PSIBLAST alignment of GI: 254780583 and protein with PDB id: 2p18

>gi|165760938|pdb|2P18|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii Length = 311
>gi|165760939|pdb|2P1E|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii With D-Lactate At The Active Site Length = 311
 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 66/266 (24%), Positives = 103/266 (38%), Gaps = 34/266 (12%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDA-PDTYIISKMLREK-----GWFLTH----IFNTHH 57
           +    DNF  LI++H     AA+D   D   I   + E         +T+    I +TH 
Sbjct: 34  VPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGNADVTYTFSTILSTHK 93

Query: 58  HIDHTRANLNLKKFFNCTI-----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATP 112
           H DH+  N  LK                  +  IP +   + +GD    G   +++I  P
Sbjct: 94  HWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAP 153

Query: 113 GHTIGHICYHFMNDHFL------CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT- 165
            HT GH+ Y   +            GDT+F  G G  FE    +M  ++EK+        
Sbjct: 154 CHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGND 213

Query: 166 -------HIYFGHEYTENNAYFALSCDPHNL-----ELQKYCSKVKSMRSQNLYTNPSTI 213
                   I+ GHEYT     F+    P         +Q   +K  +       + PS++
Sbjct: 214 YALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSL 273

Query: 214 SLEKKVNPFLRIENTSLRKNLNMENA 239
           + EK+ N FLR+ + +    +N  NA
Sbjct: 274 AEEKRQNLFLRVADPAFVAKMNQGNA 299