PSIBLAST alignment of GI: 254780583 and protein with PDB id: 1qh3

gi|6137437|pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions Present In The Active Site Length = 260
>gi|6137438|pdb|1QH3|B Chain B, Human Glyoxalase Ii With Cacodylate And Acetate Ions Present In The Active Site Length = 260
 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 66  LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 124 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAVRREKDQFK 256