 117
            L   +          + GP  ES  IP     + +GD       +   ++I  PGHT G
Sbjct: 74  ELLAAYPHNPEGAPLPVIGPAHES--IPCRTQAVREGDVVTLAQPAATFRVIDVPGHTSG 131

Query: 118 HICY------HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           H+ Y      +  +    C GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  H
Sbjct: 132 HVAYVGQLQGNAASASLFC-GDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAH 190

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT--- 228
           EYT +N  FA + +P N +L  +  +V ++R++   T P+TI  E+  NPF+R ++    
Sbjct: 191 EYTASNVRFARAVEPGNADLAAWEDEVTALRAEGRSTVPTTIGHERATNPFMRSDDANVT 250

Query: 229 -SLRKNLNMENASNLAVFTELRIRKN 253
            ++ ++  ++    +AVF  LR  KN
Sbjct: 251 QAVARHAGIDADDPVAVFAALRQWKN 276


>gi|148260773|ref|YP_001234900.1| hydroxyacylglutathione hydrolase [Acidiphilium cryptum JF-5]
 gi|226723980|sp|A5FZE9|GLO2_ACICJ RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|146402454|gb|ABQ30981.1| Hydroxyacylglutathione hydrolase [Acidiphilium cryptum JF-5]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 103/183 (56%), Gaps = 1/183 (0%)

Query: 46  GWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP 105
           G  L  +  THHH DH    ++L   F   I G   +++++P +D  L+ G T D G   
Sbjct: 49  GGRLDWVLLTHHHDDHIAGAVDLAARFGARIAGNAADAARLPRLDAALAPGQTIDLGGEA 108

Query: 106 IKIIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
           +++IATPGHT+GH+ Y F +    C GDTLFSLGCGR+FE + A+   SL+ + +   +T
Sbjct: 109 VRMIATPGHTVGHVTYLFGDAAAAC-GDTLFSLGCGRMFEGTPAQFHASLQALAALDPET 167

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            +  GHEYT +NA FA   DP N  L    ++ + +R+    T P  ++ E   NPFLR 
Sbjct: 168 LMLCGHEYTLSNARFARHVDPDNAALAARAAEAERLRAAGAPTLPVRLADELAANPFLRA 227

Query: 226 ENT 228
            + 
Sbjct: 228 ASA 230


>gi|312795587|ref|YP_004028509.1| Hydroxyacylglutathione hydrolase [Burkholderia rhizoxinica HKI 454]
 gi|312167362|emb|CBW74365.1| Hydroxyacylglutathione hydrolase (EC 3.1.2.6) [Burkholderia
           rhizoxinica HKI 454]
          Length = 280

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 134/265 (50%), Gaps = 24/265 (9%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  +I N      A +D  D   ++  L+ +G  LT I  THHH DH    
Sbjct: 20  IPVPAFEDNYIWVISNGCD--AAVVDPGDAAPVADFLQRQGLRLTAILLTHHHADHVGGV 77

Query: 66  LNLKKFFNC----TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK----IIATPGHTIG 117
             L +         ++GP  E+ ++  +   L+ GD       P++    +I  PGHT G
Sbjct: 78  ATLIQTCGAHGAVPVYGPGSETIQV--VTDPLAGGDEIRI--EPLRLVLSVIDVPGHTRG 133

Query: 118 HICYHFMND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           HI Y          H LC GDTLF+ GCGR+FE +  +M  SL+ + +  D T ++  HE
Sbjct: 134 HIAYFAAAGEDPVPHLLC-GDTLFASGCGRLFEGTPQQMLASLDALAALPDATEVHCAHE 192

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT +N  FAL+ +P N +L  +  + + +R+  + T P+T+  EK+VNPFLR    S+R+
Sbjct: 193 YTLSNIAFALAVEPDNADLLVWRDRAQGLRADGVATVPTTVGHEKRVNPFLRAHLPSIRQ 252

Query: 233 NL----NMENASNLAVFTELRIRKN 253
            L    ++  +  L  F  LR  KN
Sbjct: 253 QLADKRHVHVSGRLDTFAALREWKN 277


>gi|332306244|ref|YP_004434095.1| hydroxyacylglutathione hydrolase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173573|gb|AEE22827.1| hydroxyacylglutathione hydrolase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 257

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 129/261 (49%), Gaps = 14/261 (5%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M SL I  I  + DN+   + N +      +D  D   + K        LT I  THHH 
Sbjct: 1   MPSLKIRPIKAFEDNYIWCLTNGES--CVVVDPGDANPVIKYCSRNNLILTDILITHHHS 58

Query: 60  DHTRA-NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTI 116
           DHT   N  +  F   T++GP  ++ +I  I   L  GD        +  +++  PGHT+
Sbjct: 59  DHTGGVNDLVNAFEGVTVYGP--QNPQIQSITQRLQAGDMVQLALLDVEFRVLEVPGHTL 116

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            HI Y  +    L  GDTLFS GCGR+FE +  +M++SL ++ + +D T +Y  HEYT  
Sbjct: 117 DHIAY--VGSCGLFCGDTLFSAGCGRLFEGTPEQMYQSLGQLTALADDTKVYCTHEYTLA 174

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FAL+ DP N  L  Y    +S R     T PSTI  +K++NPFLR  + +++ +   
Sbjct: 175 NLKFALAVDPENENLLNYKGWAESQRVDLKPTLPSTIGQQKEINPFLRTASDAVKAHAEQ 234

Query: 237 ENASNL----AVFTELRIRKN 253
                L    +VF  LR  K+
Sbjct: 235 YAEQTLSTPESVFAALRAWKD 255


>gi|283783996|ref|YP_003363861.1| hydroxyacylglutathione hydrolase [Citrobacter rodentium ICC168]
 gi|282947450|emb|CBG86997.1| probable hydroxyacylglutathione hydrolase [Citrobacter rodentium
           ICC168]
          Length = 251

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ +++ R    +D  D   + + + E  W    I  THHH DH     
Sbjct: 5   SIPAFQDNYIWVLSDNQSR-CLIVDPGDAAPVLQAIAENQWQPEAILLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF +  ++GP E   K  G    ++DGD+     H  +I ATPGHT GHICY F +
Sbjct: 64  ALVQKFPHLVVYGPAETQDK--GATRIVNDGDSILILGHEFRIFATPGHTSGHICY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL+KI +  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLKKIAALPDDTLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           PH+  +  Y  KV  +R++   T P  +  E++ N FLR E+  L K +N E
Sbjct: 180 PHDSFINDYYLKVNELRAKKQMTLPVILKNERQNNIFLRTEDADLIKEINKE 231


>gi|237746599|ref|ZP_04577079.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes HOxBLS]
 gi|229377950|gb|EEO28041.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes HOxBLS]
          Length = 265

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 122/253 (48%), Gaps = 11/253 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  +I N        +D  +   +   L+++   L+ I  TH H DH      
Sbjct: 14  IPAFRDNYIWMIDNRTR--AVVVDPGEAGPVLSTLKKRSLKLSAILLTHRHEDHIGGVAR 71

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF---DFGSHPIKIIATPGHTIGHICYHFM 124
           L +  +  ++GP      +  + H L +GD     D  +  + ++  PGHT GHI Y+  
Sbjct: 72  LLQEADVPVYGP--RYDPVVSVTHPLQEGDIVTLPDLDNLALSVLDVPGHTRGHIAYYAK 129

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            + +L  GD LF  GCGR+FE +  +M  SL K+ +  D   ++ GHEYT +N  FA   
Sbjct: 130 KEKWLFCGDMLFGAGCGRMFEGTPEQMLASLSKLAALPDDVQVFAGHEYTLSNLKFAREI 189

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           +P N  + +   +  + R++   T PSTI LEK  NPFLR     + K L     ++N +
Sbjct: 190 EPGNEAIAERARQDLARRNRGRPTLPSTIGLEKATNPFLRANREDVMKRLEELGHLKNRN 249

Query: 241 NLAVFTELRIRKN 253
            +  F  +R  KN
Sbjct: 250 PVDCFAAMREWKN 262


>gi|328956419|ref|YP_004373805.1| hydroxyacylglutathione hydrolase [Carnobacterium sp. 17-4]
 gi|328672743|gb|AEB28789.1| hydroxyacylglutathione hydrolase [Carnobacterium sp. 17-4]
          Length = 233

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 118/228 (51%), Gaps = 8/228 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  +I      +   +D  +   +   L EK   L  I  TH+H DH      
Sbjct: 6   VKAFSDNYIWIIEEGTEAIV--VDPGEAEKVLDYLEEKQLLLNSILLTHNHDDHIGGVQQ 63

Query: 68  LK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           +  K+ + +I+GP +E+  I   DH + DGD+F+      +++ T GHT GHI +  M +
Sbjct: 64  ISAKYPDASIYGP-KETGDIA--DHIVVDGDSFNLLGQNFQVLKTGGHTQGHISF-LMGN 119

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
              C GD LFS GCGR+F   Y   +++L+K K   D+  +Y  HEYT+ N  FA S  P
Sbjct: 120 ALFC-GDALFSAGCGRVFTKDYQAQYDALQKFKQLEDEVQVYAAHEYTQTNLRFAHSMQP 178

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            N  + +  ++V  MRS+   T P+TI  EKK+N FL+ E     K L
Sbjct: 179 SNAAISEALNQVNEMRSKGKPTLPTTIGREKKINLFLQAEKMEDFKEL 226


>gi|171058655|ref|YP_001791004.1| hydroxyacylglutathione hydrolase [Leptothrix cholodnii SP-6]
 gi|170776100|gb|ACB34239.1| hydroxyacylglutathione hydrolase [Leptothrix cholodnii SP-6]
          Length = 245

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 115/242 (47%), Gaps = 12/242 (4%)

Query: 22  HKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLE 81
           H  +    +D  D   +   L      L  I  THHH DH      L + +   ++GP  
Sbjct: 3   HDGQAGVVVDPGDAAPVIAALERLSLRLAGILVTHHHGDHVGGLAALLQRWPVPVWGPAG 62

Query: 82  ESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-------MNDHFLCVGDT 134
           E   +P     + DGDT       +++I  PGHT GH+ Y         + +  L  GDT
Sbjct: 63  EPMPVPVT--AVRDGDTVRVLGLALQVIDVPGHTAGHVAYFIDAADQPSIGEPVLFCGDT 120

Query: 135 LFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKY 194
           LFS GCGR+FE + A+M  SL ++ +    T +   HEYT +N  FA + +P N  + ++
Sbjct: 121 LFSAGCGRLFEGTPAQMLTSLSRLAALPGDTRVCCAHEYTLSNLRFARAVEPDNAAIARH 180

Query: 195 CSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN---LAVFTELRIR 251
            +    +R+    T PS I+LE+++NPFLR    ++ +      A     +AVF  +R  
Sbjct: 181 EAHCLGLRATRTPTLPSRIALERQINPFLRSHEAAVIETARERGADAHDPVAVFAAIRAW 240

Query: 252 KN 253
           KN
Sbjct: 241 KN 242


>gi|332529403|ref|ZP_08405364.1| hydroxyacylglutathione hydrolase [Hylemonella gracilis ATCC 19624]
 gi|332041201|gb|EGI77566.1| hydroxyacylglutathione hydrolase [Hylemonella gracilis ATCC 19624]
          Length = 265

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 124/257 (48%), Gaps = 19/257 (7%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  L+H+ ++ +   +D  +   +   LR +   L  I  THHH DH      L+   
Sbjct: 11  DNYIWLLHDEQHAIV--VDPAEAAPVLDTLRARRLTLRAILVTHHHTDHVGGVPELRDAT 68

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN------- 125
              ++GP  E  ++P     +S+GD  +      +++  PGHT GHI ++          
Sbjct: 69  GAAVYGPASE--EMPEPITRVSEGDAVELLGLRFEVLDVPGHTAGHIAWYCAEATALGAP 126

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGRIFE + A+M  SL+K+      T +   HEYT +N  FA + +
Sbjct: 127 SPLLFCGDTLFSGGCGRIFEGTPAQMLASLDKLNRLPAATRVCCAHEYTLSNLRFARAVE 186

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK--------NLNME 237
           P N  L++Y    +++R++   T PST++ E+ +NPF R     + +         L   
Sbjct: 187 PANEALRQYSLDCEALRARGEPTLPSTLARERAINPFFRSRQPDVAQAVARTAGHALTGM 246

Query: 238 NASNLAVFTELRIRKNQ 254
             + +  F  LR  KN+
Sbjct: 247 QPAEVETFAALRQWKNE 263


>gi|294340667|emb|CAZ89059.1| putative Hydroxyacylglutathione hydrolase [Thiomonas sp. 3As]
          Length = 272

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 127/269 (47%), Gaps = 21/269 (7%)

Query: 7   AISLYHDNFCILIH-NHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A++ + DN+  LI  +     T  +D  D   +   L   G  L  I  THHH DH    
Sbjct: 5   ALAAFRDNYIWLIRPDANDPRTLVVDPGDAAPVIGALERGGLELRGILVTHHHSDHVGGI 64

Query: 66  LNLKKFFNC-------TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTI 116
             L +++          ++GP  E+  IP     +  GD F     P++  ++  PGHT+
Sbjct: 65  RELLQWWQAKHPADEPPVWGPAAEA--IPARTQAMRQGDGFSPTGWPLRLEVLEVPGHTL 122

Query: 117 GHICY-----HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           GHI Y            L  GDTLFS GCGR+FE + A+M  SL K+    + T +   H
Sbjct: 123 GHIAYVATALQGEEPPSLFCGDTLFSAGCGRLFEGTPAQMHHSLNKLSQLPENTTVNCAH 182

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT--- 228
           EYT +N  FA + DP N  +  +  +  ++R++ L T PS I LEK++NPFLR +     
Sbjct: 183 EYTLSNLQFARAADPLNEAVVAHQKRCLALRAKGLPTLPSHIGLEKQINPFLRTDQPGVL 242

Query: 229 -SLRKNLNMENASNLAVFTELRIRKNQSK 256
            +L ++   +    +     LR  KN  K
Sbjct: 243 QALEQHKGQKPGDAVQALAWLREWKNDFK 271


>gi|213646366|ref|ZP_03376419.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
          Length = 207

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 113/207 (54%), Gaps = 8/207 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAAHKWMPEAIFLTHHHYDHVGGVK 63

Query: 67  NLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + F   T++GP E   K  G  H + DGDT         + ATPGHT+GH+CY F +
Sbjct: 64  ELLQHFPQMTVYGPAETQDK--GATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCY-FSH 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPST 212
           PH+  + +Y  KVK +RS+   TN +T
Sbjct: 180 PHDSFINEYYRKVKELRSKK--TNDTT 204


>gi|294678495|ref|YP_003579110.1| hydroxyacylglutathione hydrolase [Rhodobacter capsulatus SB 1003]
 gi|6647529|sp|P96981|GLO2_RHOCA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|1881512|emb|CAA67905.1| hypothetical protein [Rhodobacter capsulatus]
 gi|294477315|gb|ADE86703.1| hydroxyacylglutathione hydrolase [Rhodobacter capsulatus SB 1003]
          Length = 256

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 136/255 (53%), Gaps = 1/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT     I    DN+  L H+        +D P+   + K+L ++ W L HI  THHH D
Sbjct: 1   MTLELTPIPCLTDNYAWLWHDTATDTVVVVDVPEAAPVLKVLTDRRWQLHHILITHHHAD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L +     + G   ++ ++P +DH ++ GD    G    ++IA  GHT+GHI 
Sbjct: 61  HIAGVEALAQATGAKVAGAAADAHRLPPLDHPVAPGDVLHLGMEAAQVIAADGHTLGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++      L  GD+L S GCGR+FE + A+MF++L ++ +   +T +  GHEYT  N  F
Sbjct: 121 WYLPGAGLLFSGDSLMSWGCGRLFEGTPAQMFDTLTRLAALPPETRVCSGHEYTAANGRF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS +P N  L     +V ++R     + P T+  E+  NPFLR ++ +LR  L +  +A
Sbjct: 181 ALSLEPGNGRLHDRMDRVTALRLAGEPSLPVTLGEERATNPFLRADDAALRAALGLPGDA 240

Query: 240 SNLAVFTELRIRKNQ 254
           + LAVFT  R RK++
Sbjct: 241 APLAVFTAARARKDR 255


>gi|113460952|ref|YP_719019.1| hydroxyacylglutathione hydrolase [Haemophilus somnus 129PT]
 gi|123031353|sp|Q0I3Q7|GLO2_HAES1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|112822995|gb|ABI25084.1| hydroxyacylglutathione hydrolase [Haemophilus somnus 129PT]
          Length = 233

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 134/241 (55%), Gaps = 15/241 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I   +DN+ I ++  +      ID P+   +S+ ++ +   +  +  TH+H DH  A 
Sbjct: 3   IPIPALNDNY-IWVYKRENLSVIVIDIPEIAALSQFIQAQNLVIGALLITHNHRDHIGAL 61

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLS---DGDTFDFGSHPIKIIATPGHTIGHICY 121
              K+F+ +  I+GP E +      D G++   D        + I ++ T GHT  H+ +
Sbjct: 62  AEFKQFYPHVHIYGPAECA------DQGVTQVIDAGRLIIDEYHIDVLPTGGHTAQHLSF 115

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
             ++ H  C GDTLFS GCGR+F   Y++MF SL+ +KS  D+T +   HEYT  N  FA
Sbjct: 116 -LIDGHLFC-GDTLFSAGCGRVFTGDYSQMFTSLQLLKSLPDETIVCPAHEYTLGNLAFA 173

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+   +   +QK   KVK +R++N  + P+T++LEK++NPFL++E  SL + + +  A +
Sbjct: 174 LTTGKNKSAVQKQLEKVKKLRAENKPSLPTTLALEKQINPFLQVE--SLDEFIELRKAKD 231

Query: 242 L 242
           +
Sbjct: 232 V 232


>gi|33861116|ref|NP_892677.1| putative hydroxyacylglutathione hydrolase [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
 gi|33639848|emb|CAE19018.1| Putative hydroxyacylglutathione hydrolase [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
          Length = 246

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 115/224 (51%), Gaps = 4/224 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I +  DN   L    K R    ID   +  + + L+     L  I  THHH DH    
Sbjct: 10  IGIRVLRDNIIWLWK--KNRSAVVIDPALSQPVKEYLKTNNLNLEAILQTHHHSDHIGGT 67

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L K++ N  +    +E  +IP  +  + DGDT +     +K+I   GHT  HI ++  
Sbjct: 68  RELIKEWPNVKVIASCKEKDRIPFQNSSVKDGDTLELLDEEVKVIEVIGHTRSHIAFYIN 127

Query: 125 ND-HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
           N+   L +GDTLFS GCGRIFE +Y +M+ SL++IKS    T IY  HEYT++N  +AL 
Sbjct: 128 NNVPILFIGDTLFSAGCGRIFEGTYKQMYYSLKRIKSLPKNTLIYCAHEYTKSNLLWALD 187

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN 227
            +P N  ++    +V+   +    T P  +  E K+N FLR +N
Sbjct: 188 LEPENQNIKNKLIEVEKKIALKELTIPCLLEEEMKINLFLRADN 231


>gi|242015528|ref|XP_002428405.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus
           corporis]
 gi|212513017|gb|EEB15667.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus
           corporis]
          Length = 303

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 128/252 (50%), Gaps = 14/252 (5%)

Query: 12  HDNFCILIHNHKYRLTAAID--APDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL- 68
            DN+  LI + + +    +D  APDT +  K + E+   L ++  THHH DH   N  L 
Sbjct: 58  QDNYMYLIIDVRTKDAGIVDPVAPDTVL--KAVSEENVNLKYVLTTHHHWDHAGGNSALI 115

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND-- 126
           KK  N T+ G      +I G+   +   DTF  G+   + + TP HT GHICY    D  
Sbjct: 116 KKLPNLTVLG---GDDRIQGLSKKVGHNDTFHIGNLHGECLFTPCHTSGHICYLIKQDGE 172

Query: 127 -HFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +  GDTLF  GCGR FE S  +M+++L E +    D T ++ GHEYT NN  FA   
Sbjct: 173 PSAVFTGDTLFIAGCGRFFEGSAEQMYKALIEILGQLPDNTLVFCGHEYTLNNLSFAKMV 232

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           +P N  +Q+     +  R  N  T PSTI  EK  NPFLR+  TS++  +   NA  +  
Sbjct: 233 EPKNSNIQERIEWAEKKRKLNEPTVPSTIKDEKLTNPFLRVNTTSVQSFVGHSNA--IDT 290

Query: 245 FTELRIRKNQSK 256
              LR +K+  K
Sbjct: 291 MRALRAKKDNFK 302


>gi|253988339|ref|YP_003039695.1| hydroxyacylglutathione hydrolase (glyoxalase ii) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779789|emb|CAQ82950.1| hydroxyacylglutathione hydrolase (glyoxalase ii) [Photorhabdus
           asymbiotica]
          Length = 250

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 140/252 (55%), Gaps = 9/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ +   R +  +D  ++  +   L+  GW    I  THHH DH    
Sbjct: 4   ISIPALSDNYIWLLCDDN-RHSVIVDPAESQPVLDTLKSHGWIPDAILLTHHHHDHVGGV 62

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              L +F    ++GP E  SK  G    +  G++ +FG+   ++I  PGHT+GHI ++  
Sbjct: 63  PGILDQFPELPVYGPEETQSK--GATMIVRGGNSINFGNFSFQVIDVPGHTLGHIAFY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGR+FE +  +M+ S+ KI    D T I   HEYT +N  FA + 
Sbjct: 119 QAPYLFCGDTLFSGGCGRLFEGTAEQMYTSIGKIAELPDDTLICCAHEYTVSNMKFAHAI 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NASNLA 243
            P N  + +Y  KV  MR  N  T P+T+ +EKK+N FL+ ++  L++N+ ++ N+  L+
Sbjct: 179 LP-NQAISEYQQKVTQMRENNQPTVPTTLQIEKKINIFLKCDDIDLQRNIGIKPNSQPLS 237

Query: 244 -VFTELRIRKNQ 254
            VF +LRI K++
Sbjct: 238 VVFRQLRINKDR 249


>gi|170717507|ref|YP_001784600.1| hydroxyacylglutathione hydrolase [Haemophilus somnus 2336]
 gi|189041222|sp|B0UU01|GLO2_HAES2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|168825636|gb|ACA31007.1| Hydroxyacylglutathione hydrolase [Haemophilus somnus 2336]
          Length = 233

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 131/239 (54%), Gaps = 17/239 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I   +DN+ I ++  +      ID P+   +S+ ++ +   +  +  TH+H DH  A 
Sbjct: 3   IPIPALNDNY-IWVYKRENLSVIVIDIPEIAALSQFIQAQNLVIGALLITHNHRDHIGAL 61

Query: 66  LNLKKFF-NCTIFGPLEESSKIPGIDHGLS---DGDTFDFGSHPIKIIATPGHTIGHICY 121
              K+F+ +  I+GP E +      D G++   D        + I ++ T GHT  H+ +
Sbjct: 62  AEFKQFYPHVHIYGPAECA------DQGVTQVIDAGRLIIDEYHIDVLPTGGHTAQHLSF 115

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
             ++ H  C GDTLFS GCGR+F   Y++MF SL+ +KS  D+T +   HEYT  N  FA
Sbjct: 116 -LVDGHLFC-GDTLFSAGCGRVFTGDYSQMFTSLQLLKSLPDETIVCPAHEYTLGNLAFA 173

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNLNM 236
           L+   +   +QK   KVK +R++N  + P+T++LEK++NPFL++E       LRK  +M
Sbjct: 174 LTTGKNKSAVQKQLEKVKKLRAENNPSLPTTLALEKQINPFLQVEGLEEFIELRKAKDM 232


>gi|168033818|ref|XP_001769411.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679331|gb|EDQ65780.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 260

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 16/261 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDA--PDTYIISKMLREKGWFLTHIFNTHHHIDHTR 63
           + +    DN+  L+ + +    A +D   PD  + +  +   G  +  +  THHH DH  
Sbjct: 4   VPVPCLEDNYAYLVFDEETGDAAVVDPVWPDQVLQAAQIN--GAKVKMVLTTHHHWDHAG 61

Query: 64  ANLNLKKFF-NCTIFGPLEESSKIPGIDHGLSDGDTFDFG-SHPIKIIATPGHTIGHICY 121
            N  +KK   +  I+G +++  K+ G  H +  GD F    +  +K + TP HT GHI Y
Sbjct: 62  GNNGMKKLLKDVPIYGGVKD--KVEGCSHPVQHGDEFSISPTVRVKCLETPCHTKGHISY 119

Query: 122 HFM----NDH-FLCVGDTLFSLGCGRIFEDSYAEMFESLEK-IKSFSDKTHIYFGHEYTE 175
                  ND   +  GDTLF  GCGR FE +  +M++SL K + S   +T +Y GHEYT+
Sbjct: 120 FITSTLPNDKSAVFTGDTLFIGGCGRFFEGTPDQMYQSLCKTLASLPLETQVYCGHEYTQ 179

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FAL+ +P N  L +    V   R Q L T PSTI  E + NPF+R++  SL+  L 
Sbjct: 180 KNLEFALTLEPKNEALLRKMEWVLRQRKQKLATVPSTIGDELEFNPFMRVDQKSLQ--LA 237

Query: 236 MENASNLAVFTELRIRKNQSK 256
               S L V  E+R  K+  K
Sbjct: 238 TGRESPLEVMAEVRRMKDNYK 258


>gi|296136539|ref|YP_003643781.1| hydroxyacylglutathione hydrolase [Thiomonas intermedia K12]
 gi|295796661|gb|ADG31451.1| hydroxyacylglutathione hydrolase [Thiomonas intermedia K12]
          Length = 272

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 127/269 (47%), Gaps = 21/269 (7%)

Query: 7   AISLYHDNFCILIH-NHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A++ + DN+  LI  +     T  +D  D   +   L   G  L  I  THHH DH    
Sbjct: 5   ALAAFRDNYIWLIRPDANDPRTLVVDPGDAAPVIGALERGGLELRGILVTHHHSDHVGGI 64

Query: 66  LNLKKFFNC-------TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTI 116
             L +++          ++GP  E+  IP     +  GD F     P++  ++  PGHT+
Sbjct: 65  RELLQWWQTKHPADEPPVWGPAAEA--IPARTQAIRQGDVFSPTGWPLRFEVLEVPGHTL 122

Query: 117 GHICY-----HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           GHI Y            L  GDTLFS GCGR+FE + A+M  SL K+    + T +   H
Sbjct: 123 GHIAYVATALQGEEPPSLFCGDTLFSAGCGRLFEGTPAQMHHSLNKLSQLPENTTVNCAH 182

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT--- 228
           EYT +N  FA + DP N  +  +  +  ++R++ L T PS I LEK++NPFLR +     
Sbjct: 183 EYTLSNLQFARAADPLNEAVVTHQKRCLALRAKGLPTLPSHIGLEKQINPFLRTDQPGVL 242

Query: 229 -SLRKNLNMENASNLAVFTELRIRKNQSK 256
            +L ++   +    +     LR  KN  K
Sbjct: 243 QALEQHKGQKPGDAVQALAWLREWKNDFK 271


>gi|260221006|emb|CBA29140.1| Hydroxyacylglutathione hydrolase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 261

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 116/221 (52%), Gaps = 7/221 (3%)

Query: 13  DNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFF 72
           DN+  ++HN +  L   +D  +   + + L  +   L  I  THHH DHT    NL++  
Sbjct: 16  DNYIWMLHNGQEAL--VVDPGEAQPVLEALERESLTLHTILVTHHHGDHTGGVPNLREAT 73

Query: 73  NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH---FL 129
             +++GP  E  K+P     L +GD          +I  PGHT GHI +          L
Sbjct: 74  GASVYGPAHE--KMPEPITRLMEGDRVHALGWDFTVIDVPGHTAGHIAFFAAPAAAKPLL 131

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFS GCGR+FE + A+M +SL K+ S  D T +   HEYT +N  FAL+ +P N 
Sbjct: 132 FCGDTLFSAGCGRLFEGTPAQMLDSLHKLSSLPDDTRVCCTHEYTLSNLKFALAVEPGNQ 191

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
            L  Y    +S+R+ +  T PS + LE+ +NPFLR   +S+
Sbjct: 192 ALADYDMHCRSLRANSTPTLPSNMLLERNINPFLRTHLSSV 232


>gi|21672519|ref|NP_660586.1| hydroxyacylglutathione hydrolase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|586912|sp|Q08889|GLO2_BUCAP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|349618|gb|AAA17433.1| ORF1 [Buchnera aphidicola]
 gi|21623141|gb|AAM67797.1| probable hydroxyacylglutathione hydrolase [Buchnera aphidicola str.
           Sg (Schizaphis graminum)]
          Length = 250

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 141/249 (56%), Gaps = 7/249 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +IS+  DN+  +++N        ID   +  I K + +K W L  I  TH+HIDH     
Sbjct: 5   SISVLKDNYVWILYNDNCS-CIIIDPGVSEDIIKKIEKKNWKLIAILLTHNHIDHVGGVE 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            + +++ N T+FGP  E +K   ++  +  GD        I +  TPGHT+GH+ Y ++ 
Sbjct: 64  EIIRRYPNVTVFGP--EETKTRNVNKIVKQGDVIKLLKSEIHVFLTPGHTLGHVSY-YLK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+F++ + +M++S+  IKS   KT +   HEYT +N  FA+S  
Sbjct: 121 PYIFC-GDTLFSGGCGRVFKNKFFDMYQSINFIKSLPKKTILCCSHEYTLSNLNFAMSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAV 244
           P + +++KY  K+K   SQN  + P ++  EKK+N FLR    +++K + + ++ S+  V
Sbjct: 180 PFDKKIKKYYKKIKKHISQNKTSLPVSLETEKKINIFLRTNEKTIKKAMGLKKDTSSFEV 239

Query: 245 FTELRIRKN 253
           F  LR  K+
Sbjct: 240 FILLRKEKD 248


>gi|317047018|ref|YP_004114666.1| hydroxyacylglutathione hydrolase [Pantoea sp. At-9b]
 gi|316948635|gb|ADU68110.1| hydroxyacylglutathione hydrolase [Pantoea sp. At-9b]
          Length = 251

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 112/189 (59%), Gaps = 6/189 (3%)

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L+ F    +FGP E + K  G  H L++GD F       ++IATPGHT+GHI Y F + +
Sbjct: 66  LQHFPELEVFGPQETADK--GAKHILAEGDEFTLLGINFRVIATPGHTLGHISY-FSSPY 122

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
             C GDT+FS GCGR+FE +  +MFES +K+      T I   HEYT +N  FA +  PH
Sbjct: 123 LFC-GDTMFSGGCGRLFEGTAQQMFESFQKLNELPADTLICCAHEYTLSNMKFAAAILPH 181

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLAVF 245
           + ++     ++K +R++N  T P+ ++LE+++N FLR ++  L++ L  N   A     F
Sbjct: 182 DPKILARFQQIKDLRAENRITLPTNLALEREINLFLRTQDADLQRALGGNFTTAPLWQAF 241

Query: 246 TELRIRKNQ 254
            +LR +K++
Sbjct: 242 ADLREKKDR 250


>gi|255019827|ref|ZP_05291903.1| Hydroxyacylglutathione hydrolase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970756|gb|EET28242.1| Hydroxyacylglutathione hydrolase [Acidithiobacillus caldus ATCC
           51756]
          Length = 254

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 121/250 (48%), Gaps = 9/250 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+   +      +D      +S  L  +G   + I  THHH DH      
Sbjct: 6   IPAFRDNYIYLLTLPQESAVWIVDPGAAAPVSAELSRRGLRPSAILCTHHHADHIGGVAE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L   + C ++GP   +S IP   + L +G     G   I+++  PGHT+ H+ +++  D 
Sbjct: 66  LATAYGCPVYGP--GNSTIPARTNPLREGTAHVDGRE-IRVLEVPGHTLDHLAFYW-EDL 121

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
             C GDTLF+ GCGRIFE   A +F SL+K+    D T +   HEYT  N  FA   +P 
Sbjct: 122 LFC-GDTLFAGGCGRIFEGDAAMLFASLQKLARLPDSTRVCCAHEYTLANLRFAAVVEPD 180

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASNLA 243
           N  L +   +V+  R     + PST+  E++ NPFLR    S++  +        A  +A
Sbjct: 181 NRILGERLERVRRQREAGQPSLPSTLGEERQSNPFLRCHLPSVQHAVRAVYPETAAEPVA 240

Query: 244 VFTELRIRKN 253
           +F  LR  K+
Sbjct: 241 IFAALRRWKD 250


>gi|296004396|ref|XP_002808641.1| cytosolic glyoxalase II [Plasmodium falciparum 3D7]
 gi|45685161|gb|AAS75334.1| glyoxalase IIB [Plasmodium falciparum]
 gi|225631624|emb|CAX63911.1| cytosolic glyoxalase II [Plasmodium falciparum 3D7]
          Length = 263

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 131/260 (50%), Gaps = 18/260 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + + + +DNF  +I + K +  A+ID  +   + K +      L ++  THHH DH+  N
Sbjct: 8   LVVPVLNDNFSYVIIDEKTKKAASIDPVEPDKVLKRIETANVELEYVLCTHHHYDHSGGN 67

Query: 66  LNLKKF-FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
           + +++   N  + G   E +  PG++  + DG     G   IK I  P HT GHI Y+  
Sbjct: 68  IRMRELKQNIKVVGSAYEPT--PGVNEKVYDGQIIRLGELNIKAIHAPCHTKGHILYYVY 125

Query: 124 ------MNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
                   DH     L  GDTLF  GCGR FE S  +MF+++EK+K+   +T IY GHEY
Sbjct: 126 KTDEAKQEDHKYKPILFTGDTLFIAGCGRFFEGSAKDMFKNIEKVKNMRKETLIYCGHEY 185

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T NN  FALS +  N  ++   ++V        ++ PSTI  E  +NPF R      + N
Sbjct: 186 TLNNLRFALSIENDNEYMKNKLNEVTEKLKNKEHSVPSTIEEENLINPFFRTHCYVNKFN 245

Query: 234 LNMENASNLAVFTELRIRKN 253
           +N E    + +  +LR  KN
Sbjct: 246 MNDE----IKILDKLRQLKN 261


>gi|87239984|ref|NP_001034598.1| probable hydrolase PNKD isoform 3 [Mus musculus]
 gi|158564323|sp|Q69ZP3|PNKD_MOUSE RecName: Full=Probable hydrolase PNKD; AltName:
           Full=Myofibrillogenesis regulator 1; Short=MR-1;
           AltName: Full=Paroxysmal nonkinesiogenic dyskinesia
           protein
          Length = 385

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 300 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 360 PTSDDGCSRAQLLEELRRLKDMHK 383


>gi|294627918|ref|ZP_06706497.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292597832|gb|EFF41990.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 255

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 126/254 (49%), Gaps = 10/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+ ++ +  +FGP +E  +IP   H +  G+         +++  PGHT  HI   F+
Sbjct: 63  AELQQRWPDLELFGPADE--RIPANAHQVGHGERLRLLDVEFQVLDVPGHTRSHIA--FV 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  
Sbjct: 119 AAGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----AS 240
           DP N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +        +S
Sbjct: 179 DPTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTSRPEIRAAVAPRAAGALSS 238

Query: 241 NLAVFTELRIRKNQ 254
            + VF ELR  K++
Sbjct: 239 EVDVFAELRRWKDE 252


>gi|50510835|dbj|BAD32403.1| mKIAA1184 protein [Mus musculus]
          Length = 388

 Score =  134 bits (338), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 125 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 184

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 185 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 242

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 243 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 302

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 303 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPG 362

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 363 PTSDDGCSRAQLLEELRRLKDMHK 386


>gi|119471757|ref|ZP_01614117.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Alteromonadales
           bacterium TW-7]
 gi|119445380|gb|EAW26668.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Alteromonadales
           bacterium TW-7]
          Length = 257

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 113/219 (51%), Gaps = 5/219 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D      +   L  +   L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTEGNAKAWVVDPGQAEPVLAHLAAENLTLGGILITHHHYDHTDGVA 65

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L K      ++GP  ++S   G+ H L D D+ D      K++ TPGHT+ HIC  F+N
Sbjct: 66  QLVKDDPTIKVYGP--KNSPFKGVTHPLVDSDSIDVLGINFKVLTTPGHTLDHIC--FVN 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D+    GDTLFS GCGR+FE +  +M+ SL K+K+      ++  HEYT+ N  FA + +
Sbjct: 122 DNMAFTGDTLFSGGCGRLFEGTSEQMWHSLNKLKTLPAGCKVFCTHEYTQANLTFAKAVE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           P N  L  +   V  +R ++  + P+TIS E K+NPF+R
Sbjct: 182 PRNPSLLAHSELVDELRKEDKISLPTTISQELKINPFMR 220


>gi|37747507|gb|AAH58945.1| Pnkd protein [Mus musculus]
          Length = 424

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 161 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 220

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 221 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 278

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 279 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 338

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 339 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPG 398

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 399 PTSDDGCSRAQLLEELRRLKDMHK 422


>gi|224824459|ref|ZP_03697566.1| hydroxyacylglutathione hydrolase [Lutiella nitroferrum 2002]
 gi|224602952|gb|EEG09128.1| hydroxyacylglutathione hydrolase [Lutiella nitroferrum 2002]
          Length = 252

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 122/251 (48%), Gaps = 13/251 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +  + DN+  L+      +  A+D  D   +   L   G  L  +  THHH DH      
Sbjct: 7   VPAFSDNYIWLLQQAGRAV--AVDPGDAAPVLAYLAAHGLALEAVLVTHHHADHVGGLAE 64

Query: 68  LKK-FFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + + +  I GP    + I  ++  + DG  F+  S    ++  PGHT+ H+ Y  + D
Sbjct: 65  LTRHYLHLRIIGP----ASIAQVNEAVMDGSRFELLSAQFDVLEVPGHTLDHLAY--LTD 118

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF  GCGR+FE S  +M  SL +I +  D T +Y  HEYT +N  FA + +P
Sbjct: 119 GRLFCGDTLFGAGCGRLFEGSPEQMHASLGRIAALPDSTRLYPAHEYTLSNLRFAAAVEP 178

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL---- 242
            N  +++  ++ ++  +    T PST+  E+  NPFLR    ++ +    +  + L    
Sbjct: 179 DNDAIRQRLAEDQATLAAGEPTLPSTLDKERATNPFLRTAVDAVTRRAAQQAGAPLTTPA 238

Query: 243 AVFTELRIRKN 253
           AVF  LR  KN
Sbjct: 239 AVFAVLREWKN 249


>gi|115949382|ref|XP_001191975.1| PREDICTED: similar to hydroxyacyl glutathione hydrolase
           [Strongylocentrotus purpuratus]
          Length = 272

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 120/222 (54%), Gaps = 11/222 (4%)

Query: 38  ISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN-CTIFGPLEESSKIPGIDHGLSDG 96
           + K + E+G  LT +  THHH DH   N  L K  +  T+ G      +I  ++  +  G
Sbjct: 50  VLKAVEEEGVNLTTVLTTHHHWDHAGGNEKLVKLASGLTVCGG---DDRIGALNKKVGHG 106

Query: 97  DTFDFGSHPIKIIATPGHTIGHICYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMF 152
           D F  G+  ++ + TP HT GHICY    D      +  GDTLF  GCG+ FE +  +M+
Sbjct: 107 DEFKVGNLQVRCLFTPCHTTGHICYFVQGDPSEAPVVFTGDTLFLSGCGKFFEGTPDQMY 166

Query: 153 ESL-EKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPS 211
            +L EK+    D T+++ GHEY+ ++  FALS +P N+ +QK     K  R++ L T PS
Sbjct: 167 AALIEKLSKLPDNTNVFCGHEYSVSSLSFALSVEPDNVSIQKKLEWAKDQRAKKLPTIPS 226

Query: 212 TISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKN 253
           T++ EK  NPF+R+   S++ ++   +   + V   LR  K+
Sbjct: 227 TLAEEKAYNPFMRVGAKSIQDHVG--STEPIEVMGRLRKEKD 266


>gi|26334311|dbj|BAC30873.1| unnamed protein product [Mus musculus]
          Length = 345

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 82  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 141

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 142 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 199

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 200 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 259

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 260 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPG 319

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 320 PTSDDGCSRAQLLEELRRLKDMHK 343


>gi|221067920|ref|ZP_03544025.1| hydroxyacylglutathione hydrolase [Comamonas testosteroni KF-1]
 gi|220712943|gb|EED68311.1| hydroxyacylglutathione hydrolase [Comamonas testosteroni KF-1]
          Length = 257

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 114/222 (51%), Gaps = 7/222 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  ++H+ ++ +   +D      +   L ++G  L  I  THHH DH    
Sbjct: 4   LPIPAFSDNYIWMLHDAEHAVV--VDPGQAEPVLSTLAQRGLKLQGILVTHHHADHVGGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY---H 122
             ++      ++GP  ES  +P     +  GD+ +    P ++I  PGHT GHI +    
Sbjct: 62  DAIRAATGAPVWGPAYES--LPEPVTRVQGGDSIELLGGPWQVIDVPGHTSGHIAFFSTR 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             ++  L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 120 AQSEPLLFCGDTLFSGGCGRLFEGTAAQMQASLDALAALPGSTLVCCAHEYTISNLRFAQ 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR 224
           + +P+N EL +Y    + +R     T PST+  E  +NPF+R
Sbjct: 180 AVEPNNPELAQYLEHCQQLRKSGQPTLPSTLQTELAINPFMR 221


>gi|9910442|ref|NP_064383.1| probable hydrolase PNKD isoform 1 [Mus musculus]
 gi|7670482|dbj|BAA95092.1| unnamed protein product [Mus musculus]
          Length = 360

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 97  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 156

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 157 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 214

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 215 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 274

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L     
Sbjct: 275 FAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPG 334

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 335 PTSDDGCSRAQLLEELRRLKDMHK 358


>gi|37524932|ref|NP_928276.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81420168|sp|Q7N809|GLO2_PHOLL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|36784358|emb|CAE13235.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 250

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 136/252 (53%), Gaps = 9/252 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ +   R    +D  ++  +   L  +GW    I  THHH DH    
Sbjct: 4   ISIPALSDNYIWLLCDEN-RHVVIVDPAESQPVLDTLESRGWIPDAILLTHHHHDHVGGV 62

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             +  +F    ++GP E  SK  G    +  GD+ +FG    +II  PGHT+GHI ++  
Sbjct: 63  PGIIDRFPELLVYGPAETQSK--GATIIVCGGDSINFGHFSFQIIDVPGHTLGHIAFY-- 118

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
              +L  GDTLFS GCGR+FE +  +M+ S+ KI    D T I   HEYT +N  FA + 
Sbjct: 119 QAPYLFCGDTLFSGGCGRLFEGTAEQMYTSIGKIAELPDDTLICCAHEYTISNMKFAHAV 178

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNL- 242
            P N  + +Y  KV  MR  N  T P+T+  EKK+N FL+ ++  L++N+ +  N+  L 
Sbjct: 179 LP-NQTISEYQQKVIRMRENNQPTIPTTLQTEKKINIFLKCDDIDLQRNIGITPNSQPLS 237

Query: 243 AVFTELRIRKNQ 254
           AVF +LR +K+Q
Sbjct: 238 AVFHQLRRQKDQ 249


>gi|197927180|ref|NP_001128222.1| myofibrillogenesis regulator 1 isoform 1 [Rattus norvegicus]
          Length = 385

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 126/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 181

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 182 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 239

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 240 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 299

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P N+  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 300 FAGVVEPENVARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLALQEALGPGPG 359

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 360 PTSDDGCSRAQLLEELRRLKDMHK 383


>gi|123968150|ref|YP_001009008.1| putative hydroxyacylglutathione hydrolase [Prochlorococcus marinus
           str. AS9601]
 gi|123198260|gb|ABM69901.1| Putative hydroxyacylglutathione hydrolase [Prochlorococcus marinus
           str. AS9601]
          Length = 303

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/238 (35%), Positives = 124/238 (52%), Gaps = 10/238 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN   L+   K      ID      + + + E  + L  I  THHH DH    
Sbjct: 67  IGLRVLSDNVIWLMAKDKS--VVVIDPSVHEPVIRYINENNFHLEAILQTHHHSDHIGGT 124

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L +K+ N  +    +E  +IP  +  + DG+T +     +KII   GHT  HI + F+
Sbjct: 125 KSLIEKWPNVKVIASSKEKKRIPFQNVSVEDGETLNILGEEVKIIEVLGHTSSHIAF-FL 183

Query: 125 NDH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           N     L +GDTLFS GCGRIFE +Y +M+ SLE+IKS    T IY  HEYT+ N  +AL
Sbjct: 184 NGENPVLFIGDTLFSGGCGRIFEGTYQQMYSSLERIKSLPKNTLIYCAHEYTKANILWAL 243

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNLNM 236
           +  P + +++   S+V+   S N  T P  +  E K+N FLR +N    T LR N ++
Sbjct: 244 NLKPKDQDIKNKLSEVEKKLSLNELTIPFLLDEEMKINLFLRAKNLEEFTFLRANKDL 301


>gi|160395578|sp|A2BQ40|GLO2_PROMS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
          Length = 246

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/238 (35%), Positives = 124/238 (52%), Gaps = 10/238 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN   L+   K      ID      + + + E  + L  I  THHH DH    
Sbjct: 10  IGLRVLSDNVIWLMAKDKS--VVVIDPSVHEPVIRYINENNFHLEAILQTHHHSDHIGGT 67

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L +K+ N  +    +E  +IP  +  + DG+T +     +KII   GHT  HI + F+
Sbjct: 68  KSLIEKWPNVKVIASSKEKKRIPFQNVSVEDGETLNILGEEVKIIEVLGHTSSHIAF-FL 126

Query: 125 NDH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           N     L +GDTLFS GCGRIFE +Y +M+ SLE+IKS    T IY  HEYT+ N  +AL
Sbjct: 127 NGENPVLFIGDTLFSGGCGRIFEGTYQQMYSSLERIKSLPKNTLIYCAHEYTKANILWAL 186

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNLNM 236
           +  P + +++   S+V+   S N  T P  +  E K+N FLR +N    T LR N ++
Sbjct: 187 NLKPKDQDIKNKLSEVEKKLSLNELTIPFLLDEEMKINLFLRAKNLEEFTFLRANKDL 244


>gi|53718983|ref|YP_107969.1| putative gultathione hydrolase [Burkholderia pseudomallei K96243]
 gi|76808758|ref|YP_333006.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710b]
 gi|126452658|ref|YP_001065771.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|134282857|ref|ZP_01769560.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|167815233|ref|ZP_02446913.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           91]
 gi|167823641|ref|ZP_02455112.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei 9]
 gi|167845185|ref|ZP_02470693.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           B7210]
 gi|167910429|ref|ZP_02497520.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           112]
 gi|167918454|ref|ZP_02505545.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           BCC215]
 gi|226196229|ref|ZP_03791814.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237811764|ref|YP_002896215.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           MSHR346]
 gi|242315974|ref|ZP_04814990.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106b]
 gi|254188365|ref|ZP_04894876.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198220|ref|ZP_04904642.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|254259838|ref|ZP_04950892.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710a]
 gi|254298050|ref|ZP_04965503.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|52209397|emb|CAH35342.1| putative gultathione hydrolase [Burkholderia pseudomallei K96243]
 gi|76578211|gb|ABA47686.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710b]
 gi|126226300|gb|ABN89840.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106a]
 gi|134245943|gb|EBA46034.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|157807384|gb|EDO84554.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|157936044|gb|EDO91714.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169654961|gb|EDS87654.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|225931815|gb|EEH27817.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506133|gb|ACQ98451.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           MSHR346]
 gi|242139213|gb|EES25615.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106b]
 gi|254218527|gb|EET07911.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710a]
          Length = 268

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 138/265 (52%), Gaps = 21/265 (7%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH DH    
Sbjct: 7   VPVPAFDDNYIWLVSDG--RQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHRDHVGGV 64

Query: 66  LNL----KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHI 119
             L    ++     +FGP  E+  I  I   ++ G+    G+  ++  +I  PGHT GHI
Sbjct: 65  AELLAGAREGEPIAVFGPAHEA--IEHITRRVAGGERVRIGAPALEFDVIDVPGHTRGHI 122

Query: 120 CYHF------MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
            Y           H  C GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEY
Sbjct: 123 AYFQPAGPGNAAPHLFC-GDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEY 181

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+C+P N  L  +  + ++ R++   T P+TI+ E  VNPFLR ++ S+R  
Sbjct: 182 TLSNIQFALACEPGNAALAAWRDEARARRARGEPTLPTTIAHECAVNPFLRADSASIRAT 241

Query: 234 LNM---ENASN-LAVFTELRIRKNQ 254
           L     E A + LA FT +R  KN+
Sbjct: 242 LEARLHEAAPDRLAAFTLMREWKNR 266


>gi|160900329|ref|YP_001565911.1| hydroxyacylglutathione hydrolase [Delftia acidovorans SPH-1]
 gi|160365913|gb|ABX37526.1| hydroxyacylglutathione hydrolase [Delftia acidovorans SPH-1]
 gi|222838903|gb|EEE77254.1| predicted protein [Populus trichocarpa]
          Length = 257

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 122/256 (47%), Gaps = 12/256 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  L+++    L   +D  D   +   LR+    L  I  THHH DH    
Sbjct: 4   LPIPAFSDNYIWLLYDAGQALV--VDPGDAAPVLASLRQLDLQLQGILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             L++     ++GP  E  ++P     +  GDT      P ++I  PGHT GHI ++   
Sbjct: 62  AQLRQATGAQVWGPAYE--QLPEPVQRVQGGDTVQALGGPWQVIDVPGHTSGHIAFYSTA 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE +  +M +SL+ + +  D T +   HEYT +N  FA 
Sbjct: 120 AQAQPVLFCGDTLFSGGCGRLFEGTPQQMQQSLDDLAALPDNTLVCCAHEYTMSNLRFAQ 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK-----NLNME 237
           + +P+N  L  Y    +++R     T PS +  E+ +NPFLR   +++       +  + 
Sbjct: 180 AVEPNNQALAHYQRHCQALREAGRPTLPSLMETERSINPFLRTRESAVAAAAAGFDAQVR 239

Query: 238 NASNLAVFTELRIRKN 253
                +V   LR  KN
Sbjct: 240 QQDPASVLAGLRQWKN 255


>gi|239815321|ref|YP_002944231.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus S110]
 gi|239801898|gb|ACS18965.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus S110]
          Length = 259

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 123/257 (47%), Gaps = 13/257 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +    +   +D  D   +   L      L  I  THHH DHT   
Sbjct: 4   VPLPAFADNYIWMLQDGSNAIV--VDPGDAQPVFDALARDKLQLAAILVTHHHPDHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       +FGP  E  +IP     LS GDT +       +I  PGHT GHI Y    
Sbjct: 62  AALHAATGAPVFGPARE--RIPQPFKPLSHGDTAEVLGLRFSVIDVPGHTAGHIAYFLPA 119

Query: 126 DH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT  N  FA
Sbjct: 120 SAGRAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDALAALPGDTRVCCAHEYTLANLRFA 179

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-----M 236
            + +P N +L +Y +  +S+R+Q   T PS ++ E+++NPFLR    ++ + +       
Sbjct: 180 RAVEPGNADLTQYSAHCESLRAQGRPTLPSQLATERRINPFLRSREATVLRAVREHAELS 239

Query: 237 ENASNLAVFTELRIRKN 253
            +A+   VF  LR  KN
Sbjct: 240 ADAAEAEVFAALRQWKN 256


>gi|21230446|ref|NP_636363.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769560|ref|YP_244322.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992768|ref|YP_001904778.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|81304485|sp|Q4URM1|GLO2_XANC8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81796010|sp|Q8PBY0|GLO2_XANCP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724036|sp|B0RTE9|GLO2_XANCB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|21112009|gb|AAM40287.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574892|gb|AAY50302.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734528|emb|CAP52738.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris]
          Length = 255

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 128/252 (50%), Gaps = 10/252 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +  +  R    +D      + +  + +G+       THHH DH     
Sbjct: 5   ALPAFDDNYIWALVANDGR-AVIVDPGQAAPVLEAAQREGFTPVAALLTHHHADHIGGVA 63

Query: 67  NLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L++ F    ++GP +E  ++P     ++ GDT         ++  PGHT  H+ Y  + 
Sbjct: 64  ELQQHFPALELYGPDDE--RMPSATRHVAHGDTVTALGIDFAVLEVPGHTRSHVAY--VG 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF++L+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DGHLFSGDTLFSLGCGRMFEGTPPQMFDALQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR+    +R     + ++   S+
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRLHTPEIRAAAAAHASISITSD 239

Query: 242 LAVFTELRIRKN 253
           + VF ELR  K+
Sbjct: 240 VDVFAELRRWKD 251


>gi|260824575|ref|XP_002607243.1| hypothetical protein BRAFLDRAFT_104472 [Branchiostoma floridae]
 gi|229292589|gb|EEN63253.1| hypothetical protein BRAFLDRAFT_104472 [Branchiostoma floridae]
          Length = 602

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 119/227 (52%), Gaps = 9/227 (3%)

Query: 12  HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKF 71
            DN+  L+ +   +  A +D  +   +   ++E+   LT +  THHH DH+  N  L K 
Sbjct: 353 QDNYMYLLVDETTKEAAIVDPVEPDKVVAAVKEEDVKLTTVLTTHHHWDHSGGNEQLAKM 412

Query: 72  FN-CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN----D 126
            +  T+ G      +I  ++  +  GD F  G+  +K + TP HT GHICY+       D
Sbjct: 413 VSGLTVCGG---DDRIGALNKKVGHGDQFKVGALNVKCLFTPCHTSGHICYYVTGEEGED 469

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKS-FSDKTHIYFGHEYTENNAYFALSCD 185
             +  GDTLF  GCGR FE +   M+++L +I      +T +Y GHEYT NN  +A   +
Sbjct: 470 PAVFTGDTLFVAGCGRFFEGTPDNMYKALVEILGILPQQTKVYCGHEYTVNNLKYAERVE 529

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           P N  +Q   +  KS R +N  T PSTI  E K NPF+R++ + +++
Sbjct: 530 PDNPAVQDKLAWAKSKRDKNQATVPSTIGDELKFNPFMRVKESPVQQ 576


>gi|149927488|ref|ZP_01915742.1| Metallo-beta-lactamase family protein [Limnobacter sp. MED105]
 gi|149823761|gb|EDM82987.1| Metallo-beta-lactamase family protein [Limnobacter sp. MED105]
          Length = 257

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 122/230 (53%), Gaps = 11/230 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRA-- 64
            I  + DN+   I +   +    +D   +  + + L   G+ L+ I  THHH+DH     
Sbjct: 16  GIPAFQDNYLWAIVHEPSKACMVVDPGCSKSVQEFLDSHGYHLSGILVTHHHMDHVGGID 75

Query: 65  NLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF- 123
            L  K   +  ++GP   S +I  I+  + +GDT D      +++  PGHT+ H+ Y   
Sbjct: 76  ALLSKAGKDLPVYGPA--SGRIAQINRPVREGDTVDVHCLVAQVLEVPGHTVDHLAYVIE 133

Query: 124 ----MN--DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
               MN  + ++  GDTLFS GCGR+FE S  +MFESL+K+  F   T +Y  HEYTE+N
Sbjct: 134 LKDTMNSEETWMFPGDTLFSGGCGRLFEGSAQQMFESLQKLNQFPANTRVYCAHEYTESN 193

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN 227
             FA +  P +  ++   ++V+ +R Q L T P+T+ +E+  N F+  +N
Sbjct: 194 MRFARTYSPESKNIEARENEVRRIREQGLSTIPTTLGIERLSNLFINAKN 243


>gi|197927184|ref|NP_001128223.1| myofibrillogenesis regulator 1 isoform 2 [Rattus norvegicus]
          Length = 360

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 126/264 (47%), Gaps = 15/264 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 97  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 156

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
            +L ++  +C ++G  ++   IP + H L   D    G   I+ +ATPGHT GH+ Y   
Sbjct: 157 RDLSRRHRDCRVYGSPQDG--IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLD 214

Query: 125 NDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + +     L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  
Sbjct: 215 GEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLG 274

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA   +P N+  ++    V+  R +   T PST+  E+  NPFLR    +L++ L     
Sbjct: 275 FAGVVEPENVARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLALQEALGPGPG 334

Query: 237 ----ENASNLAVFTELRIRKNQSK 256
               +  S   +  ELR  K+  K
Sbjct: 335 PTSDDGCSRAQLLEELRRLKDMHK 358


>gi|56479132|ref|YP_160721.1| Zn-dependent hydrolase [Aromatoleum aromaticum EbN1]
 gi|56315175|emb|CAI09820.1| Zn-dependent hydrolase [Aromatoleum aromaticum EbN1]
          Length = 263

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 122/254 (48%), Gaps = 12/254 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  L+   +  L A +D  D  ++   L  +G  L  I  THHH DH    
Sbjct: 14  IPLPAFRDNYLWLLRCGQ--LAAVVDPGDAAVVEDGLAAQGLDLCAILLTHHHADHVGGV 71

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK--IIATPGHTIGHICYHF 123
             L    +  +FGP   ++ I G+++ +++GD        I+  ++  PGHT  HI Y  
Sbjct: 72  TELIASRDIPVFGP--AAADIQGVNNPVAEGDEVSLDRLGIRFRVLEVPGHTASHIAY-- 127

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
           +    L  GDTLFS GCGR+   + A++  SL ++      T +Y  HEYT  N  FA  
Sbjct: 128 LAPGLLFPGDTLFSAGCGRLLGGTAAQLHASLRRLADLPGDTAVYCTHEYTLANLAFARV 187

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS----LRKNLNMENA 239
            DP N E  ++  + ++ R     T P+TI+ E++VNPFLR    +    +     +   
Sbjct: 188 ADPGNPERDEWLVECEARRDAGRPTLPTTIARERRVNPFLRTGEPAVMGVIADRTGVRPR 247

Query: 240 SNLAVFTELRIRKN 253
            +L  F  LR  K+
Sbjct: 248 DSLECFAALRAWKD 261


>gi|170726957|ref|YP_001760983.1| hydroxyacylglutathione hydrolase [Shewanella woodyi ATCC 51908]
 gi|169812304|gb|ACA86888.1| hydroxyacylglutathione hydrolase [Shewanella woodyi ATCC 51908]
          Length = 263

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 136/264 (51%), Gaps = 15/264 (5%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           T L I  I  ++DN+  +I      L   +D  D  ++   L      L  I  THHH D
Sbjct: 5   TDLTITPIQAFNDNYIWVISKSSSPLVYVVDPGDANVVIHYLETNQLTLAGILITHHHSD 64

Query: 61  HTRANLNLKKF--FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTI 116
           HT    +L ++   +  I+GP   S  I  I++ +S        +  +  ++   PGHT+
Sbjct: 65  HTGGIKSLIEYSATDLEIYGP--SSENIADINNPISTQPHIKLQALELTARVYQLPGHTL 122

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI YH + D   C GDTLFS GCGR+FE + +++  SLE + S    T +Y  HEYT +
Sbjct: 123 GHIAYH-IQDELFC-GDTLFSGGCGRLFEGTASQLHHSLELLASLEQHTRVYCAHEYTLS 180

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR-----IENTSLR 231
           N  FA+  +P+N +L  Y    +++R+    T PSTI  EK++NPFLR     I N ++ 
Sbjct: 181 NLKFAIRVEPNNSQLAHYYQDCQTLRANKKITLPSTIKTEKEINPFLRCHIHEIVN-AVN 239

Query: 232 KNLNMENASNLAVFTELRIRKNQS 255
           ++ N +    +  F  LR  K+++
Sbjct: 240 QHFNQKPVDTVTTFGLLRQWKDKA 263


>gi|325179671|emb|CCA14069.1| hydroxyacylglutathione hydrolase putative [Albugo laibachii Nc14]
          Length = 324

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 126/257 (49%), Gaps = 16/257 (6%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLRE-----KGWFLTHIFNTHHHIDHT 62
           I +++DN+  ++ +   ++  A+D  +   I  +L E     K  FL  I  TH H DH 
Sbjct: 69  IPMFNDNYGYIVIDEANQVMFAVDPAEPARILPVLLEEETVKKRTFLG-ILTTHKHADHA 127

Query: 63  RANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             N  L +++    + GP  E   +P     +  G TF  GS  IK++    HT GH+ Y
Sbjct: 128 GGNAELVQRYPQAMVIGPANE--HVPACTMQVKGGQTFCIGSIHIKVLDVACHTRGHVAY 185

Query: 122 HFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTEN 176
               D      L  GD LF  GCGR FE +  +M+ +L E I      T  Y GHEYT +
Sbjct: 186 VVTGDRATPPLLFPGDVLFVGGCGRFFEGTAEDMYHALYEVILQLPKDTRCYCGHEYTMS 245

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FALS DP N  L+     +K  RS+NL T PST+  E   NPFLR+   ++RK +  
Sbjct: 246 NLRFALSVDPSNTVLRDKMKAMKLRRSKNLPTVPSTLREEMLFNPFLRVHTETIRKAVG- 304

Query: 237 ENASNLAVFTELRIRKN 253
             +  + V   LR RK+
Sbjct: 305 -GSDPVTVLENLRRRKD 320


>gi|289741115|gb|ADD19305.1| glyoxylase [Glossina morsitans morsitans]
          Length = 301

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 122/230 (53%), Gaps = 15/230 (6%)

Query: 12  HDNFCILIHNHKYRLTAAIDA--PDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
            DN+  LI     R  A +D   PDT +  + ++++   L  +  THHH DH   N  L 
Sbjct: 55  QDNYMYLIICGSTREAAIVDPVYPDTVL--QAVKDENVKLKKVLTTHHHWDHAGGNEKLL 112

Query: 70  KFFNCTIFGPLE---ESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN- 125
           + F+     PLE     ++I G++  +   D    G+  +  + TP HT GHICY+  + 
Sbjct: 113 QMFSL----PLEVYGGDNRIGGLNCMVKQNDHLKIGNLDVTCLFTPCHTSGHICYYVQSA 168

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYFAL 182
             D ++  GDTLF  GCGR FE +  +M+++L +++ S  D T ++ GHEYT  N  +AL
Sbjct: 169 TGDRYVFTGDTLFQGGCGRFFEGTADQMYDALCKQLSSLPDDTKVFCGHEYTLQNMSYAL 228

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
             +PHN  + K     K  R+    T PSTI+ EK  NPF+R+   S++K
Sbjct: 229 HVEPHNENILKRIEWAKLRRATKSPTVPSTIAQEKSWNPFMRVHEPSVQK 278


>gi|126335303|ref|XP_001365859.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 282

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 120/232 (51%), Gaps = 8/232 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            IS+  DN+  L+     R   A+DA     + ++++++G  LT +  THHH DH+R N 
Sbjct: 5   VISVLEDNYMYLVIEENTREAIAVDAAVPKRLLEIVQKEGVKLTTVLTTHHHWDHSRGNE 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L +   C          +I  + H L+      FG+  ++ + TPGHT+GH+CY    D
Sbjct: 65  ELMQL--CPGLQVYGADERIGALTHKLTHNQELKFGAICVRCLLTPGHTLGHMCYFMWED 122

Query: 127 H-----FLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHIYFGHEYTENNAYF 180
           +      +  GD LF  GCGR+ E +  +M+ SL E + +   +T ++ GHE+T  N  F
Sbjct: 123 NCPDAPAVFSGDALFIGGCGRLLEGTPEQMYRSLNEALGTLPKETKVFCGHEHTVRNLKF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           AL  +P N  ++   +  K+    ++ T PST+  E   NPFLR+   S++K
Sbjct: 183 ALKVEPDNETVKTKLAWAKARDDDDIPTVPSTLGEEFHYNPFLRVAEESVQK 234


>gi|92114067|ref|YP_573995.1| hydroxyacylglutathione hydrolase [Chromohalobacter salexigens DSM
           3043]
 gi|122419844|sp|Q1QW62|GLO2_CHRSD RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91797157|gb|ABE59296.1| Hydroxyacylglutathione hydrolase [Chromohalobacter salexigens DSM
           3043]
          Length = 255

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 124/252 (49%), Gaps = 5/252 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+          +D  D   + + L  +G  L  I  THHH DHT   
Sbjct: 5   IPIPAFQDNYIWLLRQDASDKVVIVDPGDAQPVIEYLEREGLSLAAILVTHHHHDHTGGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K ++  + GP  ++S IP ID  + D D         ++ A PGHT+ HI ++   
Sbjct: 65  DALVKRYSPRVIGP--DNSAIPAIDEVVGDEDECRVQGRRFEVFAVPGHTLDHIAFYAPG 122

Query: 126 -DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFS GCGR+FE +  +M  SL ++ +  D T ++ GHEYT  N  FA + 
Sbjct: 123 TPGLLFCGDTLFSGGCGRLFEGTAEQMHRSLARLAALPDDTLVFAGHEYTLANLRFAQAA 182

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNL 242
           +P N     +  + +  R     T PSTI  E+++NPFLRI+   L   L  + +   + 
Sbjct: 183 EPDNPARDAHLGECERARQLERPTLPSTIGRERQINPFLRIDQPGLLNALAEQGSVDDDS 242

Query: 243 AVFTELRIRKNQ 254
           A F  LR  K++
Sbjct: 243 AAFATLRGWKDR 254


>gi|325920990|ref|ZP_08182876.1| hydroxyacylglutathione hydrolase [Xanthomonas gardneri ATCC 19865]
 gi|325548524|gb|EGD19492.1| hydroxyacylglutathione hydrolase [Xanthomonas gardneri ATCC 19865]
          Length = 255

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 126/253 (49%), Gaps = 10/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +     R    +D      +    + +G+  + +  THHH DH     
Sbjct: 5   ALPAFEDNYIWALVAADGR-AVIVDPGQAEPVFAAAKREGFTPSAVLLTHHHADHIGGVA 63

Query: 67  NLK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L+ ++ +  +FGP +E S  P     +  G+         +++  PGHT+ HI   F+ 
Sbjct: 64  ALQQRWPDLELFGPADERS--PADARQVGQGERLTLLGMGFEVLEVPGHTLSHIA--FVT 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DEHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANASFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI----ENTSLRKNLNMENASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR        +     +   +S+
Sbjct: 180 PTNAALQRRQQEAQAMRQAARPTLPISLKSELATNPFLRTSSSEIRAAAAARASCALSSD 239

Query: 242 LAVFTELRIRKNQ 254
           + VF ELR  K++
Sbjct: 240 VDVFAELRRWKDE 252


>gi|300823397|ref|ZP_07103527.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 119-7]
 gi|300524015|gb|EFK45084.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 119-7]
          Length = 216

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L +KF    ++GP E   K  G    + DG+T     H   +IATPGHT+GHICY F  
Sbjct: 64  ELVEKFPQIVVYGPQETQDK--GTTQVVKDGETAFVLGHEFSVIATPGHTLGHICY-FSK 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
            +  C GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  
Sbjct: 121 PYLFC-GDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPF 222
           PH+L +  Y  KVK +R++N  T P  +  E+++N F
Sbjct: 180 PHDLSINDYYRKVKELRAKNQITLPVILKNERQINVF 216


>gi|158288855|ref|XP_310681.3| AGAP000416-PA [Anopheles gambiae str. PEST]
 gi|157018772|gb|EAA06259.3| AGAP000416-PA [Anopheles gambiae str. PEST]
          Length = 265

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 130/268 (48%), Gaps = 18/268 (6%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S+ +  I    DNF  L+  +  R  A ID  +   + ++ RE+G  L  +  THHH 
Sbjct: 1   MASMTVTKIPALKDNFMYLVVCNATRQAAVIDPVEPARVLEVAREQGCKLNQLLTTHHHW 60

Query: 60  DHTRANLNL-------KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATP 112
           DH   N  L         +   T++G  +E  +IPG+ + +   DTF  G   ++ +ATP
Sbjct: 61  DHAGGNEALCEQYRQHADWGQLTVYGGDDE--RIPGLTNRVGQDDTFAIGQLRVRCLATP 118

Query: 113 GHTIGHICYHF----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESL-EKIKSFSDKTHI 167
            HT  H+CY+       +  +  GDTLF  GCGR FE +  +M+++L  K+ +  D T +
Sbjct: 119 CHTTSHVCYYVEGGDRGERAVFTGDTLFLAGCGRFFEGTPDQMYDALIGKLSALPDDTRV 178

Query: 168 YFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT-NPSTISLEKKVNPFLRIE 226
           Y GHEY   N  F    +P N + +    + ++   +      PSTI  EK++N F+R+ 
Sbjct: 179 YCGHEYALQNLRFGHQVEPDNADTRALLERAQAADLEGRRALVPSTIGQEKRINVFMRVH 238

Query: 227 NTSLRKNLNMENASNLAVFTELRIRKNQ 254
             +++  +     + L     LR  K++
Sbjct: 239 QPAVQAYVG--KGTPLETMQALRAAKDK 264


>gi|238784818|ref|ZP_04628