BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus
Liberibacter asiaticus str. psy62]
         (256 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|288962843|ref|YP_003453137.1| hydroxyacylglutathione hydrolase [Azospirillum sp. B510]
 gi|288915109|dbj|BAI76593.1| hydroxyacylglutathione hydrolase [Azospirillum sp. B510]
          Length = 255

 Score =  231 bits (588), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 96/251 (38%), Positives = 145/251 (57%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++ +        +D  D   +   L  +GW LTHIF THHH DH    
Sbjct: 4   ILVPAFADNYIYVLRDAASGKVGVVDPGDAAPVQAELERRGWSLTHIFLTHHHDDHIGGA 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK      + G   ++ +IPG+D  L DGD   FG    +++A PGHT GHI + F  
Sbjct: 64  AALKARHGAIMVGARADAHRIPGLDVALGDGDRTVFGEQTARVMAVPGHTSGHIAFWFEA 123

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFSLGCGR+FE + A+M++SL  +++ +D+T +Y GHEYT++N  FAL+ D
Sbjct: 124 AETLFSGDTLFSLGCGRLFEGTPAQMWDSLRSLRALTDQTLVYCGHEYTQSNGRFALTVD 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L +   +V ++R +   T P+TI +E++ NPFLR ++  ++  + M  A  + VF
Sbjct: 184 PRNGALHQRMEEVAALRERGRPTLPTTIGMERRTNPFLRADDPGVQSAIGMAGAPAVEVF 243

Query: 246 TELRIRKNQSK 256
            ELR RK+  +
Sbjct: 244 AELRRRKDHFR 254


>gi|154252030|ref|YP_001412854.1| hydroxyacylglutathione hydrolase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155980|gb|ABS63197.1| Hydroxyacylglutathione hydrolase [Parvibaculum lavamentivorans
           DS-1]
          Length = 256

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 115/256 (44%), Positives = 154/256 (60%), Gaps = 1/256 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           MT L I       DN+  L+H     +TAAID P+   I   L EKGW LTHI NTHHH 
Sbjct: 1   MTKLQIHQFPCLSDNYGYLVHEPSSGMTAAIDTPEVKPILDALAEKGWKLTHILNTHHHF 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  LK+   CTI GP  E   IPGID  + +GD  + G+   +++  PGHT GHI
Sbjct: 61  DHAGGNAELKEKTGCTIIGPKGEEGAIPGIDRAVQEGDIVELGAARARVLDVPGHTRGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F +DH   VGDTLF+LGCGR+FE +  +M+ SL K+ +  D T +Y  HEYT++NA 
Sbjct: 121 AYSFDDDHIAFVGDTLFALGCGRLFEGTAQQMWTSLGKLMALPDDTVVYCAHEYTQSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P N  L     ++ + R++  +T P+TI LEK  NPFLR  +  LR+ + +E A
Sbjct: 181 FALSVEPQNEALIARAKEIDAKRARGEWTVPTTIGLEKATNPFLRAASADLRRTIGLETA 240

Query: 240 SNLAVFTELRIRKNQS 255
           +++ VF E R RK+  
Sbjct: 241 ADVDVFAETRKRKDNF 256


>gi|262277919|ref|ZP_06055712.1| hydroxyacylglutathione hydrolase [alpha proteobacterium HIMB114]
 gi|262225022|gb|EEY75481.1| hydroxyacylglutathione hydrolase [alpha proteobacterium HIMB114]
          Length = 256

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 97/256 (37%), Positives = 145/256 (56%), Gaps = 1/256 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+ L +  +    DN+  +I N   +    +D  +   +   +++ G  L +I  THHH 
Sbjct: 1   MSLLQVNLVHCLSDNYSYIISNPITKKAIVVDPAEAEPVINSIKKLGLKLEYILITHHHA 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  LK+ +NC I G   +S +IPGID  + D + F+F    I++   PGHT GHI
Sbjct: 61  DHVGGNNELKEKYNCKIIGFKNDSRRIPGIDIQIKDKEIFNFEDEEIELNFAPGHTSGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F  +    VGD +FSLGCGRIFE +  +M++S+ KIKS  ++T IY GHEYTE+N  
Sbjct: 121 FYFFKKNKLAFVGDVVFSLGCGRIFEGTPEQMYKSVMKIKSLPEETKIYCGHEYTESNLK 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           F L+ D  N  L+K   +V+ +R + L T P+TIS EKK N F R +  ++ + L ++ +
Sbjct: 181 FCLAYDADNHNLKKRGDEVRELRQKGLPTIPTTISDEKKNNIFFRCDENTIIEKLGLKTS 240

Query: 240 SNLAVFTELRIRKNQS 255
               VF +LR  K+  
Sbjct: 241 EPQMVFKKLRELKDNF 256


>gi|254512519|ref|ZP_05124586.1| hydroxyacylglutathione hydrolase [Rhodobacteraceae bacterium KLH11]
 gi|221536230|gb|EEE39218.1| hydroxyacylglutathione hydrolase [Rhodobacteraceae bacterium KLH11]
          Length = 261

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 95/255 (37%), Positives = 142/255 (55%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    DN+  L H+     TA IDAP+   I   L  +GW L+H   THHH D
Sbjct: 7   MPLEIVTIPCLSDNYAFLAHDPVSGETALIDAPEAAPILAALESRGWQLSHALLTHHHPD 66

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     ++       + G   +  ++P +D  +++GDTF  G   ++++   GHTIGHI 
Sbjct: 67  HVDGLFDILAKHPARVIGAKADEHRLPELDQAVAEGDTFYIGGDLVEVLDVSGHTIGHIA 126

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H         GD+L +LGCGR+FE   A+M+ SL K+ +  D+T +  GHEYT++NA F
Sbjct: 127 FHMPETGAAFTGDSLMALGCGRLFEGKPAQMWASLGKLAALPDETIVCSGHEYTQSNAKF 186

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  LQ   + +   R+    T PS ++LEK  NPFLR  + +++ +L MENA 
Sbjct: 187 ALTIDPDNAALQDRVADINRARAAGEPTVPSVLALEKATNPFLRAADPAIQAHLGMENAD 246

Query: 241 NLAVFTELRIRKNQS 255
             +VF E+R RK++ 
Sbjct: 247 PTSVFAEIRARKDRF 261


>gi|330813476|ref|YP_004357715.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486571|gb|AEA80976.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 253

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 99/248 (39%), Positives = 154/248 (62%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+   I + + +  A +D  +   +   L +    L  I NTHHH DH   N +
Sbjct: 6   IPCLTDNYSYCIVDPETKKVAIVDPAEFNAVDSFLEKNNLSLDFILNTHHHGDHVDGNRS 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L+K +NC I G   + ++IPGID  L DG  + F +  +++   PGHT GHI Y+F  ++
Sbjct: 66  LQKKYNCKIVGFAPDHNRIPGIDILLDDGQVWKFANTEVEVHHVPGHTSGHIFYYFKKNN 125

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
              VGD +FSLGCGRIFE +Y EM  S+++I+    +T ++ GHEYTE+N  F +S DP+
Sbjct: 126 LAFVGDVVFSLGCGRIFEGTYEEMLASVDQIRKLPPETKVFCGHEYTESNLAFCMSVDPY 185

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N +L+K  ++++S+R QN  T P+TI +E K N F R+++ ++RK+L++ NA++L VFT+
Sbjct: 186 NDDLKKRATEIESLRRQNKPTIPTTIGMELKTNIFFRLDDLTVRKSLSLNNATDLEVFTK 245

Query: 248 LRIRKNQS 255
           LR  K+  
Sbjct: 246 LRELKDNF 253


>gi|260432834|ref|ZP_05786805.1| hydroxyacylglutathione hydrolase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416662|gb|EEX09921.1| hydroxyacylglutathione hydrolase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 255

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 147/255 (57%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    DN+  L H+     TA IDAP+T  I   L  +GW LTH+  THHH D
Sbjct: 1   MPLEIVTIPCLSDNYAFLAHDPASGETALIDAPETDPILSELDARGWRLTHVLLTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      +       + G   ++ ++P +D  +++GD F+ G  P+++    GHT+GH+ 
Sbjct: 61  HVDGLAGIVARHPAKVIGAAADAHRLPHLDMQVAEGDRFEIGGEPVEVFDVSGHTVGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+    H +   D+L +LGCGR+FE + A+M+ SL K+ +  D T +  GHEYT++NA F
Sbjct: 121 YYMPQSHAVFTADSLMALGCGRLFEGNAAQMWASLCKLAALPDDTLVCSGHEYTQSNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N +L+   +++ + R+    T PS++ LEK  NPFLR +N +++ +L M  A 
Sbjct: 181 ALTVDPDNPDLRGRAAEIDAARAAGRPTVPSSLGLEKATNPFLRADNPAIQAHLGMAGAD 240

Query: 241 NLAVFTELRIRKNQS 255
              VF+E+R RK++ 
Sbjct: 241 PAQVFSEIRGRKDRF 255


>gi|307822371|ref|ZP_07652603.1| hydroxyacylglutathione hydrolase [Methylobacter tundripaludum SV96]
 gi|307736937|gb|EFO07782.1| hydroxyacylglutathione hydrolase [Methylobacter tundripaludum SV96]
          Length = 254

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 104/255 (40%), Positives = 153/255 (60%), Gaps = 1/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++ + + + +DN+  L+H+     TA +D      +  +L +KGW LT I NTHHH D
Sbjct: 1   MLTI-LTLPVLNDNYIYLVHDPVSGETAVVDPAVAQPVLNVLDQKGWQLTTILNTHHHSD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   NL LK+   CT+  PL +  +IPGID G+ DG+    G H  ++I+TPGHT GH+ 
Sbjct: 60  HVGGNLELKQKTGCTVIAPLSDQHRIPGIDRGVVDGNEITLGKHTARVISTPGHTSGHVV 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF +D+ L  GDTLF +GCGR+FE +  +M+ SL+K+K+    T IY  HEYT+ N  F
Sbjct: 120 YHFADDNTLFCGDTLFVMGCGRLFEGTAEQMWHSLQKLKALPTSTRIYCAHEYTQANGRF 179

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N +LQ+    +  +R+  L T PSTI  E   NPF R ++ +L++ + M N  
Sbjct: 180 ALTVEPDNRQLQQRMDVINQLRANRLPTVPSTIEQELATNPFFREDSLALQETIKMANKK 239

Query: 241 NLAVFTELRIRKNQS 255
              VF E+R  K+  
Sbjct: 240 PAEVFAEVRRLKDNF 254


>gi|86607653|ref|YP_476415.1| glyoxalase II family protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123504126|sp|Q2JPX4|GLO2_SYNJB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86556195|gb|ABD01152.1| glyoxalase II family protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 252

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 91/256 (35%), Positives = 133/256 (51%), Gaps = 5/256 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L   +    DN+  L+HN      A +D      + + L E G  L  IFNTHHH D
Sbjct: 1   MRVLQ--LPALRDNYIYLLHNPDTATAAVVDPAVAEPVLEKLAELGAELVAIFNTHHHHD 58

Query: 61  HTRANLNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           H   N  L + +    ++G   +  +IPG    L  G+T +F     K++  PGHT GHI
Sbjct: 59  HVGGNRQLLERYPRARVYGSQVDRGRIPGQTVELKAGETVEFAGRLAKVLFVPGHTRGHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+F     L  GDTLF+ GCGR+FE +  +M  SL++++   + T ++  HEYT NN  
Sbjct: 119 AYYFSESGDLFCGDTLFAGGCGRLFEGTPEQMVGSLDQLRQLPEATRVWCAHEYTLNNLR 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N +LQ    +V ++R     T PSTI  E++ NPFLR +  +L+    ++  
Sbjct: 179 FALTVDGDNPDLQARYQQVAALRQTGSPTVPSTIGEERRTNPFLRWDQPALQAATGLQ-- 236

Query: 240 SNLAVFTELRIRKNQS 255
             + VF  LR  K+Q 
Sbjct: 237 DPVRVFARLRGMKDQF 252


>gi|86605820|ref|YP_474583.1| glyoxalase II family protein [Synechococcus sp. JA-3-3Ab]
 gi|123506832|sp|Q2JVC3|GLO2_SYNJA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86554362|gb|ABC99320.1| glyoxalase II family protein [Synechococcus sp. JA-3-3Ab]
          Length = 252

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 91/256 (35%), Positives = 131/256 (51%), Gaps = 5/256 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L   +    DN+  L+H+ +    A +D      +   L E G  L  IFNTHHH D
Sbjct: 1   MRILQ--LPALRDNYIYLLHDPETATAAVVDPTVAEPVLDKLAELGAELVAIFNTHHHHD 58

Query: 61  HTRANLNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           H   NL L   +    ++G   +  +IPG    L  G+T  F     K++  PGHT GH+
Sbjct: 59  HVGGNLQLLARYPRAVVYGSQADRGRIPGQTVELQAGETVAFAGRQAKVLFVPGHTRGHV 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+F     L  GDTLF+ GCGR+FE +  +M  SL++++   + T ++  HEYT NN  
Sbjct: 119 AYYFPESGDLFCGDTLFAGGCGRLFEGTPEQMLGSLDQLRQLPEATRVWCAHEYTLNNLK 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N +LQ    +V ++R     T PSTI  E++ NPFLR +  +LR     +  
Sbjct: 179 FALTVDGDNPDLQARYQQVVALRQAGSPTVPSTIGEERRTNPFLRWDQPALRAATGAQ-- 236

Query: 240 SNLAVFTELRIRKNQS 255
             + VF  LR  K+Q 
Sbjct: 237 DPVRVFARLRGMKDQF 252


>gi|254466347|ref|ZP_05079758.1| hydroxyacylglutathione hydrolase [Rhodobacterales bacterium Y4I]
 gi|206687255|gb|EDZ47737.1| hydroxyacylglutathione hydrolase [Rhodobacterales bacterium Y4I]
          Length = 257

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 91/255 (35%), Positives = 142/255 (55%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    I +    DN+  LIHN     TA +DAP+   +   L E+GW L  I  THHH D
Sbjct: 3   MPLEIITLPCLSDNYAFLIHNPASGETALVDAPEAGAVKAALAERGWGLDWILLTHHHWD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +   + G   ++ ++P +D  + DG TF      ++++   GHT+GHI 
Sbjct: 63  HVDGVAELREAYGAKVIGAEADAHRLPPLDKAVEDGGTFSLMGEEVQVMDVSGHTVGHIA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH      +   D+L +LGCGR+FE +  +M+ SL ++ +   +T +Y GHEYT+ NA F
Sbjct: 123 YHIPGAAAVFTADSLMALGCGRLFEGTPQQMWASLSRLAALPAQTVVYSGHEYTQANAGF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A++ DP N  LQ+    +   R + + T PS++ LE   NPFLR  ++++R +L ME+A 
Sbjct: 183 AVTVDPGNPALQERARDIARAREKGIPTVPSSLQLELDTNPFLRAADSAIRAHLGMEDAE 242

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 243 DAEVFAEIRKRKDNF 257


>gi|255078470|ref|XP_002502815.1| hydroxyacylglutathione hydrolase [Micromonas sp. RCC299]
 gi|226518081|gb|ACO64073.1| hydroxyacylglutathione hydrolase [Micromonas sp. RCC299]
          Length = 254

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 102/248 (41%), Positives = 149/248 (60%), Gaps = 1/248 (0%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+     TA +D P+   I   L+EKGW LTHI NTHHH DHT  N  L
Sbjct: 7   PCLQDNYSFLLHDPSTGATAVVDTPEVAPIEAALKEKGWKLTHILNTHHHWDHTGGNAEL 66

Query: 69  KKFFNCTIFGPL-EESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           K    C + GP  E   +IPG D  + +GD    G+   +++ TPGHT GH+ YHF  + 
Sbjct: 67  KARHGCVVIGPSGERKGEIPGADRAVREGDEVAVGNVVARVLDTPGHTAGHVVYHFPTEK 126

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            + VGDT+F++GCGR+FE +  +M+ S++KI +    T ++  HEYT +NA FA+S +P 
Sbjct: 127 KVFVGDTMFAMGCGRLFEGTADQMWSSIQKITAMPPDTEVFCAHEYTLSNAKFAVSVEPD 186

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  LQ    +V+  R++ + T P+T++LE   NPF R ++  LR+ L +E A ++AVF E
Sbjct: 187 NEALQARLREVEVKRAKGVPTVPTTVALELATNPFCRPDSVLLRRTLGLEGADDVAVFAE 246

Query: 248 LRIRKNQS 255
            R RK+  
Sbjct: 247 TRRRKDNF 254


>gi|83854837|ref|ZP_00948367.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           NAS-14.1]
 gi|83842680|gb|EAP81847.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           NAS-14.1]
          Length = 255

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 140/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   + I    DN+  L+ +      A ID P+   I+  L E GW LT I+ THHH D
Sbjct: 1   MSFDLVTIPCLSDNYAFLLRDQTSGKVALIDVPEAAPIAAKLDELGWTLTEIWITHHHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L       + G   ++ ++P +D    DG +F FG+H + +I   GHT+GHI 
Sbjct: 61  HIQGVPALIADHPARVIGAKADAERLPPLDAAYDDGQSFTFGAHTVDVIDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H      +   D+L +LGCGR+FE + A+M++SL+K+      T +  GHEYT++NA F
Sbjct: 121 FHVPAAKCVFTADSLMALGCGRLFEGTPAQMWDSLQKLMRLPADTTVCSGHEYTQSNAKF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  L     ++   R+    T PST+S E + NPFLR  +  +R  L M NA+
Sbjct: 181 ALTVDPENAALISRAREIDQARADGEPTVPSTLSTELETNPFLRPSDPGIRAQLGMVNAT 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DTDVFAEIRARKDRF 255


>gi|149202406|ref|ZP_01879379.1| Hydroxyacylglutathione hydrolase [Roseovarius sp. TM1035]
 gi|149144504|gb|EDM32535.1| Hydroxyacylglutathione hydrolase [Roseovarius sp. TM1035]
          Length = 278

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 145/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L H+    +TA ID P+   I + L +KGW  + +  THHH D
Sbjct: 24  MVLQILTVPCLADNYAYLAHDPATGVTAVIDVPEAEPILQALDKKGWSASLVLLTHHHAD 83

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L+   + ++ G   ++ ++P +DH +++GD    GS   +++   GHT+GHI 
Sbjct: 84  HVQGLDALRARHSVSVIGAAADAHRLPPLDHRVTEGDLIKIGSEEGRVLDVSGHTLGHIA 143

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF     +   D+L ++GCGR+FE +  +MFESL K+ +   +T +  GHEYT++NA F
Sbjct: 144 FHFPTSAVVFTADSLMAMGCGRVFEGTMPQMFESLGKLANLPPETLVCSGHEYTQSNAKF 203

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  L     ++ + R+    T PST++ E   NPFLR EN S++ +L M   +
Sbjct: 204 ALTVDPDNPALISRVKEISAARAAGRPTVPSTLAEELATNPFLRAENASVQAHLGMSGRA 263

Query: 241 NLAVFTELRIRKNQS 255
            + VF E+R RK++ 
Sbjct: 264 PVDVFAEIRARKDRF 278


>gi|83941360|ref|ZP_00953822.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           EE-36]
 gi|83847180|gb|EAP85055.1| hydroxyacylglutathione hydrolase, putative [Sulfitobacter sp.
           EE-36]
          Length = 255

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 141/255 (55%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   + I    DN+  L+ +      A ID P+   I+  L E GW LT I+ THHH D
Sbjct: 1   MSFDLVTIPCLSDNYAFLLRDQTSGKVALIDVPEAAPIAAKLDELGWTLTEIWLTHHHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L   +   + G   ++ ++P +D    DG +F FG+H + +I   GHT+GHI 
Sbjct: 61  HIQGVPALIADYPARVIGAKADAERLPPLDAAYDDGQSFTFGAHTVDVIDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H      +   D+L +LGCGR+FE + A+M++SL+K+      T +  GHEYT++NA F
Sbjct: 121 FHVPVAKCVFTADSLMALGCGRLFEGTPAQMWDSLQKLMRLPADTTVCSGHEYTQSNAKF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  L     ++   R+    T PST+S E + NPFLR  +  +R  L M NA+
Sbjct: 181 ALTVDPENAALISRAREIDQARADGEPTVPSTLSTELETNPFLRPSDPGIRAQLGMVNAT 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DTDVFAEIRARKDRF 255


>gi|254485820|ref|ZP_05099025.1| hydroxyacylglutathione hydrolase [Roseobacter sp. GAI101]
 gi|214042689|gb|EEB83327.1| hydroxyacylglutathione hydrolase [Roseobacter sp. GAI101]
          Length = 255

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 91/250 (36%), Positives = 142/250 (56%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +      A ID P+   IS  L + GW LT I+ THHH DH +  
Sbjct: 6   VTIPCLSDNYAFLLRDQASGAVALIDVPEAAPISAKLDDLGWTLTEIWLTHHHPDHIQGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L       I G   ++ ++P +DH +SDG+TF F  H ++++   GHT+GHI ++   
Sbjct: 66  PDLITEHPARIIGAKADAHRLPDLDHAVSDGETFQFAGHEVQVMDVSGHTVGHIAFYVPA 125

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M+ S++K+    + T +  GHEYT++NA FAL+ D
Sbjct: 126 AKCVFTADSLMALGCGRLFEGTAAQMWSSMQKLMKLPEDTTVCSGHEYTQSNAKFALTVD 185

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     ++   R   + T PST+  E + NPFLR  +  +R  L M+NA++  VF
Sbjct: 186 PKNDALISRSREIDLARKNGVPTVPSTLVTELQTNPFLRPGDPGIRTQLGMKNATDTDVF 245

Query: 246 TELRIRKNQS 255
            E+R RK++ 
Sbjct: 246 AEIRARKDRF 255


>gi|28143946|gb|AAO26580.1| glyoxalase II [Brassica juncea]
          Length = 335

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 80  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 139

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 140 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 199

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 200 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 259

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA- 239
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +  
Sbjct: 260 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPDHF 319

Query: 240 SNLAVFTELRIRKNQS 255
            +  V   +R  K+  
Sbjct: 320 DDARVLEVVRRAKDNF 335


>gi|21070362|gb|AAM34273.1|AF508863_1 glyoxalase II [Pennisetum glaucum]
          Length = 336

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 201 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA- 239
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +  
Sbjct: 261 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPDHF 320

Query: 240 SNLAVFTELRIRKNQS 255
            +  V   +R  K+  
Sbjct: 321 DDARVLEVVRRAKDNF 336


>gi|115480159|ref|NP_001063673.1| Os09g0516600 [Oryza sativa Japonica Group]
 gi|16209608|gb|AAL14249.1| glyoxalase II [Oryza sativa]
 gi|50726249|dbj|BAD33825.1| glyoxalase II [Oryza sativa Japonica Group]
 gi|113631906|dbj|BAF25587.1| Os09g0516600 [Oryza sativa Japonica Group]
 gi|215697948|dbj|BAG92136.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215737215|dbj|BAG96144.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218202459|gb|EEC84886.1| hypothetical protein OsI_32046 [Oryza sativa Indica Group]
          Length = 336

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLQDNYAYILHDVDTGTVGVVDPSEATPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  LS+GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSAKDRDRIPGIDITLSEGDTWMFAGHQVLVMETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF     +  GDTLFSL CG++FE +  +M+ SL+KI +  D+T +Y GHEYT +N+ F
Sbjct: 201 YHFPGSGAIFTGDTLFSLSCGKLFEGTPQQMYSSLQKIIALPDETRVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA- 239
           ALS +P N +LQ+Y +    +R +N  T P+TI  EK+ NPFLR  +  ++  L++ +  
Sbjct: 261 ALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGREKQCNPFLRTSSPEIKNTLSIPDHF 320

Query: 240 SNLAVFTELRIRKNQS 255
            +  V   +R  K+  
Sbjct: 321 DDARVLEVVRRAKDNF 336


>gi|152981854|ref|YP_001352899.1| hydroxyacylglutathione hydrolase [Janthinobacterium sp. Marseille]
 gi|151281931|gb|ABR90341.1| hydroxyacylglutathione hydrolase [Janthinobacterium sp. Marseille]
          Length = 258

 Score =  213 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 124/260 (47%), Gaps = 7/260 (2%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L++  +  ++DN+  +IH+      A +D  D   I   L      L  I  THHH 
Sbjct: 1   MRMLSVLTVPAFNDNYLWIIHDGV--HAAVVDPGDAKPILAALEAHKLSLVAILLTHHHS 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      L + F   +F P ++            D  T       + ++  PGHT+GHI
Sbjct: 59  DHVGGVSTLLQHFKVPVFAPRKDPIANVTQPLDEGDVVTIPELGLELSVLHVPGHTLGHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y      +L  GDTLF+ GCGR+FE +  +M  SL+K+ +  D T +Y  HEYT +N  
Sbjct: 119 AYVAKEQGWLFCGDTLFAGGCGRLFEGTPTQMLASLDKLAALPDDTKVYCAHEYTISNLR 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FAL+ +P N  L       ++ R QN+ T PS I LEK  NPFLR    ++ K +     
Sbjct: 179 FALAAEPANTALASRFEAEQAKRKQNIPTVPSNIGLEKSTNPFLRAREPAIAKQMVAEGR 238

Query: 236 MENASNLAVFTELRIRKNQS 255
            +NA  + VF  LR  KN  
Sbjct: 239 AKNADPVTVFAALREWKNNF 258


>gi|146278242|ref|YP_001168401.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17025]
 gi|160395513|sp|A4WUN2|GLO2_RHOS5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145556483|gb|ABP71096.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 255

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 133/255 (52%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+H+     TA +D P+   +   L E+ W LT I  THHH D
Sbjct: 1   MPLELVTVPCLSDNYAFLVHDAASGETAVVDVPEAGPVMAALAERNWRLTQILLTHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++     + G   ++ ++P +D  L++GD    GS    ++  PGHT+GHI 
Sbjct: 61  HVAGVAALREATGARVAGAAADAHRLPPLDLALAEGDRVRIGSEDGTVLEVPGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF +      GD+L ++GCGR+FE +   M++SL K+ +    T I  GHEYT+ NA F
Sbjct: 121 FHFADSGLAFTGDSLMAMGCGRLFEGTPRMMWQSLRKLSALPADTLICSGHEYTQANARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + +P N  L      + + R +   T PS +S E   NPFLR    +L+  + M +A 
Sbjct: 181 ACTLEPENPVLIFRVGSIAAARKEGRPTVPSQLSDEIATNPFLRAGEAALKAAVGMADAE 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 241 DAEVFAEIRRRKDNF 255


>gi|83594600|ref|YP_428352.1| hydroxyacylglutathione hydrolase [Rhodospirillum rubrum ATCC 11170]
 gi|123525672|sp|Q2RP80|GLO2_RHORT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|83577514|gb|ABC24065.1| Hydroxyacylglutathione hydrolase [Rhodospirillum rubrum ATCC 11170]
          Length = 256

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 141/256 (55%), Gaps = 1/256 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M++L+I  I++  DN+  L+        A ID      +       GW +THI NTHHH 
Sbjct: 1   MSTLDIHQIAVLSDNYIYLVRCRATGACAVIDPSLAEPVLAAAESLGWTITHILNTHHHY 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  +K    C I G   ++ ++PGID  + +GD    G    ++I TPGHT+GHI
Sbjct: 61  DHTGGNEEIKAATGCEIIGFAGDAHRLPGIDRTVVEGDRVAIGQAEARVIETPGHTLGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F     L  GDTLFS GCGR+FE S  +M++SL K+++   +T ++ GHEYT+ N  
Sbjct: 121 AYWFAESSALFCGDTLFSAGCGRLFEGSAGQMWDSLRKLRALPAQTLVFCGHEYTQPNIT 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L+    +V ++R+    T P+ +  E + NPFLR ++   ++   M  A
Sbjct: 181 FALTIDPRNEALRARALEVDALRAAGRPTVPAFLGDEARSNPFLRADSADFQEAFGMTGA 240

Query: 240 SNLAVFTELRIRKNQS 255
             + VF   R++K+  
Sbjct: 241 DPVEVFARTRLKKDHF 256


>gi|30679573|ref|NP_849599.1| GLX2-4 (glyoxalase 2-4); hydrolase/ hydroxyacylglutathione
           hydrolase/ zinc ion binding [Arabidopsis thaliana]
 gi|20466237|gb|AAM20436.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|22136310|gb|AAM91233.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|332189822|gb|AEE27943.1| putative hydroxyacylglutathione hydrolase 2, chloroplast
           [Arabidopsis thaliana]
          Length = 330

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++    LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI 
Sbjct: 133 HTGGNLELKDRYGAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHIS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 193 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L + E A
Sbjct: 253 ALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETA 312

Query: 240 SNLAVFTELRIRKNQSK 256
                   +R  K+  K
Sbjct: 313 DEAEALGIIRRAKDNFK 329


>gi|18390616|ref|NP_563760.1| GLX2-4 (glyoxalase 2-4); hydrolase/ hydroxyacylglutathione
           hydrolase/ zinc ion binding [Arabidopsis thaliana]
 gi|75246000|sp|Q8LDW8|GLO2D_ARATH RecName: Full=Probable hydroxyacylglutathione hydrolase 2,
           chloroplast; AltName: Full=Glyoxalase 2-4; AltName:
           Full=Glyoxalase II; Short=Glx II; Flags: Precursor
 gi|21553879|gb|AAM62972.1| glyoxalase II isozyme, putative [Arabidopsis thaliana]
 gi|110742461|dbj|BAE99149.1| glyoxalase II isozyme like protein [Arabidopsis thaliana]
 gi|332189821|gb|AEE27942.1| putative hydroxyacylglutathione hydrolase 2, chloroplast
           [Arabidopsis thaliana]
          Length = 331

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++    LT+I NTHHH D
Sbjct: 74  SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYD 133

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI 
Sbjct: 134 HTGGNLELKDRYGAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHIS 193

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 194 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 253

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L + E A
Sbjct: 254 ALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETA 313

Query: 240 SNLAVFTELRIRKNQSK 256
                   +R  K+  K
Sbjct: 314 DEAEALGIIRRAKDNFK 330


>gi|8810475|gb|AAF80136.1|AC024174_18 Contains similarity to glyoxalase II isozyme from Arabidopsis
           thaliana gb|U90927 and is a member of the
           Metallo-beta-lactamase seperfamily PF|00753. ESTs
           gb|AV519053, gb|AV535897, gb|AV535667, gb|AV556046,
           gb|BE039169, gb|AV525509 come from this gene
          Length = 512

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++    LT+I NTHHH D
Sbjct: 255 SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRNLTYILNTHHHYD 314

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L D D + F  H + I+ TPGHT GHI 
Sbjct: 315 HTGGNLELKDRYGAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVHIMETPGHTRGHIS 374

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 375 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 434

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR ENT +R+ L + E A
Sbjct: 435 ALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTENTDIRRALGIPETA 494

Query: 240 SNLAVFTELRIRKNQSK 256
                   +R  K+  K
Sbjct: 495 DEAEALGIIRRAKDNFK 511


>gi|254474804|ref|ZP_05088190.1| hydroxyacylglutathione hydrolase [Ruegeria sp. R11]
 gi|214029047|gb|EEB69882.1| hydroxyacylglutathione hydrolase [Ruegeria sp. R11]
          Length = 257

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 90/255 (35%), Positives = 145/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    I +    DN+  L+HN     TA +DAP+   I   L ++GW L  I  THHH D
Sbjct: 3   MPLEIITLPCLSDNYAFLLHNDDTGQTALVDAPEEAAIKAELDKRGWGLDLILLTHHHWD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+  F   + G   ++ ++P +D  +S+GD FD     ++++   GHT+GHI 
Sbjct: 63  HVDGVDALRAAFGAKVVGASADAHRLPDLDLSVSEGDRFDCLGAEVEVLDVSGHTVGHIA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H  ++  +   D+L +LGCGR+FE +  +M+ SL+K+K+   +T +Y GHEYT++NA F
Sbjct: 123 FHLPSEKAVFTADSLMALGCGRLFEGTPEQMWASLQKLKALPSETTVYSGHEYTQSNARF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A++ +P N  L+   + + + R++   T PST+  EK  NPFLR +   ++  L M +A 
Sbjct: 183 AITIEPDNKALRLRANAIDNARAEGRPTVPSTLQEEKDTNPFLRADLAEVKNALGMAHAQ 242

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 243 DAEVFAEIRSRKDNF 257


>gi|114570931|ref|YP_757611.1| hydroxyacylglutathione hydrolase [Maricaulis maris MCS10]
 gi|122315366|sp|Q0AM20|GLO2_MARMM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114341393|gb|ABI66673.1| Hydroxyacylglutathione hydrolase [Maricaulis maris MCS10]
          Length = 256

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 111/256 (43%), Positives = 150/256 (58%), Gaps = 1/256 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+ L I       DN+  LIH+     TA ID PD  +I     + GW +T I+NTHHH 
Sbjct: 1   MSELLIRQFPCLSDNYGFLIHDPDSGETATIDTPDADVILNEADQAGWSITQIWNTHHHF 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  ++      +  P  +  +IPGI   + DGD    G H  K+  TPGHT+GH+
Sbjct: 61  DHAGGNETIQALTGAKVVAPRYDRHRIPGISMEVEDGDVISLGDHKAKVFYTPGHTMGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYH   D    VGDTLF+LGCGR+FE + AEM+ SL ++ +  D+T IY  HEYTE NA 
Sbjct: 121 CYHMPMDGIAFVGDTLFALGCGRLFEGTPAEMWHSLSRLAALPDETRIYCAHEYTEANAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS DP N +LQ Y + V+  R++   T P+TI+ EK  NPFLR ++ ++R  L ME+ 
Sbjct: 181 FALSIDPDNHDLQVYAAMVEGERARGEPTVPTTIAAEKAANPFLRPDDPAIRARLGMEHD 240

Query: 240 SNLAVFTELRIRKNQS 255
            +  VF E+R RK+  
Sbjct: 241 DDEEVFAEIRRRKDSF 256


>gi|302835830|ref|XP_002949476.1| hypothetical protein VOLCADRAFT_74188 [Volvox carteri f.
           nagariensis]
 gi|300265303|gb|EFJ49495.1| hypothetical protein VOLCADRAFT_74188 [Volvox carteri f.
           nagariensis]
          Length = 336

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 97/252 (38%), Positives = 141/252 (55%), Gaps = 2/252 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+       TA +D  + + +   L  +GW L  I NTHHH DH  AN
Sbjct: 85  VRVPCLSDNYVWLLREPTSGRTAVVDPAELHPVVSELERRGWVLDAILNTHHHWDHVGAN 144

Query: 66  -LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
               ++F +C I GP  +  +IPGI+  + +GD++  GS  +++  TPGHT GHI Y   
Sbjct: 145 LDLKRRFPSCDIVGPRADKDRIPGIEVQVGEGDSWHLGSLEVRVFDTPGHTRGHITYWVP 204

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLF+LGCGR+FE S  +M+ SL K+ +  D T +Y  HEYT  NA FA++ 
Sbjct: 205 QAGALFPGDTLFALGCGRLFEGSPRQMWSSLSKLLALPDHTRVYCAHEYTAANARFAMTV 264

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLA 243
           DP N +L     +V + R++   T PST+  EK  NPFLR    S+RKN+ +   A +  
Sbjct: 265 DPDNPQLADRKMRVDAARAKGEATVPSTLGEEKATNPFLRPGAPSVRKNMGLGPAAEDWE 324

Query: 244 VFTELRIRKNQS 255
           VF  +R  K++ 
Sbjct: 325 VFAAVRAAKDRF 336


>gi|219363327|ref|NP_001136491.1| hypothetical protein LOC100216606 [Zea mays]
 gi|194695910|gb|ACF82039.1| unknown [Zea mays]
          Length = 311

 Score =  211 bits (538), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 98/256 (38%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 56  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 115

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 116 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 175

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 176 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 235

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +  
Sbjct: 236 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPDHF 295

Query: 241 NLA-VFTELRIRKNQS 255
           +   V   +R  K+  
Sbjct: 296 DEDRVLGVVRRAKDNF 311


>gi|89053533|ref|YP_508984.1| hydroxyacylglutathione hydrolase [Jannaschia sp. CCS1]
 gi|122499324|sp|Q28TK3|GLO2_JANSC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|88863082|gb|ABD53959.1| Hydroxyacylglutathione hydrolase [Jannaschia sp. CCS1]
          Length = 256

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 92/250 (36%), Positives = 138/250 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+H+     TA ID PD   I   L  +GW LT I  THHH DH    
Sbjct: 7   ITIPCLQDNYAFLLHDPSTGATACIDVPDAAPIQAALGAQGWTLTDILLTHHHWDHIDGV 66

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L +     ++G   ++ ++P +DH L++GDT   G+    ++   GHT+GH+ +HF  
Sbjct: 67  PALVEATGAKVWGAAADAHRLPPLDHALAEGDTIRIGALEGDVMDVSGHTVGHVAFHFPA 126

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M  SLEK+K     T +  GHEYT +NA FAL+ +
Sbjct: 127 ATAVFTADSLMALGCGRLFEGTPAQMHGSLEKLKMLPPGTLVCSGHEYTASNARFALTIE 186

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     ++ + R+    T PST++ E   NPFLR +  ++   L+ME A  + VF
Sbjct: 187 PDNPDLIFRVERITAARAAGQPTVPSTLAEELATNPFLRADAPTVAAPLDMEGADPVDVF 246

Query: 246 TELRIRKNQS 255
           T +R +K+  
Sbjct: 247 TRIRAQKDSF 256


>gi|194696414|gb|ACF82291.1| unknown [Zea mays]
          Length = 337

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 82  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 141

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 142 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 201

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE S  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 202 YYFAGSGAIFTGDTLFNLSCGKLFEGSPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 261

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +  
Sbjct: 262 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPDHF 321

Query: 241 NLA-VFTELRIRKNQS 255
           +   V   +R  K+  
Sbjct: 322 DEDRVLGVVRRAKDNF 337


>gi|53802509|ref|YP_112875.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
 gi|81682989|sp|Q60BX0|GLO2_METCA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|53756270|gb|AAU90561.1| metallo-beta-lactamase family protein [Methylococcus capsulatus
           str. Bath]
          Length = 256

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 149/256 (58%), Gaps = 1/256 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + I +  DN+  L+H      TAA+D      + + L  +GW L H+ NTHHH D
Sbjct: 1   MLEI-LQIPVLEDNYVYLLHEPGSGATAAVDPAVAGPVLEALDARGWRLGHVLNTHHHGD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   NL LK    CT+ G   +  +IPGID  L DG+ F  GS   +++  PGHT GH+ 
Sbjct: 60  HVGGNLELKAATGCTVVGAAGDRHRIPGIDVALKDGEEFRLGSASARMLDVPGHTSGHVA 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           + F +D  L  GDTLF+LGCGR+FE S  +M+ SLE++++   +T ++  HEYT+ NA F
Sbjct: 120 FWFEDDAALFCGDTLFALGCGRLFEGSAEQMWRSLERLRALPAETKVFCAHEYTQANARF 179

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A++ +P N  L++   +V+++R +   T PS +S E   NPFLR E+  +R  L +    
Sbjct: 180 AVTIEPGNAALRERVERVEALRREGAATVPSILSEELATNPFLRPESPEIRARLGLPGVP 239

Query: 241 NLAVFTELRIRKNQSK 256
            + VF E+R RK+  +
Sbjct: 240 EVEVFAEIRRRKDVFR 255


>gi|86136458|ref|ZP_01055037.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp. MED193]
 gi|85827332|gb|EAQ47528.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp. MED193]
          Length = 255

 Score =  211 bits (537), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 87/255 (34%), Positives = 140/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    I +    DN+  L+H+ K   TA +DAP+   +   L  +GW L  I  THHH D
Sbjct: 1   MPLEIITLPCLSDNYAYLLHDAKSGQTALVDAPEAAAVKSALSARGWGLDAILLTHHHYD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +   ++G   ++ ++P +DH L  G  F+     ++++   GHT+GHI 
Sbjct: 61  HIDGVDALRRDYGAKVYGAKPDAHRLPPLDHALDYGVRFELFGEEVQVLDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       +   D+L +LGCGR+FE +   M++SL ++ +   +T +Y GHEYT++NA F
Sbjct: 121 FFLPESQAVFTADSLMALGCGRLFEGTPDMMWQSLNRLMALPPETMVYSGHEYTQSNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N +LQ    ++ + R++   T PS + LE   NPFLR     ++  L ME+A 
Sbjct: 181 ALTIEPDNAKLQLRVDEINAKRAKGEATVPSRLQLELDTNPFLRAHLDEMKSTLGMESAE 240

Query: 241 NLAVFTELRIRKNQS 255
           N  VF E+R RK+  
Sbjct: 241 NAEVFAEIRQRKDNF 255


>gi|148554902|ref|YP_001262484.1| hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
 gi|148500092|gb|ABQ68346.1| Hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
          Length = 278

 Score =  211 bits (537), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 142/257 (55%), Gaps = 1/257 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I       DN+  L+H     +TAAID PD   I   L ++GW LTHI NTH H 
Sbjct: 21  MPGLEIHQFPCLDDNYAYLVHVEGSDVTAAIDTPDADAIIAELDKRGWTLTHILNTHWHP 80

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  LK+ +   +  P +   +I  ID  + D D  D G   +K++  PGHT  H+
Sbjct: 81  DHAGGNAALKQRYGALVIAPADPEGRIADIDRTVRDSDRLDLGGAEVKVLGVPGHTTDHV 140

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + F       VGDTLF+LGCGR+FE +  +M+ESL K+ +    T +Y  HEYT +NA 
Sbjct: 141 AFWFPETGAAFVGDTLFALGCGRLFEGTPEQMWESLGKLTALPADTMVYCAHEYTASNAR 200

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA++ +P N EL +    ++ +R  +  T P+TI LE + NPFLR  +  +R  L M   
Sbjct: 201 FAVTIEPGNAELVERVDHIRRLREADTPTVPTTIGLELRTNPFLRTRSAEIRDRLEMPED 260

Query: 240 SNLAVFTELRIRKNQSK 256
            ++AVF E+R RK+  K
Sbjct: 261 EDVAVFAEVRARKDSFK 277


>gi|316932079|ref|YP_004107061.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris DX-1]
 gi|315599793|gb|ADU42328.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris DX-1]
          Length = 255

 Score =  211 bits (537), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 97/248 (39%), Positives = 141/248 (56%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH     
Sbjct: 7   IVPCLTDNFGYLVHDPSTGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGIA 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LK  ++C +  P + ++KI   D  + +GD    GS   +++ TPGHT+ H+ Y F +D
Sbjct: 67  ELKNKYHCRVHAPHDANAKIADADVRVEEGDVVRIGSLTARVLETPGHTLDHVSYVFDDD 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L   DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P
Sbjct: 127 RALFAADTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFRLYCGHEYTASNVKFALGIEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N +LQ    +V+++R+    T P T+  EKK N FLR +  S+   + +  A    VF 
Sbjct: 187 GNADLQARAKQVEALRADGKPTIPVTLGEEKKANVFLRADVPSVADAVGLSGAPAAEVFG 246

Query: 247 ELRIRKNQ 254
           E+R RKN 
Sbjct: 247 EIRERKNN 254


>gi|297822879|ref|XP_002879322.1| glyoxalase 2-5 [Arabidopsis lyrata subsp. lyrata]
 gi|297325161|gb|EFH55581.1| glyoxalase 2-5 [Arabidopsis lyrata subsp. lyrata]
          Length = 324

 Score =  211 bits (537), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 144/256 (56%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L+  G  LT+I NTHHH D
Sbjct: 69  SSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPVIDSLKRSGRNLTYILNTHHHYD 128

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI 
Sbjct: 129 HTGGNLELKDRYGAKVIGSAMDKDRIPGIDIALKDGDKWMFAGHEVHVMDTPGHTKGHIS 188

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            +F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ F
Sbjct: 189 LYFPGSRAIFTGDTLFSLSCGKLFEGTPKQMLASLQKIISLPDDTSIYCGHEYTLSNSKF 248

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L + E A
Sbjct: 249 ALSLEPNNEILQSYAAHVAELRSKKLPTIPTTLKMEKACNPFLRSSNTDIRRALRIPETA 308

Query: 240 SNLAVFTELRIRKNQS 255
                   +R  K+  
Sbjct: 309 DEAEALGIIRKAKDDF 324


>gi|85704173|ref|ZP_01035276.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Roseovarius sp. 217]
 gi|85671493|gb|EAQ26351.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Roseovarius sp. 217]
          Length = 278

 Score =  211 bits (536), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 91/255 (35%), Positives = 139/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L H+    +TAAID P+   I + L +KGW L+ +  THHH D
Sbjct: 24  MVLQILTVPCLADNYAYLAHDPATGVTAAIDVPEAAPILQALDKKGWKLSLVLLTHHHAD 83

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L       + G   ++ ++P +D  +SDGD    GS    ++   GHT+GH+ 
Sbjct: 84  HVQGLGELLARHPAQVIGAAADAHRLPPLDRAVSDGDQIGIGSETGVVMDVSGHTVGHLA 143

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF     +   D+L ++GCGR+FE + A+MFESL KI S   +T I  GHEYTE+NA F
Sbjct: 144 FHFPQSAVVFTADSLMAMGCGRVFEGTMAQMFESLGKISSLPPRTTICSGHEYTESNAKF 203

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + DP N  L     ++ + R+    T PS ++ E   NPFLR  +  ++  L M  ++
Sbjct: 204 ARTVDPDNAALISRSIEISAARAAGRPTVPSILADELATNPFLRAGDAGIQAQLGMTGSA 263

Query: 241 NLAVFTELRIRKNQS 255
            + VF E+R RK++ 
Sbjct: 264 PVDVFAEIRARKDRF 278


>gi|269101976|ref|ZP_06154673.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161874|gb|EEZ40370.1| hydroxyacylglutathione hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 252

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 135/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  + DN+  L+ + + +    ID  D   + + + ++   L  I  THHH D
Sbjct: 1   MLTVQ-SIPAFKDNYIWLLQSPE-KHCIVIDPGDAKPVIEAIEKQQLTLDAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ +        +    IPG+   + DGD  D       ++A PGHT GH+ 
Sbjct: 59  HCGGISELKRRYPSINVVGPQN-DPIPGLTQSVEDGDQVDIFGERFMVLAVPGHTHGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS GCGRIFE +  EM+ SL+KI +  D+T IY  HEYT  N  F
Sbjct: 118 YVG--DEKLFCGDTLFSAGCGRIFEGTPEEMYASLQKIAALPDETEIYCAHEYTAGNIAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL  +  N  LQ+Y  +V  +R+    T PST+  EK VNPFLR +  S++K +     +
Sbjct: 176 ALVAEQDNPHLQRYREEVNRLRANGESTLPSTLGKEKLVNPFLRCDQPSIKKAVADKATD 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +S+LA FT LR  K+  
Sbjct: 236 SSDLATFTALRSWKDDF 252


>gi|84683662|ref|ZP_01011565.1| hydroxyacylglutathione hydrolase, putative [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668405|gb|EAQ14872.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2654]
          Length = 255

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 139/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   I I    DN+  L+H+     TA  DAP+T  I   L  +GW LT +F THHH D
Sbjct: 1   MTLELITIPCRSDNYAFLVHDAATGETALFDAPETAPIKAELDARGWTLTDLFITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L+  + C + G   ++ ++P +D  +  GD   F  H +++ A  GHTIGHI 
Sbjct: 61  HIEGVDDLRAAYGCRVVGGKHDAGRLPALDKAVEPGDVLSFAGHEVQVFAADGHTIGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++  +      GD+L +LGCGR+FE +  +M+ +L ++ +  D T I  GHEYT  NA F
Sbjct: 121 FYMPDAKAAFTGDSLMALGCGRLFEGTPEQMWGTLSRLMALPDDTLICSGHEYTAANARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N +L     +   +R    +T PS +SLEK  NPFLR     ++K ++ME+  
Sbjct: 181 ALSVEPQNADLIHRAEQTTKLRENGEFTVPSLLSLEKATNPFLRAGLPEMKKAVDMEHDG 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF  +R  K+  
Sbjct: 241 DAEVFAAIRRAKDNF 255


>gi|242049842|ref|XP_002462665.1| hypothetical protein SORBIDRAFT_02g029900 [Sorghum bicolor]
 gi|241926042|gb|EER99186.1| hypothetical protein SORBIDRAFT_02g029900 [Sorghum bicolor]
          Length = 336

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 97/256 (37%), Positives = 149/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 81  SSLQIELVPCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 140

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 141 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTSGHVC 200

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +N+ F
Sbjct: 201 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYSSLQKITALPDDTKVYCGHEYTLSNSKF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  ++  L++ +  
Sbjct: 261 ALSVEPGNKALQEYAANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKSTLSIPDHF 320

Query: 241 NLA-VFTELRIRKNQS 255
           +   V   +R  K+  
Sbjct: 321 DEDRVLEVVRRAKDNF 336


>gi|330445179|ref|ZP_08308831.1| hydroxyacylglutathione hydrolase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489370|dbj|GAA03328.1| hydroxyacylglutathione hydrolase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 252

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 138/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LI N +      +D  D   + + L +    L  I  THHH D
Sbjct: 1   MLTVK-SIPAFNDNYIWLIQNKE-NHCVVVDPGDATPVFEALEKNNLTLDAILITHHHSD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ F             IPGI   + DGD  D       +++ PGHT+GH+ 
Sbjct: 59  HIGGISELKRRFPTIKVVGPAS-EPIPGITQPVEDGDQVDIFGERFMVMSVPGHTLGHVV 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS GCGR+FE + A+MF+SL+KI +  D+T ++  HEYT +N  F
Sbjct: 118 YVG--DEKLFCGDTLFSAGCGRLFEGTPAQMFDSLQKIAALPDETEVFCAHEYTASNLSF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQKY   V  +R+    T PST+SLEK +NPFLR +  S+++++  +  +
Sbjct: 176 ALVAEQDNPHLQKYRDNVIRLRANGESTLPSTLSLEKLINPFLRCDQPSIKRSVADKAYD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K++ 
Sbjct: 236 DSDLETFAALRRWKDKF 252


>gi|254282523|ref|ZP_04957491.1| hydroxyacylglutathione hydrolase [gamma proteobacterium NOR51-B]
 gi|219678726|gb|EED35075.1| hydroxyacylglutathione hydrolase [gamma proteobacterium NOR51-B]
          Length = 257

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 85/260 (32%), Positives = 130/260 (50%), Gaps = 8/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+     I  + DN+  L+ + ++R    +D  D   +  +L E+G  L  I  THHH D
Sbjct: 1   MSVSISPIPAFQDNYIWLLEDTQHR-AVVVDPGDAEPVQAVLAERGLDLHAILITHHHPD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H    L LK    C ++GP     +I GIDH L DGD  D      +++   GHT+ HI 
Sbjct: 60  HVGGVLTLKTATGCKVYGPRN--PEIEGIDHPLKDGDQIDVLGESFEVLEVGGHTLDHIA 117

Query: 121 YHFMN-DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           Y     +  L  GDTLF  GCGR+FE +   M++SL ++ +   +T +Y  HEYT  N  
Sbjct: 118 YLSHTSEPALFCGDTLFVAGCGRMFEGTPPLMYQSLARLAALPPQTAVYCAHEYTLANLA 177

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN- 238
           FA + +P N  +      ++++R+    T PS+I+ E K NPFLR    ++ + L  E+ 
Sbjct: 178 FARAAEPGNSAITARIEDLETVRAAGEPTVPSSIAWELKTNPFLRCGEPTIVEQLQREDR 237

Query: 239 ---ASNLAVFTELRIRKNQS 255
               +   +F  LR  K+  
Sbjct: 238 LTGDAPHEIFAALRRWKDNF 257


>gi|56698000|ref|YP_168371.1| hydroxyacylglutathione hydrolase, putative [Ruegeria pomeroyi
           DSS-3]
 gi|81349102|sp|Q5LNN5|GLO2_SILPO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|56679737|gb|AAV96403.1| hydroxyacylglutathione hydrolase, putative [Ruegeria pomeroyi
           DSS-3]
          Length = 255

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 143/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  LIH+     TA +DAP+   I   L  +GW L  ++ THHH D
Sbjct: 1   MPLEIVTVPCLSDNYAYLIHDADAGKTALVDAPEAAPIQSELDRRGWSLDQVWLTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+  +  T+ G   ++ ++P +D  +S+GD FD G  P++++   GHT+GHI 
Sbjct: 61  HVDGLAALRDRYKPTVIGAEADAHRLPPLDLAVSEGDRFDLGGAPVEVLDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H      +   D+L +LGCGR+FE +  +M+ SL K+ +  D T +  GHEYT++NA F
Sbjct: 121 FHLPTGKAVFTADSLMALGCGRLFEGTPDQMWASLSKLAALPDDTLVCSGHEYTQSNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP N  L+   +++   R++   T PS +SLEK  NPFLR  +  ++  L M+ A 
Sbjct: 181 ALSVDPDNAALKTRAAEIDQARAEGRPTVPSLLSLEKSTNPFLRAADPGIQSLLGMQGAD 240

Query: 241 NLAVFTELRIRKNQS 255
              VF E+R RK+  
Sbjct: 241 PARVFAEIRARKDHF 255


>gi|30684920|ref|NP_850166.1| GLX2-5 (GLYOXALASE 2-5); hydroxyacylglutathione hydrolase/ iron ion
           binding / zinc ion binding [Arabidopsis thaliana]
 gi|330253437|gb|AEC08531.1| Hydroxyacylglutathione hydrolase 2 [Arabidopsis thaliana]
          Length = 323

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 144/256 (56%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH D
Sbjct: 68  SSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYD 127

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI 
Sbjct: 128 HTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHIS 187

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            +F     +  GDT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ F
Sbjct: 188 LYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKF 247

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L + E A
Sbjct: 248 ALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAA 307

Query: 240 SNLAVFTELRIRKNQS 255
                   +R  K+  
Sbjct: 308 DEAEALGIIRKAKDDF 323


>gi|15224661|ref|NP_180693.1| GLX2-5 (GLYOXALASE 2-5); hydroxyacylglutathione hydrolase/ iron ion
           binding / zinc ion binding [Arabidopsis thaliana]
 gi|73621009|sp|Q9SID3|GLO2N_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 2, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|4589965|gb|AAD26483.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|18176314|gb|AAL60021.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|20465675|gb|AAM20306.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|330253438|gb|AEC08532.1| Hydroxyacylglutathione hydrolase 2 [Arabidopsis thaliana]
          Length = 324

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 144/256 (56%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH D
Sbjct: 69  SSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYD 128

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI 
Sbjct: 129 HTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHIS 188

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            +F     +  GDT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ F
Sbjct: 189 LYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKF 248

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P+N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L + E A
Sbjct: 249 ALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAA 308

Query: 240 SNLAVFTELRIRKNQS 255
                   +R  K+  
Sbjct: 309 DEAEALGIIRKAKDDF 324


>gi|307105103|gb|EFN53354.1| hypothetical protein CHLNCDRAFT_56279 [Chlorella variabilis]
          Length = 272

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 147/259 (56%), Gaps = 6/259 (2%)

Query: 3   SLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
            L I  +    DN+  L+H  +  +TA +D  +   +   LR KGW LTHI NTHHH DH
Sbjct: 15  VLQIERVPCLSDNYSWLLHEPQQGVTA-VDPAEAAPVLAALRSKGWNLTHIINTHHHYDH 73

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
              N  L++ F CT+ GP  + ++IPGI   L DGD F FG+  +    TPGHT GH+ Y
Sbjct: 74  VGGNAELQREFGCTVVGPAADHARIPGIQVQLKDGDRFQFGAAEMVCYDTPGHTRGHVTY 133

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           HF     L  GDTLFSLGCGR+FE + A+M+ SL K+      T +Y  HEYT +NA FA
Sbjct: 134 HFPAAKALFPGDTLFSLGCGRLFEGTPAQMWASLSKLTPLPGDTLVYCAHEYTASNAKFA 193

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLR---IENTSLRKNLNMEN 238
              D  N +LQ+  + +++ R++   T PS +  E K NPFLR   +++ ++R  L +  
Sbjct: 194 AHVDEGNEDLQRMKADIEAKRARGEPTVPSQLGDELKCNPFLRPGTLDSPAIRSKLGVPE 253

Query: 239 ASNLAV-FTELRIRKNQSK 256
            ++  V F  +R  K+  +
Sbjct: 254 GASNDVAFGAIRAAKDTFR 272


>gi|192289044|ref|YP_001989649.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris TIE-1]
 gi|192282793|gb|ACE99173.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris TIE-1]
          Length = 255

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 98/248 (39%), Positives = 139/248 (56%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH     
Sbjct: 7   IVPCLTDNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWKLTDILVTHHHGDHVGGIA 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LKK + C +  P + ++KI   D  L +GD    G    +++ TPGHT+ H+ Y F  D
Sbjct: 67  ELKKKYQCRVHAPHDANAKIADADVRLQEGDVVRVGDLTARVLETPGHTLDHLSYVFDAD 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L   DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P
Sbjct: 127 RALFAADTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFKLYCGHEYTASNVKFALGIEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQ    +V+++R++   T P T+  EK+ N FLR +  S+   + M  A    VF 
Sbjct: 187 DNAALQARAKQVEALRAEGKPTIPVTLGEEKQANVFLRADVPSVAAAVGMPGAPAAEVFG 246

Query: 247 ELRIRKNQ 254
           E+R RKN 
Sbjct: 247 EIRERKNN 254


>gi|39933687|ref|NP_945963.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           CGA009]
 gi|81564127|sp|Q6NC62|GLO2_RHOPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|39647533|emb|CAE26054.1| putative glyoxalase II [Rhodopseudomonas palustris CGA009]
          Length = 255

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/248 (39%), Positives = 140/248 (56%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DNF  L+H+     TA+IDAP+   +   L ++GW LT I  THHH DH     
Sbjct: 7   IVPCLTDNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWKLTDILVTHHHGDHVGGIA 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LKK + C +  P + ++KI   D  L +GD    G    +++ TPGHT+ H+ Y F +D
Sbjct: 67  ELKKKYQCRVHAPHDANAKIADADVRLQEGDVVRVGDLTARVLETPGHTLDHLSYVFDDD 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L   DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL  +P
Sbjct: 127 RALFAADTLFSIGCGRVFEGTYPMMWESLLKLRALPDDFKLYCGHEYTASNVKFALGIEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQ    +V+S+R++   T P T+  EK+ N FLR +  S+   + M  A    VF 
Sbjct: 187 DNAALQARAKQVESLRAEGKPTIPVTLGEEKQANVFLRADVPSVAAAVGMPGAPAAEVFG 246

Query: 247 ELRIRKNQ 254
           E+R RKN 
Sbjct: 247 EIRERKNN 254


>gi|83952817|ref|ZP_00961547.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX
           II)protein [Roseovarius nubinhibens ISM]
 gi|83835952|gb|EAP75251.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX
           II)protein [Roseovarius nubinhibens ISM]
          Length = 255

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/255 (36%), Positives = 136/255 (53%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L H+     TA +D P+   I+ +L E+GW  + +  THHH D
Sbjct: 1   MALEIVTVPCLSDNYAYLAHDPGTGATAVVDVPEAAPITAVLAERGWQASLVILTHHHDD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L       + G   ++ ++P +D  L DG T D G     +    GHTIGHI 
Sbjct: 61  HVQGLPELLAEHQAKVAGNAADAHRLPPLDIALRDGGTVDIGGETGHVFDVSGHTIGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            HF         D+L +LGCGR+FE +  +M++SL K+ +   +T I  GHEYT  NA F
Sbjct: 121 LHFPQSAVAFTADSLMALGCGRVFEGTMDQMWQSLSKLAALPPETTICSGHEYTAANARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP N  L     ++ + RS N  T PST+S E   NPFLR  + +L+  L+M +AS
Sbjct: 181 ALSIDPANSALISRAERIATARSANQPTVPSTLSDELATNPFLRASDPALKSALDMGDAS 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DAEVFAEIRHRKDRF 255


>gi|297848880|ref|XP_002892321.1| hypothetical protein ARALYDRAFT_311691 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338163|gb|EFH68580.1| hypothetical protein ARALYDRAFT_311691 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 485

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  ++H+        +D  +   +   L++   +LT+I NTHHH D
Sbjct: 228 SSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSRYLTYILNTHHHYD 287

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI 
Sbjct: 288 HTGGNLELKDRYGAKVIGSAVDRDRIPGIDVALKDGDKWMFAGHEVHVMETPGHTRGHIS 347

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL++I +  D T +Y GHEYT +N+ F
Sbjct: 348 FYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSVYCGHEYTLSNSKF 407

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ Y + V  +R + L T P+T+ +EK  NPFLR  NT +R+ L +    
Sbjct: 408 ALSIEPTNEVLQSYAAYVAELREKKLPTIPTTMKMEKACNPFLRAGNTDIRRALGIPETE 467

Query: 241 N-LAVFTELRIRKNQSK 256
           +       +R  K+  K
Sbjct: 468 DEAEALGIIRRAKDNFK 484


>gi|302802971|ref|XP_002983239.1| hypothetical protein SELMODRAFT_268709 [Selaginella moellendorffii]
 gi|300148924|gb|EFJ15581.1| hypothetical protein SELMODRAFT_268709 [Selaginella moellendorffii]
          Length = 298

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 104/248 (41%), Positives = 149/248 (60%), Gaps = 3/248 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ +        +D      + + L  +G  LTHI NTHHH DHT  N +
Sbjct: 52  IPCLKDNYAYLLRDASSGAIGVVDPSTAQPVIEALERRGLKLTHIINTHHHWDHTGGNAD 111

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LKK +   I         IPGID  L DGDT+  G H +K+I TPGHT GH+ Y+F +  
Sbjct: 112 LKKRYGAQIV--APPGDGIPGIDVPLKDGDTWMLGEHAMKVIGTPGHTRGHVSYYFADSR 169

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFS+GCGR+FE S  +M+ SL K+ +  D+T ++ GHEYT +NA FA++ +P+
Sbjct: 170 AVFTGDTLFSIGCGRLFEGSAQQMWSSLSKLAALPDETRVFCGHEYTLSNAKFAMTIEPN 229

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFT 246
           N  L  +  KVK +R   L T PS++  EKK NPFLR  +  +R++LN+ ++AS+  VFT
Sbjct: 230 NPALNSHFEKVKQLRDSGLATIPSSVGEEKKFNPFLRPASREIRRSLNLSDDASDSDVFT 289

Query: 247 ELRIRKNQ 254
            +R  K++
Sbjct: 290 AVRKAKDR 297


>gi|307730499|ref|YP_003907723.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1003]
 gi|307585034|gb|ADN58432.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1003]
          Length = 263

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/265 (30%), Positives = 136/265 (51%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +   R    +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFEDNYIWVVSD--GRHAVVVDPGEAAPVRAYLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L       ++GP  E+ +         D       +    ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQAVPVYGPAGEAIEHVTQRLKNGDRVNIAEPALEFSVLDVPGHTSGHI 118

Query: 120 CYHFMND----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE + A+M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQAADLAGTPHVFCGDTLFACGCGRLFEGTPAQMLASLDSLAALPGATQVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----R 231
           +N  FAL+C+P N +LQ +  K   +R++N  T P+TI+ E+ VNPFLR  + ++    +
Sbjct: 179 SNIRFALACEPGNAQLQAWRDKASDLRARNQPTLPTTIAHERAVNPFLRAGDPAVQATLQ 238

Query: 232 KNLNMENASNLAVFTELRIRKNQSK 256
           + L+ + +  LA FT +R  KN+ +
Sbjct: 239 EALHEKVSDRLAAFTLMREWKNRFR 263


>gi|163732300|ref|ZP_02139746.1| hydroxyacylglutathione hydrolase, putative [Roseobacter litoralis
           Och 149]
 gi|161394598|gb|EDQ18921.1| hydroxyacylglutathione hydrolase, putative [Roseobacter litoralis
           Och 149]
          Length = 257

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 94/255 (36%), Positives = 147/255 (57%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    DN+  L+H+     TA ID P+   I K L ++ W L+ ++ THHH D
Sbjct: 3   MPLEILTIPCLSDNYAYLVHDDATGQTALIDVPEADAILKALADRQWHLSEVWITHHHAD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +   ++       + G  ++S ++P +D  L DG++FDF  H ++++   GHTIGHI 
Sbjct: 63  HVQGLADVLTAHPAKVRGAADDSHRLPALDFALGDGESFDFAGHEVEVMDVSGHTIGHIA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  +   +   D+L +LGCGR+FE +  +M++SL K+      T IY GHEYT  NA F
Sbjct: 123 YYCADAKAVFTADSLMALGCGRLFEGTADQMWKSLSKLAVLPPDTQIYSGHEYTAANARF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DPHN +L      + + R+    T PS+++ E   NPFLR  + ++R +LNM++AS
Sbjct: 183 ALTIDPHNSDLISRSQGIAASRTAGKPTVPSSLATEAATNPFLRAADPTIRAHLNMQHAS 242

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 243 DSEVFAEIRARKDAF 257


>gi|91974575|ref|YP_567234.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris BisB5]
 gi|123735877|sp|Q13F06|GLO2_RHOPS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91681031|gb|ABE37333.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris BisB5]
          Length = 255

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 100/248 (40%), Positives = 138/248 (55%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DNF  LIH+     TA+IDAP+   +   L ++GW LT I  THHH DH     
Sbjct: 7   IVPCLTDNFGYLIHDPSSGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGVA 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LKK + C +  P + ++KI  ID  + +GD    G    +++ TPGHT+ HI Y F +D
Sbjct: 67  ELKKKYQCRVVAPHDANAKIADIDLRVEEGDVVRVGGLSARVLETPGHTLDHISYVFDDD 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L   DTLFS+GCGR+FE +Y  M+ESL K++   D   +Y GHEYT +N  FAL+ +P
Sbjct: 127 RALFAADTLFSIGCGRVFEGTYPMMWESLLKLRELPDDFKLYCGHEYTASNVKFALTIEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQ    +V+  R+    T P T+  EK+ N FLR +  S+   + +   S   VF 
Sbjct: 187 DNAALQARAKQVEQQRAAGQPTIPVTLGEEKQANLFLRADVPSVAAAVGLPGESAADVFG 246

Query: 247 ELRIRKNQ 254
           ELR RKN 
Sbjct: 247 ELRERKNN 254


>gi|134095499|ref|YP_001100574.1| hydroxyacylglutathione hydrolase [Herminiimonas arsenicoxydans]
 gi|226724000|sp|A4G7G5|GLO2_HERAR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|133739402|emb|CAL62452.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II) (Glx II)
           GloB-like [Herminiimonas arsenicoxydans]
          Length = 259

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/262 (33%), Positives = 126/262 (48%), Gaps = 9/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+ + +  ++DN+  +IH+      A +D  D   I   L E    L  I  THHH D
Sbjct: 1   MLSV-LTVPAFNDNYLWIIHDGV--HAAVVDPGDATPILAALEEHQLSLVAILLTHHHAD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + FN  +F P ++            D          + ++A PGHT+GHI 
Sbjct: 58  HVGGVAKLLQHFNVPVFAPRKDPIANVSHPLDDGDTVHIPELDLHLSVLAVPGHTLGHIA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y      +L  GDTLF+ GCGR+FE +  +M  SLEK+ +  D T +Y  HEYT +N  F
Sbjct: 118 YVAAEQGWLFCGDTLFAGGCGRLFEGTPTQMLTSLEKLAALPDDTKVYCAHEYTISNLRF 177

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           AL+ +P N  L       ++ R  ++ T PSTI LEK  NPFLR    ++   L      
Sbjct: 178 ALAAEPDNAALAIRFKAEQAKREADIPTVPSTIGLEKSTNPFLRAREPAIADQLIAAGRV 237

Query: 235 NMENASNLAVFTELRIRKNQSK 256
           N  +   +AVF  LR  KN  +
Sbjct: 238 NENDKGPVAVFAALRAWKNDFR 259


>gi|126725795|ref|ZP_01741637.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2150]
 gi|126704999|gb|EBA04090.1| hydroxyacylglutathione hydrolase, putative [Rhodobacterales
           bacterium HTCC2150]
          Length = 255

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/255 (36%), Positives = 144/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   I +    DN+  +  + +  +TA +D P+   I   L  +GW L  I  THHH D
Sbjct: 1   MSLEIITVPCLSDNYAFIARDQETGVTALVDVPEAAPILAELDARGWGLDLILLTHHHDD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    +    N  + G   ++ ++P +D  L++GD+ + G+    ++   GHTIGHI 
Sbjct: 61  HIQGVPEVIAKTNAKVVGAKADAHRLPKLDMALNEGDSINIGASEGVVLDVSGHTIGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF     +   D+L +LGCGR+FE S+A+M+ESL K+      T +  GHEYT  N  F
Sbjct: 121 FHFAKAKTIFTADSLMALGCGRLFEGSFAQMWESLSKMAVLDPDTLVCSGHEYTAANGRF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A+S +P N +LQ    ++ S  ++++ T PS +SLE   NPFLR  +  +R NLNM++AS
Sbjct: 181 AMSVEPENTDLQTRVKEIASANAKDVPTVPSLLSLELATNPFLRPHSPEIRVNLNMQDAS 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 241 DADVFAEIRRRKDNF 255


>gi|195624204|gb|ACG33932.1| hydroxyacylglutathione hydrolase 2 [Zea mays]
          Length = 337

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 151/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +S   DN+  ++H+        +D  +   I   L ++   LT+I NTHHH D
Sbjct: 82  SSLQIELVSCLRDNYAYILHDVDTGTVGVVDPSEAMPIINALEKRNQNLTYILNTHHHYD 141

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  NL LK  +   + G  ++  +IPGID  L +GDT+ F  H + ++ TPGHT GH+C
Sbjct: 142 HTGGNLELKAKYGAKVIGSEKDKDRIPGIDITLKEGDTWMFAGHQVLVLETPGHTTGHVC 201

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+F     +  GDTLF+L CG++FE +  +M+ SL+KI +  D T +Y GHEYT +NA F
Sbjct: 202 YYFAGSGAIFTGDTLFNLSCGKLFEGTPQQMYASLQKITALPDDTKVYCGHEYTLSNAKF 261

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQ+Y +    +R++N+ T P+TI  EK+ NPFLR  N  +++ L++ +  
Sbjct: 262 ALSVEPGNKALQEYTANAAELRNKNIPTVPTTIGREKECNPFLRTSNPEIKRTLSVPDHF 321

Query: 241 NLA-VFTELRIRKNQS 255
           +   V   +R  K+  
Sbjct: 322 DEDRVLGVVRRAKDNF 337


>gi|332557736|ref|ZP_08412058.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides WS8N]
 gi|332275448|gb|EGJ20763.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides WS8N]
          Length = 255

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 136/255 (53%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+H+     T+ +D P+   I K L E+GW L+ I  THHH D
Sbjct: 1   MPLELVTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPILKALEERGWHLSQILLTHHHSD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI 
Sbjct: 61  HVAGVEELRAATGARVAGAAADAHRLPPLDLELAEGDPVQVGASEGRVIDVPGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF +      GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA F
Sbjct: 121 FHFPDSALAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + +P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A 
Sbjct: 181 AATLEPDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAE 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DAEVFAEIRRRKDKF 255


>gi|319781260|ref|YP_004140736.1| hydroxyacylglutathione hydrolase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167148|gb|ADV10686.1| hydroxyacylglutathione hydrolase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 255

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 109/246 (44%), Positives = 151/246 (61%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+ K   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK
Sbjct: 10  CRSDNFGVLVHDPKSGQTAIIDAPEEAPILAAIKRTGWTPTMILTTHHHMDHVEANLALK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F   I GP  E +KIPGID  + DG     G   I++IATPGHT GH+ Y+       
Sbjct: 70  ERFKLRIVGPEAEKAKIPGIDETVEDGSVLHLGDERIEVIATPGHTAGHVSYYLPASSVA 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE     M++SL+K+ +   +T IY GHEYT +NA FAL+ DP N 
Sbjct: 130 FTADTLFALGCGRLFECKPPVMYDSLKKLAALPAETAIYCGHEYTLSNARFALTVDPSNS 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++ +R++N  T P+TI  E   NPFLR  + ++RK+L +E AS+  VF E+R
Sbjct: 190 ALKERAARIEKLRAENKPTLPTTIGEELSTNPFLRWHDPAIRKHLGLEKASDAEVFAEIR 249

Query: 250 IRKNQS 255
            RK+  
Sbjct: 250 KRKDNF 255


>gi|298292701|ref|YP_003694640.1| hydroxyacylglutathione hydrolase [Starkeya novella DSM 506]
 gi|296929212|gb|ADH90021.1| hydroxyacylglutathione hydrolase [Starkeya novella DSM 506]
          Length = 257

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 102/249 (40%), Positives = 136/249 (54%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+ +L+ +     TA IDAP+   I   L  + W LTHI  THHH DH    L 
Sbjct: 8   IPCLADNYAVLLRDPVTEATAVIDAPEVAPILAALEREDWTLTHILVTHHHTDHIAGVLA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+ F  T+ GP  E   IPG+D  + DGD    G    +++ TPGHT GHI + F ++ 
Sbjct: 68  LKERFGATVIGPKAERDTIPGLDFAVVDGDPVAVGGLVGRVMETPGHTKGHIVFLFEDER 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF LGCGR FE     ++ESL +++   D   +Y GHEYT +N  FA+S DP 
Sbjct: 128 LLFSGDTLFVLGCGRPFECDPPVLWESLVRLRGLPDDISVYCGHEYTVSNGRFAVSVDPD 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L     + ++ R+    T P+TI  EK  NPFLR ++  L   + +  A   AVFTE
Sbjct: 188 NAALAARLKEAEAQRAAGEPTLPTTIGAEKVTNPFLRADDPELAARIGLAGAEPGAVFTE 247

Query: 248 LRIRKNQSK 256
           LR  KN  +
Sbjct: 248 LRSLKNSFR 256


>gi|149913690|ref|ZP_01902223.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           AzwK-3b]
 gi|149812810|gb|EDM72639.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           AzwK-3b]
          Length = 255

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 92/255 (36%), Positives = 136/255 (53%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M      I    DN+  L H+     TAAID PD   I  ML E  W L+H+  THHH D
Sbjct: 1   MALQIETIPCLSDNYAFLAHDPDTGQTAAIDVPDAAPILAMLEENDWTLSHVLLTHHHAD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L       + G   ++ ++P +D  ++DGD+   G+   ++I  PGHT+GHI 
Sbjct: 61  HVQGLEALLDAAPAKVVGAAADAHRLPPLDISVADGDSIIIGNLIAEVIEVPGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     L   D+L +LGCGR+FE +  +M++SL ++ +    T +Y GHEYT  NA F
Sbjct: 121 FYFPESAALFSADSLMALGCGRVFEGTMDQMYDSLSRLAALPSDTTVYSGHEYTRANAKF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  L    + + + R +   T PS +S E   NPFLR  +  ++ +L M  A 
Sbjct: 181 ALTIDPANAALTSRAAAIDAAREKGHPTVPSKLSEELATNPFLRASDPDIQAHLGMVGAD 240

Query: 241 NLAVFTELRIRKNQS 255
              VF E+R RK++ 
Sbjct: 241 PAKVFAEIRGRKDRF 255


>gi|77462845|ref|YP_352349.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Rhodobacter sphaeroides 2.4.1]
 gi|221638714|ref|YP_002524976.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides KD131]
 gi|123592439|sp|Q3J436|GLO2_RHOS4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|77387263|gb|ABA78448.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Rhodobacter sphaeroides 2.4.1]
 gi|221159495|gb|ACM00475.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides KD131]
          Length = 255

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 136/255 (53%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+H+     T+ +D P+   I K L E+GW L+ I  THHH D
Sbjct: 1   MPLELVTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPILKALEERGWHLSQILLTHHHSD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI 
Sbjct: 61  HVAGVEELRAATGARVAGAAADAHRLPPLDLELAEGDLVRVGASEGRVIEVPGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF +      GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA F
Sbjct: 121 FHFPDSSLAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + +P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A 
Sbjct: 181 AATLEPDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAE 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DAEVFAEIRRRKDKF 255


>gi|86747196|ref|YP_483692.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris HaA2]
 gi|123004823|sp|Q2J429|GLO2_RHOP2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|86570224|gb|ABD04781.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris HaA2]
          Length = 255

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 98/248 (39%), Positives = 136/248 (54%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DNF  LIH+     TA+IDAP+   +   L ++GW LT I  THHH DH     
Sbjct: 7   IVPCLTDNFGYLIHDPSSGATASIDAPEAAPLIAALEKEGWKLTDILVTHHHGDHVGGIA 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LK  ++C +  P + ++KI   D  + +GD    G    +++ TPGHT+ HI Y F +D
Sbjct: 67  ELKAKYHCRVVAPHDANAKIADADLRVEEGDVVKVGGLEARVLETPGHTLDHISYVFADD 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L   DTLFS+GCGR+FE +Y  M+ESL K+++  D   +Y GHEYT +N  FAL+ +P
Sbjct: 127 RALFAADTLFSIGCGRVFEGTYPMMWESLLKLRALPDDYKLYCGHEYTASNVKFALTIEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQ    +V+  R     T P T+  EK+ N FLR +  S+   +     S   VF 
Sbjct: 187 ENAALQARAKQVEQQRGAGRPTIPVTLGEEKQANVFLRADVPSVAAAIGFAGESAADVFG 246

Query: 247 ELRIRKNQ 254
           ELR RKN 
Sbjct: 247 ELRERKNN 254


>gi|126461738|ref|YP_001042852.1| hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17029]
 gi|160395512|sp|A3PIB4|GLO2_RHOS1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|126103402|gb|ABN76080.1| Hydroxyacylglutathione hydrolase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 255

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 136/255 (53%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+H+     T+ +D P+   + K L E+GW L+ I  THHH D
Sbjct: 1   MPLELVTVPCLSDNYAFLVHDAGTGETSVVDVPEAGPVLKALEERGWHLSQILLTHHHSD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      + G   ++ ++P +D  L++GD    G+   ++I  PGHT+GHI 
Sbjct: 61  HVAGVEELRAATGARVAGAAADAHRLPPLDLELAEGDLVRVGASEGRVIEVPGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF +      GD+L ++GCGR+FE +   M++SL K+ +   +T I  GHEY  +NA F
Sbjct: 121 FHFPDSSLAFTGDSLMAMGCGRLFEGTAEAMWQSLRKLSALPPETMICSGHEYAASNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + +P +  L      + + R +   T PS +S E   NPFLR    SL+  + M +A 
Sbjct: 181 AATLEPDSPMLIFRVGSIAAARKEGRPTVPSHLSDEIATNPFLRAGEASLKAAVGMVDAE 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK++ 
Sbjct: 241 DAEVFAEIRRRKDKF 255


>gi|110680699|ref|YP_683706.1| hydroxyacylglutathione hydrolase, putative [Roseobacter
           denitrificans OCh 114]
 gi|123172160|sp|Q162S3|GLO2_ROSDO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|109456815|gb|ABG33020.1| hydroxyacylglutathione hydrolase, putative [Roseobacter
           denitrificans OCh 114]
          Length = 255

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 93/255 (36%), Positives = 149/255 (58%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I   +DN+  L+H+     TA ID P+   I K+L E+ W L+ ++ THHH D
Sbjct: 1   MPIEILTIPCLNDNYAFLVHDTATGQTALIDVPEAAPILKVLAERTWQLSEVWITHHHAD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +   ++       + G   ++ ++P +D  L DG++FDF  H + ++   GHT+GHI 
Sbjct: 61  HVQGLGDILSAHPAQVRGAARDAHRLPALDVELRDGESFDFAGHKVDVMDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  +   +   D+L +LGCGR+FE +  +M++SL K+ +   +T +Y GHEYT  NA F
Sbjct: 121 YYCADAKAVFTADSLMALGCGRLFEGTADQMWDSLSKLAALPSETQVYSGHEYTAANARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DPHN +L      + + R+    T PST++ E   NPFLR  + ++R +LNM++AS
Sbjct: 181 ALTIDPHNPDLISRSEGITAARAAAKPTVPSTLATEAATNPFLRAADPAIRAHLNMQHAS 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 241 DSEVFAEIRARKDAF 255


>gi|241765316|ref|ZP_04763294.1| hydroxyacylglutathione hydrolase [Acidovorax delafieldii 2AN]
 gi|241364997|gb|EER59908.1| hydroxyacylglutathione hydrolase [Acidovorax delafieldii 2AN]
          Length = 257

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 88/258 (34%), Positives = 135/258 (52%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+   R    +D  D   +   L+ +G  L  I  THHH DH    
Sbjct: 4   LPLPAFTDNYIWMLHD--TRQAIVVDPGDAAPVLHALQAQGLQLQAILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     +FGP     ++P     L+DGDT +       ++  PGHT GHI Y+  +
Sbjct: 62  PTLREATGAHVFGPAG--EQMPEPLQRLADGDTVEVLGLRFSVLDVPGHTAGHIAYYCAD 119

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +    T +   HEYT +N  FA 
Sbjct: 120 LAGAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDRLAALPGSTRVCCTHEYTLSNLRFAR 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN- 241
           + +P N  L+ Y S  +S+R++   T PSTI+LE+++NPFLR+   ++R      +AS  
Sbjct: 180 AVEPGNQALRDYSSHCESLRARQEPTLPSTIALEREINPFLRVREATVRAAAQGFDASPP 239

Query: 242 ----LAVFTELRIRKNQS 255
               +AVF  LR  KN  
Sbjct: 240 QHDAVAVFAALRQWKNNF 257


>gi|46200874|ref|ZP_00056264.2| COG0491: Zn-dependent hydrolases, including glyoxylases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 257

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 106/257 (41%), Positives = 146/257 (56%), Gaps = 2/257 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  + +  I +  DN+  L H     +TAAID   +  + + L  +GW LTHI NTHHH 
Sbjct: 1   MAKIIVEQIPVLSDNYVYLAHEPLGGVTAAIDPAVSEPVLERLAARGWTLTHILNTHHHG 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT ANL+L +   C + G   +S +IPGI   +SDG+TF  G   + ++  PGHT GH+
Sbjct: 61  DHTGANLDLARRTGCAVVGAARDSGRIPGITLEVSDGETFMLGHAAVTVLDVPGHTSGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y F + H L  GDTLFSLGCGR+FE S  EM+ SL+K++     T  Y  HEYT  N  
Sbjct: 121 AYWFADSHVLFCGDTLFSLGCGRLFEGSAEEMWASLKKLRDLPSDTMAYPAHEYTAANGR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-N 238
           FA   +  N  L+    +V+ +R+ N  T P  ++ E+ VNPFLR +  S+ + + ME  
Sbjct: 181 FAKLVERDNQALKARLDEVERLRAGNRPTVPVRLAEERAVNPFLRADTASVARAVGMEPG 240

Query: 239 ASNLAVFTELRIRKNQS 255
           A    VF ELR RK+  
Sbjct: 241 ADPAQVFAELRRRKDVF 257


>gi|209966686|ref|YP_002299601.1| glyoxalase II, putative [Rhodospirillum centenum SW]
 gi|209960152|gb|ACJ00789.1| glyoxalase II, putative [Rhodospirillum centenum SW]
          Length = 257

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 154/256 (60%), Gaps = 1/256 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L+I  I    DN+  L+ + +    A +D  D + +   L   GW LTHI NTHHH 
Sbjct: 1   MAPLDIRLIPALADNYVYLLRDPETGAVAVVDPADPFPVEAELNRLGWRLTHILNTHHHA 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  LK+ F   + GP  + ++IP ID    +GD F  G+ P+++I  PGHT GHI
Sbjct: 61  DHTAGNGELKRLFRARVIGPAADRARIPEIDEAYGEGDRFLLGARPVEVIDVPGHTRGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            + F +   L  GD+LF+LGCGR+FE + A+M++SL K++   ++T +Y GHEYT +NA 
Sbjct: 121 AFWFSDAGALFSGDSLFALGCGRLFEGTPAQMWQSLLKLRRLPEETAVYCGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA++ DP N  L+   ++V+ +R+Q   T PS+I LE+  NPFLR ++ ++   + +  A
Sbjct: 181 FAVTVDPGNDALRARAAEVERLRTQGQPTLPSSIGLERATNPFLRADDPAVAAAVGLAGA 240

Query: 240 SNLAVFTELRIRKNQS 255
             + VF E+R RK+  
Sbjct: 241 DPVTVFAEIRRRKDGF 256


>gi|209525558|ref|ZP_03274097.1| hydroxyacylglutathione hydrolase [Arthrospira maxima CS-328]
 gi|209494057|gb|EDZ94373.1| hydroxyacylglutathione hydrolase [Arthrospira maxima CS-328]
          Length = 256

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 97/253 (38%), Positives = 136/253 (53%), Gaps = 7/253 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH   N  
Sbjct: 6   LPALSDNYIFLLHDPEQNQAAVVDPAEADPVLAKLSELGAELIAIFNTHHHADHVGGNRE 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L+K F   T++G  E+  +IPG +  L +GD  +FG     +   PGHT GHI Y+F   
Sbjct: 66  LRKHFPNLTVYGGAEDRDRIPGQEVFLKEGDRVEFGGRKADVFFVPGHTRGHIAYYFPAT 125

Query: 127 HF----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLF+ GCGR+FE + ++M  SL K++S  D T I+  HEYT NN  FAL
Sbjct: 126 DKEGGELFCGDTLFAGGCGRLFEGTPSQMVSSLSKLRSLPDDTRIWCAHEYTLNNLKFAL 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + D  N+ L+    KV   RSQN  T PS I +EK  NPFLR +  +L+  +  +   ++
Sbjct: 186 TVDGDNINLRDRLEKVTIARSQNQPTIPSLIGVEKATNPFLRWDEPALQLAV--QGKDDI 243

Query: 243 AVFTELRIRKNQS 255
             F  +R  K+Q 
Sbjct: 244 QTFARIRGMKDQF 256


>gi|27375333|ref|NP_766862.1| glyoxalase II [Bradyrhizobium japonicum USDA 110]
 gi|81740494|sp|Q89XT5|GLO2_BRAJA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|27348469|dbj|BAC45487.1| glyoxalase II [Bradyrhizobium japonicum USDA 110]
          Length = 255

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 101/245 (41%), Positives = 149/245 (60%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
             +DNF  LIH+ + + TA+IDAP+   I K L  +GW LT I  THHH DH      LK
Sbjct: 10  CLNDNFGYLIHDVETKATASIDAPEAGPILKALEREGWQLTDILITHHHGDHVGGVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             +NC +  P ++++ I  +D  +++ D    G+   +++ TPGHT+ HI Y F  +  +
Sbjct: 70  HKYNCRVVAPHDKTTAIANVDLRVANADVVKVGNLLARVVETPGHTLDHISYVFDTEKTV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ DP N 
Sbjct: 130 FAADTLFSIGCGRVFEGTYPMMWDSLLKLRALPDDFKLYCGHEYTASNVKFALTVDPDNA 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            LQ   ++V  +R++N  T PS +  EK+ N FLR ++ S+   L+M+ A   AVF ELR
Sbjct: 190 ALQARAAEVAKLRAENKPTIPSLLGDEKRANVFLRADDPSVAARLHMKGADAAAVFGELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|67922175|ref|ZP_00515690.1| Hydroxyacylglutathione hydrolase [Crocosphaera watsonii WH 8501]
 gi|67856075|gb|EAM51319.1| Hydroxyacylglutathione hydrolase [Crocosphaera watsonii WH 8501]
          Length = 257

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 127/254 (50%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+      A +D  +   + K L E G  L  I NTHHH DH  AN  
Sbjct: 6   LPALSDNYIFLLHDPHNNTAAVVDPAEAKPVLKCLDELGAKLVAILNTHHHADHVGANKK 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L K F    I+G  E+  +IPG    L +GDT  F     K+   PGHT GHI Y+F   
Sbjct: 66  LMKKFPDVCIYGGKEDQGRIPGQQVFLEEGDTVKFAEKMAKVYFVPGHTRGHIAYYFPPH 125

Query: 127 H-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDT+F+ GCGR+FE + A+M  SL K+++  D T ++  HEYT +N  FA
Sbjct: 126 DSEGKGDLFCGDTIFAGGCGRLFEGTPAQMVNSLTKLRNLPDNTRVWCAHEYTLSNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ +  N ELQ     +   R     T PS +  EKK NPFLR +  +L+    M     
Sbjct: 186 VTVEQDNNELQNRYQAIIKARKNQQATVPSLLGEEKKTNPFLRWDQPALQSLTGMN--DP 243

Query: 242 LAVFTELRIRKNQS 255
             VF ++R  K+  
Sbjct: 244 ARVFGQIRGMKDNF 257


>gi|310815410|ref|YP_003963374.1| hydroxyacylglutathione hydrolase [Ketogulonicigenium vulgare Y25]
 gi|308754145|gb|ADO42074.1| hydroxyacylglutathione hydrolase [Ketogulonicigenium vulgare Y25]
          Length = 264

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 93/250 (37%), Positives = 138/250 (55%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  LIH+     TA IDAP+   I  +LR +GW L  I  THHH DH  A 
Sbjct: 15  VTIPCLRDNYAFLIHDSTTNRTALIDAPEADPIETVLRARGWKLDAILLTHHHDDHIAAV 74

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L +     ++G   +  ++P +DH L  GD F     P+++I  PGHTIGHI +H   
Sbjct: 75  PALLQNHKAQVYGAAADRHRLPPLDHALKGGDVFSLLGTPVEVIEVPGHTIGHIAFHLPE 134

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                 GD+L  +GCGR+FE + A+M+ SL ++ +   +T I+ GHEYTE+N  FALS  
Sbjct: 135 LTAAFTGDSLMVMGCGRLFEGTAAQMYHSLTQLAALPPETLIHSGHEYTESNMRFALSIL 194

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P +  L+   +K+ + R++  +T P+ +  E   NPFLR     + + ++M +A  L VF
Sbjct: 195 PDDPSLRARATKIAACRAEGSFTVPARLEKELATNPFLRAHEAQIARAIDMPDADPLRVF 254

Query: 246 TELRIRKNQS 255
           T LR  K+  
Sbjct: 255 TRLRAMKDDF 264


>gi|313201262|ref|YP_004039920.1| hydroxyacylglutathione hydrolase [Methylovorus sp. MP688]
 gi|312440578|gb|ADQ84684.1| hydroxyacylglutathione hydrolase [Methylovorus sp. MP688]
          Length = 250

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/250 (33%), Positives = 129/250 (51%), Gaps = 4/250 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  ++H   +   A +D  D   + + L   G  L  I  THHH DH    
Sbjct: 5   IPIPAFSDNYIWMLH--AHGQAAVVDPGDAEPVLQQLAASGLQLQTILITHHHNDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      ++ P  E+           D    DF    + ++  PGHT+GH+ Y+   
Sbjct: 63  ERLQHETGARVYAPARENYAFKHQPVHEGDQIELDFLPLTLTVLEVPGHTLGHVAYYG-- 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE + A+M +SL K+ +   +T +Y  HEYTE+N  FA   D
Sbjct: 121 AKLLFCGDTLFSAGCGRLFEGTPAQMLDSLNKLAALPAETAVYCTHEYTEHNLKFARQLD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L    ++V  +R Q L + PST+++E++ NPFLR  + ++++   +  A+ LAVF
Sbjct: 181 PENAALLARQARVAQLRRQGLPSLPSTLAIERESNPFLRCASPAIQQASGIHEANPLAVF 240

Query: 246 TELRIRKNQS 255
           T +R  +N  
Sbjct: 241 TAIREMRNHF 250


>gi|168025266|ref|XP_001765155.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683474|gb|EDQ69883.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 254

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 106/253 (41%), Positives = 155/253 (61%), Gaps = 2/253 (0%)

Query: 4   LNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTR 63
           + I +    DN+  L+H+     T  +D      + K L+EKG  L +I NTHHH DHT 
Sbjct: 1   MLIQVKCLVDNYAYLLHDTASGTTGIVDPSAAGPVVKALKEKGLSLDYILNTHHHWDHTG 60

Query: 64  ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTI-GHICYH 122
            N +LKK +N  + GP  +  +IPGID  L DG+T+ FG   ++++ TPGHT  GH+ ++
Sbjct: 61  GNADLKKQYNAKVVGPRADQERIPGIDIALRDGETWMFGEQLMRVLDTPGHTRAGHVSFY 120

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           F     L  GDTLFS+GCGR+FE S  +M+ SL K+ +  D T +Y GHEYT +NA FAL
Sbjct: 121 FERSKSLFTGDTLFSIGCGRLFEGSPEQMWISLSKLTALPDDTLVYCGHEYTMSNAKFAL 180

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASN 241
           + +P N+ LQ    +VK +R ++  T P+T+  EK+ NPFLR  +  LRK+LN+   AS+
Sbjct: 181 TVEPQNIALQSRAQQVKELRDKDQPTIPTTLREEKEFNPFLRPFSAELRKSLNVAAAASD 240

Query: 242 LAVFTELRIRKNQ 254
           +  F  +R  K++
Sbjct: 241 IDAFAAVRAAKDR 253


>gi|323495339|ref|ZP_08100417.1| hydroxyacylglutathione hydrolase [Vibrio brasiliensis LMG 20546]
 gi|323310410|gb|EGA63596.1| hydroxyacylglutathione hydrolase [Vibrio brasiliensis LMG 20546]
          Length = 252

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 130/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LI N   R  A +D  D   +   L E    L  I  THHH D
Sbjct: 1   MLNIK-SIPAFNDNYIWLIQNSD-RRCAVVDPGDAAPVLAYLNEHNLSLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F             +P + H +  GD  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPQVDVVGPAN-EPVPTLTHAVEAGDQIELFDEVFFVLGLEGHTSGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T +Y  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMHTSLSKLAALPEETEVYCAHEYTTSNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +LQ+Y  +V  +R+QN  T P+TI  EK +NPFLR +  S+ +++      
Sbjct: 176 ALAVEPDNSQLQQYRDEVNRLRAQNQPTLPTTIRREKWINPFLRTDQPSVIRSVANRTSQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              LA+FT LR  KN+ 
Sbjct: 236 TDPLAIFTALREWKNEF 252


>gi|187924847|ref|YP_001896489.1| hydroxyacylglutathione hydrolase [Burkholderia phytofirmans PsJN]
 gi|187716041|gb|ACD17265.1| hydroxyacylglutathione hydrolase [Burkholderia phytofirmans PsJN]
          Length = 263

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/265 (30%), Positives = 136/265 (51%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +   R  A +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFDDNYIWVVSD--GRHAAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L       ++GP  E+ +         D  +    +  + ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQAVPVYGPAGEAIEHLTHRLKNGDHVSIAAPALKLSVLDVPGHTSGHI 118

Query: 120 CYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQAADPQGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDSLAALPGATEVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-- 233
           +N  FAL+C+P N ELQ +  K   +R++++ T P+TI+ E+ VNPFLR  + +++ +  
Sbjct: 179 SNIRFALACEPGNAELQAWRDKASELRARDVPTLPTTIAHERAVNPFLRAGDPAVQASLR 238

Query: 234 --LNMENASNLAVFTELRIRKNQSK 256
             L+      L  FT +R  KN+ +
Sbjct: 239 EQLHEAVPDRLTAFTLMREWKNRFR 263


>gi|170695451|ref|ZP_02886596.1| hydroxyacylglutathione hydrolase [Burkholderia graminis C4D1M]
 gi|170139642|gb|EDT07825.1| hydroxyacylglutathione hydrolase [Burkholderia graminis C4D1M]
          Length = 263

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/265 (30%), Positives = 137/265 (51%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +        +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFEDNYIWVVSD--GHHAVVVDPGEAAPVRAYLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L    +  ++GP  E+ +         D  T    +  + ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQDVPVYGPAGEAIERVTQRLENGDRVTIAAPALELSVLDVPGHTSGHI 118

Query: 120 CYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +   +T ++  HEYT 
Sbjct: 119 AYFQAADPGGTPHVFCGDTLFACGCGRLFEGTPQQMLASLDSLAALPGETQVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-- 233
           +N  FAL+C+P N +LQ +  +   +R++NL T P+TI+ E+ VNPFLR  N +++    
Sbjct: 179 SNIRFALACEPGNADLQAWRDQAADLRARNLPTLPTTIAHERAVNPFLRAGNPAVQAALQ 238

Query: 234 --LNMENASNLAVFTELRIRKNQSK 256
             L+ + +  L  FT +R  KN+ +
Sbjct: 239 EQLHEKVSDRLGAFTLMREWKNRFR 263


>gi|284050643|ref|ZP_06380853.1| hydroxyacylglutathione hydrolase [Arthrospira platensis str.
           Paraca]
 gi|291568347|dbj|BAI90619.1| putative glyoxalase II [Arthrospira platensis NIES-39]
          Length = 256

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 97/253 (38%), Positives = 136/253 (53%), Gaps = 7/253 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH   N  
Sbjct: 6   LPALSDNYIFLLHDPEQNQAAVVDPAEADPVLAKLSELGAELIAIFNTHHHADHVGGNRE 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L+K F   T++G  E+  +IPG +  L +GD  +FG     +   PGHT GHI Y+F   
Sbjct: 66  LRKHFPNLTVYGGAEDRDRIPGQEVFLKEGDRVEFGGRKADVFFVPGHTRGHIAYYFPAT 125

Query: 127 HF----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLF+ GCGR+FE + ++M  SL K++S  D T I+  HEYT NN  FAL
Sbjct: 126 DKEGGELFCGDTLFAGGCGRLFEGTPSQMVSSLSKLRSLPDDTRIWCAHEYTLNNLKFAL 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + D  N+ L+    KV   RSQN  T PS I +EK  NPFLR +  +L+  +  +   ++
Sbjct: 186 TVDGDNISLRDRLEKVTIARSQNQPTIPSLIGVEKATNPFLRWDEPALKLAV--QGKDDI 243

Query: 243 AVFTELRIRKNQS 255
             F  +R  K+Q 
Sbjct: 244 QTFARIRGMKDQF 256


>gi|303283280|ref|XP_003060931.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457282|gb|EEH54581.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 256

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 101/250 (40%), Positives = 146/250 (58%), Gaps = 3/250 (1%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+     TA +D P+   I   LREKGW LTHI NTH H DHT  N+ L
Sbjct: 7   PCLSDNYAFLLHDPSTGCTAVVDTPEVAPIEAALREKGWKLTHILNTHWHGDHTGGNVEL 66

Query: 69  KKFFNCTIFGPLEES---SKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           K+   C I GP  E      IPG+D  +S+ D    G+   ++I  PGHT+GH+ Y+F  
Sbjct: 67  KREHACEIVGPARERKGADAIPGMDRAVSEDDVVKIGNIEARVIDVPGHTLGHVAYYFPA 126

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  + VGD LF+LGCGR+FE    +M+ S+ K+ +   +T +Y  HEYT  NA FA+S +
Sbjct: 127 ERKVFVGDALFALGCGRMFEGKATQMWNSVSKLMALPRETEVYCAHEYTLANAKFAMSVE 186

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L     +V+  R++  +T P+TI LE + NPF R  +  +R+N+ + +A ++AVF
Sbjct: 187 PGNDALSARAKEVEEKRARGEWTVPTTIGLELETNPFCRPHSDEIRRNVGLVDADDVAVF 246

Query: 246 TELRIRKNQS 255
            E R RK+  
Sbjct: 247 KETRKRKDNF 256


>gi|110834083|ref|YP_692942.1| metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
 gi|110647194|emb|CAL16670.1| Metallo-beta-lactamase family protein [Alcanivorax borkumensis SK2]
          Length = 257

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 128/258 (49%), Gaps = 6/258 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT+  IAI  ++DN+    H         +D  D   + + LRE G  L+ +  THHH D
Sbjct: 1   MTASPIAIPAFNDNYIWAFHQQD--QCVVVDPGDAEPVERYLRENGLSLSALLITHHHPD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L K  +  ++GP +ES           D  T         I+  PGHT+GHI 
Sbjct: 59  HVGGVAALTKHRDIPVYGPAKESIPAMSHPLHEGDTITPAGTDLAFTIMEVPGHTLGHIA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +   +  +L  GDTLF+ GCGR+FE + A+MF SLE++ +  + T ++  HEYT+ N  F
Sbjct: 119 FINDSHGWLFSGDTLFAGGCGRLFEGTAAQMFHSLERLAALPEATLVFCAHEYTQANLTF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA- 239
           A +  P++  +Q     V  +R +   T PST++ EK  NPFLR +N  ++ +       
Sbjct: 179 AAAVTPNDSAVQTRLQAVTELRKKGKITLPSTLAEEKATNPFLRSDNEEVKASCQRHEPG 238

Query: 240 ---SNLAVFTELRIRKNQ 254
              S++  F  LR  K+ 
Sbjct: 239 CGESDIQCFAALRRWKDN 256


>gi|91784546|ref|YP_559752.1| hydroxyacylglutathione hydrolase [Burkholderia xenovorans LB400]
 gi|91688500|gb|ABE31700.1| Hydroxyacylglutathione hydrolase [Burkholderia xenovorans LB400]
          Length = 263

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 80/265 (30%), Positives = 134/265 (50%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +        +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFDDNYIWVVSDGHS--AVVVDPGEAAPVQAYLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L       ++GP  E+ +         D  +    +  + ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQAVPVYGPAGEAIEHLTHRLKNGDHVSIAAPALELSVLDVPGHTSGHI 118

Query: 120 CYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQAADPRGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDALAALPGATEVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-- 233
           +N  FAL+C+P N ELQ +  K   +R++ + T P+TI+ E+ VNPFLR  N +++ +  
Sbjct: 179 SNIRFALACEPANAELQAWRDKAGELRARGVPTLPTTIAHERAVNPFLRAGNPAVQASLR 238

Query: 234 --LNMENASNLAVFTELRIRKNQSK 256
             L+ +    L  FT +R  KN+ +
Sbjct: 239 EQLHEKVPDRLTAFTLMREWKNRFR 263


>gi|56554604|pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana
           Gene At2g31350
 gi|56554605|pdb|1XM8|B Chain B, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana
           Gene At2g31350
 gi|150261470|pdb|2Q42|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of
           Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350
 gi|150261471|pdb|2Q42|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of
           Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350
          Length = 254

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 100/249 (40%), Positives = 140/249 (56%), Gaps = 1/249 (0%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  ++H+        +D  +   I   L+  G  LT+I NTHHH DHT  NL 
Sbjct: 6   VPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +   + G   +  +IPGID  L DGD + F  H + ++ TPGHT GHI  +F    
Sbjct: 66  LKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSR 125

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDT+FSL CG++FE +  +M  SL+KI S  D T IY GHEYT +N+ FALS +P+
Sbjct: 126 AIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPN 185

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFT 246
           N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  NT +R+ L + E A       
Sbjct: 186 NEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALG 245

Query: 247 ELRIRKNQS 255
            +R  K+  
Sbjct: 246 IIRKAKDDF 254


>gi|296158204|ref|ZP_06841036.1| hydroxyacylglutathione hydrolase [Burkholderia sp. Ch1-1]
 gi|295891540|gb|EFG71326.1| hydroxyacylglutathione hydrolase [Burkholderia sp. Ch1-1]
          Length = 263

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 80/265 (30%), Positives = 134/265 (50%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +        +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFDDNYIWVVSDGHS--AVVVDPGEAAPVQAYLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L       ++GP  E+ +         D  +    +  + ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQAVPVYGPAGEAIEHLTHRLKNGDHVSIVAPALELSVLDVPGHTSGHI 118

Query: 120 CYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQAADPRGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDALAALPGATEVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----R 231
           +N  FAL+C+P N ELQ +  K   +R++ + T P+TI+ E+ VNPFLR  N ++    +
Sbjct: 179 SNIRFALACEPANAELQAWRDKAGELRARGVPTLPTTIAHERAVNPFLRAGNPAVQATLQ 238

Query: 232 KNLNMENASNLAVFTELRIRKNQSK 256
           + L+ +    L  FT +R  KN+ +
Sbjct: 239 EQLHEKVPDRLTAFTLMREWKNRFR 263


>gi|163745695|ref|ZP_02153055.1| hydroxyacylglutathione hydrolase, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382513|gb|EDQ06922.1| hydroxyacylglutathione hydrolase, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 255

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 90/255 (35%), Positives = 140/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    DN+  L+ +H       ID P+   I   L  +GW L+ ++ THHH D
Sbjct: 1   MAFDLVTIPCLSDNYAFLLRDHDSGDVTLIDVPEAAPIMAELDRRGWTLSQVWLTHHHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +    L   F   + G   ++ ++P +D  +++GD+   G+   +++   GHT+GHI 
Sbjct: 61  HVQGLAELLTRFPAQVVGAKADARRLPPLDREVAEGDSIALGALHAEVLDVSGHTVGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            H    +     D+L +LGCGR+FE + A+M+ESL+K+ +    T I  GHEYT  NA F
Sbjct: 121 LHVPEANAAFTADSLMALGCGRLFEGTPAQMWESLQKLAALPRDTTICSGHEYTAANAKF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  L      +++ R+    T PS +SLE + NPFLR  + ++R  L M +A+
Sbjct: 181 ALTVDPDNAALISRSKDIEATRTAGRPTVPSQLSLELETNPFLRPGDPAIRATLGMPDAT 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VFTE+R RK+Q 
Sbjct: 241 DTEVFTEIRKRKDQF 255


>gi|293603365|ref|ZP_06685793.1| hydroxyacylglutathione hydrolase [Achromobacter piechaudii ATCC
           43553]
 gi|292818275|gb|EFF77328.1| hydroxyacylglutathione hydrolase [Achromobacter piechaudii ATCC
           43553]
          Length = 273

 Score =  205 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+   I + +    A +D  +   + + L ++G  L  I  THHH DH    
Sbjct: 18  LPLPAFTDNYIWAIVHGEN--AAVVDPGEAGPVLRWLEQEGLRLRAILLTHHHGDHVGGV 75

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
           L L +  + T++GP  ES     +     D  T       ++++  PGHT GHI Y    
Sbjct: 76  LELSRIADLTVYGPARESLPRCDVPLTEGDRVTLPELDLDLRVLDVPGHTAGHIAYTGRA 135

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLF+ GCGR+FE + A+MF+SLEK       T ++  HEYT  N  +AL
Sbjct: 136 AGIEPVLFCGDTLFAGGCGRLFEGTPAQMFDSLEKFSVLPPDTQVFCAHEYTLANLRWAL 195

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNMEN 238
           + +P N  L ++  + + +R++ L T PSTI  E+  NPFLR +   + +          
Sbjct: 196 AVEPANRTLHQWYQRAQQLRAEGLPTLPSTIGQERATNPFLRTQQVDVIRAAASWAGNNQ 255

Query: 239 ASNLAVFTELRIRKNQSK 256
            + + VF  LR  KN  K
Sbjct: 256 PAPVEVFASLREWKNDFK 273


>gi|227823240|ref|YP_002827212.1| putative glyoxalase II [Sinorhizobium fredii NGR234]
 gi|227342241|gb|ACP26459.1| putative glyoxalase II [Sinorhizobium fredii NGR234]
          Length = 256

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 165/246 (67%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     TA+IDAP+   I + L  +GW LTHI  THHH DH  AN++LK
Sbjct: 11  CRTDNFGVLIHDPASGATASIDAPEERPILEALERRGWRLTHILTTHHHGDHVAANVSLK 70

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  TI GP  E+SKIPGID  ++ G+ FDF  HP+++I TPGHT GHI +H   D  L
Sbjct: 71  QRFGVTIIGPKGEASKIPGIDKQVAHGERFDFAGHPVEVIETPGHTAGHISFHLPEDKLL 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE +   M++SL ++ +  D T +YFGHEYT +NA+FA++ DP N 
Sbjct: 131 FAADTLFALGCGRLFEGTAETMWQSLNRLMALPDDTSVYFGHEYTLSNAHFAVTIDPENA 190

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++  RS   +T P+TI LEK+ NPFLR  ++ +R +L ME AS+ AVF E+R
Sbjct: 191 ALKERAAEIEETRSDGGFTAPTTIGLEKRTNPFLRAGDSKIRAHLGMEKASDAAVFAEIR 250

Query: 250 IRKNQS 255
            RK+  
Sbjct: 251 KRKDNF 256


>gi|163737810|ref|ZP_02145227.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis BS107]
 gi|161389336|gb|EDQ13688.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis BS107]
          Length = 257

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 144/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+HN +   TA +DAP+   I   L  +GW L  I  THHH D
Sbjct: 3   MPLEIVTLPCLSDNYAFLLHNAETGRTALVDAPEAAAIRSELERRGWGLDQILLTHHHWD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L+  ++  + G   ++ ++P +D  +++GD+F      + ++   GHTIGHI 
Sbjct: 63  HIDGVADLRTAYDPQVIGASADAHRLPDLDLAVAEGDSFTCLDEEVSVLDVSGHTIGHIA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H  +   +   D+L +LGCGR+FE +  +M++SL+K+ +   +T +Y GHEYT++NA F
Sbjct: 123 FHIPSAAAVFTADSLMALGCGRLFEGTPDQMWQSLQKLSALPGETTVYSGHEYTQSNARF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N  LQ  C  + + R++   T PS +  E   NPFLR    SL++ + M  AS
Sbjct: 183 ALTIEPDNAALQHRCKAIDAARAKGEATVPSQLQEELDTNPFLRAHLDSLKQAVGMTGAS 242

Query: 241 NLAVFTELRIRKNQS 255
              VF E+R RK++ 
Sbjct: 243 AAEVFAEIRARKDKF 257


>gi|195440518|ref|XP_002068089.1| GK10504 [Drosophila willistoni]
 gi|194164174|gb|EDW79075.1| GK10504 [Drosophila willistoni]
          Length = 308

 Score =  204 bits (519), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 83/265 (31%), Positives = 127/265 (47%), Gaps = 10/265 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + + I     DN+  LI ++K +  A +D  D  ++ K + E+   L  +  THHH 
Sbjct: 44  LAGMQVKILPALQDNYMYLIIDNKTKEAAVVDPVDPDLVIKTVNEEKVTLKKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L K +            +I  ++  +   DTF+ GS  +  ++TP HT GHI
Sbjct: 104 DHAGGNEKLVKLWTSGELKVYGGDDRIGALNEKVRQNDTFNIGSLNVMCLSTPCHTTGHI 163

Query: 120 CYHFMNDHFL-------CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGH 171
           CYH                GDTLF  GCGR FE +  EM+E+   K+ +  D T ++ GH
Sbjct: 164 CYHVSAADDAAADSGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDDTKVFCGH 223

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+  ++++
Sbjct: 224 EYTLQNMSFARHVEPDNQLIQQRIEWAKLRRASQDPTVPSTIGEEKSWNPFMRVHESTVQ 283

Query: 232 KNLNMENASNLAVFTELRIRKNQSK 256
           K+      + +    +LR  K+  K
Sbjct: 284 KHTG-NTTNPIETMGKLRKEKDNFK 307


>gi|295677147|ref|YP_003605671.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1002]
 gi|295436990|gb|ADG16160.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1002]
          Length = 263

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/265 (31%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  +I +   R    +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFEDNYIWVIAD--GRHAVVVDPGEAAPVRACLAQRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L    +  ++GP  E+           D  T    +    ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQDVPVYGPASEAIARLTHRLKSGDHVTIAAPALEFSVLDVPGHTSGHI 118

Query: 120 CYHFMND----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQAADTGGTPHVFCGDTLFACGCGRLFEGTPQQMLNSLDALAALPGATEVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-- 233
           +N  FAL+C+PHN ELQ +  K   +R+++  T P+TI+ E+ VNPFLR +  +++ N  
Sbjct: 179 SNIRFALACEPHNAELQAWRDKANELRARHQPTLPTTIAHERAVNPFLRADEPAIQSNLE 238

Query: 234 --LNMENASNLAVFTELRIRKNQSK 256
             L+   +  L  FT +R  KN+ +
Sbjct: 239 AQLHETVSDRLKAFTLMREWKNRFR 263


>gi|89069067|ref|ZP_01156448.1| hydroxyacylglutathione hydrolase, putative [Oceanicola granulosus
           HTCC2516]
 gi|89045436|gb|EAR51501.1| hydroxyacylglutathione hydrolase, putative [Oceanicola granulosus
           HTCC2516]
          Length = 252

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/250 (36%), Positives = 136/250 (54%), Gaps = 1/250 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+HN + R TA +DAP+   I+ +L  +GW L+ I  THHH DH    
Sbjct: 4   VTIPCRTDNYAFLLHNAESRETALVDAPEAAPIAAVLSARGWQLSDILITHHHGDHVEGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L +  +  + G   ++ ++P +D  + +GD       P+ I    GHT+GH+ +HF  
Sbjct: 64  AGL-RTDDVRVIGAAADAHRLPDLDLAVREGDALTVCGEPVTIFDVSGHTVGHVAFHFPE 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
                  D+L +LGCGR+FE +  +M+ SL K+++  + T I  GHEYT  NA FA + D
Sbjct: 123 TGAAFTADSLMALGCGRLFEGTPEQMWHSLLKLRALPEDTVICSGHEYTAANARFAQTID 182

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L      V   R+ +  T PST+  E   NPFLR +   L+  L ME AS++ VF
Sbjct: 183 PANGALMSRSRAVDEARTLDQPTVPSTLKEEIATNPFLRADTPELKAALGMERASDVEVF 242

Query: 246 TELRIRKNQS 255
            E+R RK++ 
Sbjct: 243 AEIRARKDRF 252


>gi|126656671|ref|ZP_01727885.1| glyoxalase II [Cyanothece sp. CCY0110]
 gi|126621891|gb|EAZ92599.1| glyoxalase II [Cyanothece sp. CCY0110]
          Length = 257

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 89/254 (35%), Positives = 127/254 (50%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+      A +D      +   L + G  L  IFNTHHH DH   N  
Sbjct: 6   LPALSDNYIFLLHDPDNNTAAVVDPAVAEPVLNCLDQLGAKLVAIFNTHHHADHVGGNQK 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + F    ++G  E+  +IPG    L +GDT +F     K+   PGHT GHI Y+F  +
Sbjct: 66  LMEKFPDLCVYGSQEDKGRIPGQQVFLQEGDTVEFAGKTGKVYFVPGHTRGHIAYYFPPN 125

Query: 127 H-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDT+F+ GCGR+FE +  +M +S+ K+++  D T I+  HEYT NN  FA
Sbjct: 126 DSEEIGDLFCGDTIFAGGCGRLFEGTPTQMVQSISKLRNLPDNTRIWCAHEYTLNNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ D  N +LQ     V   R     T PS +  EKK NPFLR +  +L+    M     
Sbjct: 186 VTVDKDNSDLQTRYQAVIKARENEQATVPSLLGEEKKTNPFLRWDQPALQMVTGMN--DP 243

Query: 242 LAVFTELRIRKNQS 255
             VF ++R  K+  
Sbjct: 244 ARVFGKIRGMKDNF 257


>gi|22299182|ref|NP_682429.1| putative hydroxyacylglutathione hydrolase [Thermosynechococcus
           elongatus BP-1]
 gi|81742856|sp|Q8DIF1|GLO2_THEEB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|22295364|dbj|BAC09191.1| tll1639 [Thermosynechococcus elongatus BP-1]
          Length = 252

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 92/249 (36%), Positives = 134/249 (53%), Gaps = 3/249 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN-L 66
           ++   DN+  L+H+ +    A +D  +   +   L E G  L  IFNTHHH DH  AN  
Sbjct: 6   LNALTDNYIFLLHDPQTGTAAVVDPAEPEPVLAKLAELGATLRAIFNTHHHWDHVGANCA 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
              +F +  ++G  E+  +IP     L  GD   FG     ++  PGHT GHI Y+    
Sbjct: 66  LRSRFPDIAVYGSSEDQGRIPEQTVFLKAGDRVPFGQTYFDVLFVPGHTRGHIAYYAPTT 125

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF  GCGR+FE S A+M +SL +++   ++T ++  HEYT+ N  FAL+ + 
Sbjct: 126 GDLFCGDTLFGGGCGRLFEGSPAQMLDSLNQLRQLPEETRVWCAHEYTQKNLSFALTVEA 185

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQ+  ++V   R+Q   T PSTI LEK  NPFLR E  S++  +     + L  FT
Sbjct: 186 DNPTLQERYAQVCRDRAQGKATIPSTIGLEKATNPFLRCEVRSIQIAVGA--TTPLQTFT 243

Query: 247 ELRIRKNQS 255
            LR +++Q 
Sbjct: 244 RLRGKRDQY 252


>gi|260576489|ref|ZP_05844479.1| hydroxyacylglutathione hydrolase [Rhodobacter sp. SW2]
 gi|259021372|gb|EEW24678.1| hydroxyacylglutathione hydrolase [Rhodobacter sp. SW2]
          Length = 253

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 97/255 (38%), Positives = 141/255 (55%), Gaps = 2/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   + I    DN+  LIH+     TA +D PD   I   L  +GW L+ I  THHH D
Sbjct: 1   MTLQLVTIPCRKDNYAFLIHDAASGETAVVDVPDATPILAELARRGWQLSDILITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      + G   ++ ++P +D  LSDG TF  G+   ++I  PGHTIGH+ 
Sbjct: 61  HIEGVQALRAATGAMVIGNAADAHRLPPLDLALSDGLTFTIGAEVGQMIEVPGHTIGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF        GDTL ++GCGR+FE S  +M++SL+++ +   +T I  GHEY E+NA F
Sbjct: 121 YHFAASGLAFTGDTLMAMGCGRLFEGSAQQMWQSLKRLAALPPETLICSGHEYAESNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P    L     ++ + R+QNL T PST++ E   NPFLR     L   L M +A+
Sbjct: 181 ALTLEPATPALTLRLGQIAAARAQNLPTVPSTLADELATNPFLRA--PLLGAALGMADAT 238

Query: 241 NLAVFTELRIRKNQS 255
           +  +F  +R RK++ 
Sbjct: 239 DAEIFAAIRARKDKF 253


>gi|71726091|gb|AAZ39214.1| putative hydroxyacylglutathione hydrolase [Janthinobacterium
           lividum]
          Length = 269

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 129/260 (49%), Gaps = 12/260 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  LIH+   R  A +D  D   I   L+     LT I  THHH DHT   
Sbjct: 12  LAVPAFADNYLWLIHD--GRHAAVVDPGDAMAILDALQAHQLTLTAILLTHHHADHTGGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + F   +FGP  E+           D          + +I  PGHT GHI Y    
Sbjct: 70  PELLQHFAVPVFGPRNEAITAITEPLAEGDVAYVPELGLQMTVIDVPGHTKGHIAYVRQR 129

Query: 126 D-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           D      +L  GDTLF+ GCGR+FE +  +M +SL K+ +  D T ++  HEYT +N  F
Sbjct: 130 DERSGAPWLFSGDTLFAGGCGRLFEGTPGQMADSLGKLAALPDDTEVFCAHEYTLSNLRF 189

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--- 237
           A + +P N+ LQ+  +     R Q L T PSTI+LEK  NPFLR    ++  +L +E   
Sbjct: 190 ANAVEPGNVALQERIAIDTEKRQQGLSTVPSTIALEKATNPFLRYREPAILTSLKVEGKL 249

Query: 238 --NASNLAVFTELRIRKNQS 255
             +AS +  F  LR+ KN  
Sbjct: 250 ASDASPVEAFAALRMWKNNF 269


>gi|89094530|ref|ZP_01167469.1| Metallo-beta-lactamase superfamily protein [Oceanospirillum sp.
           MED92]
 gi|89081266|gb|EAR60499.1| Metallo-beta-lactamase superfamily protein [Oceanospirillum sp.
           MED92]
          Length = 257

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 127/260 (48%), Gaps = 8/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+   I  + DN+  +I +    + A +D  D   +   L E    LT I  THHH D
Sbjct: 1   MFSVT-PIPAFSDNYIWVIASPDSNMVAVVDPGDEAPVLAYLEENNLQLTAILITHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     LK  F   ++GP   +S   GI H L+DGD+       + I A PGHT+ HI 
Sbjct: 60  HTGGVEALKDRFKTPVYGPA--NSPFQGITHPLNDGDSIQLMGASVAIKAIPGHTLDHIS 117

Query: 121 YHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           Y+          GDTLF  GCGR+FE +  +M  ++    S  D T +Y  HEY+  N  
Sbjct: 118 YYSERHKPQLFCGDTLFLAGCGRLFEGTAKQMLNAMNYFASLPDDTEVYCTHEYSMANLS 177

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR-KNLNMEN 238
           FA + +P+N  ++    +    R Q+  T P++I+ EK +NPF+R ++  +    L    
Sbjct: 178 FAEAVEPNNDAIKNAIRRCAEQREQDQPTLPTSIAEEKLINPFMRTQHEDVVSAALGFSR 237

Query: 239 AS---NLAVFTELRIRKNQS 255
           AS    + VF  +R  KNQ 
Sbjct: 238 ASLSNEVEVFASIREWKNQF 257


>gi|209695826|ref|YP_002263756.1| putative metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
 gi|226723983|sp|B6EJV4|GLO2_ALISL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|208009779|emb|CAQ80085.1| putative metallo-beta-lactamase [Aliivibrio salmonicida LFI1238]
          Length = 252

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 93/257 (36%), Positives = 135/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LIHN+       +D  +   +   L+E G  L  I  THHH D
Sbjct: 1   MLLIK-SIPAFNDNYIWLIHNND-NHCVVVDPGEAAPVLACLKEHGLILDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        E    IP + H + DGD  +  +    ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPNINVVGPEN-EPIPTLTHPVGDGDFVELFNEKFMVLGVEGHTKGHIA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  F
Sbjct: 118 YIG--DEKLFCGDTLFSAGCGRLFEGTAEQMFHSLQKLAALPDETEVYCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  LQ+Y  KV  +R+    T P+T+  EK +NPFLR    S+++ +   +EN
Sbjct: 176 ALAVEPDNDYLQQYREKVLRLRANGKATIPTTMQREKLINPFLRTSEASVKQAVSSKVEN 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S +A F  LR  K++ 
Sbjct: 236 DSEVATFAALRRWKDEF 252


>gi|126739847|ref|ZP_01755538.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           SK209-2-6]
 gi|126719079|gb|EBA15790.1| hydroxyacylglutathione hydrolase, putative [Roseobacter sp.
           SK209-2-6]
          Length = 255

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 148/255 (58%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    I +    DN+  L+HN     TA +DAP++  I   L+E+GW L  I  THHH D
Sbjct: 1   MPLEIITLPCLSDNYAFLLHNAAEGKTALVDAPESAAIKTALQERGWGLDAILLTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L+  +   ++G + ++ ++P +D  L DG++FD     + ++   GHT+GHI 
Sbjct: 61  HVDGVADLRATYGSKVYGAMVDAHRLPELDVALKDGESFDLFGEAVTVLDVSGHTLGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H      +   D+L +LGCGR+FE +  +M+ SL ++ +   +T +Y GHEYT++NA F
Sbjct: 121 FHMPQSKAVFTADSLMALGCGRLFEGTPEQMWHSLSRLAALPAETMVYSGHEYTQSNAAF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N  LQ   ++V + R++   T PS + LE + NPFLR  + +L++ + ++   
Sbjct: 181 ALTIEPGNAALQARVAEVNAKRAKGEATVPSLLKLEIETNPFLRAADPALKEAIGLQGVE 240

Query: 241 NLAVFTELRIRKNQS 255
           N +VF E+R RK+  
Sbjct: 241 NASVFAEVRKRKDNF 255


>gi|224133230|ref|XP_002327992.1| predicted protein [Populus trichocarpa]
 gi|222837401|gb|EEE75780.1| predicted protein [Populus trichocarpa]
          Length = 328

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 103/256 (40%), Positives = 147/256 (57%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        ID  +   +   L  K   LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDVDTGTVGVIDPSEAAPVIDALSRKNRNLTYILNTHHHYD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + FG H + ++ TPGHT GH+ 
Sbjct: 133 HTGGNEELKARYGAKVIGSGVDRDRIPGIDIVLNDGDNWMFGGHEVLVMETPGHTRGHVS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D T+IY GHEYT +N+ F
Sbjct: 193 FYFPGSGAIFAGDTLFSLSCGKLFEGTPEQMLSSLRKIMSLPDDTNIYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS DP+N  LQ Y + V  +RS++L T P+ + +EK  NPFLR  +T++R  LN+   A
Sbjct: 253 ALSVDPNNEALQSYAAHVAHLRSKSLPTIPTKLKVEKACNPFLRTSSTAIRHTLNIPATA 312

Query: 240 SNLAVFTELRIRKNQS 255
           ++      +R  K+  
Sbjct: 313 NDSEALGVIRQAKDNF 328


>gi|163742884|ref|ZP_02150268.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis 2.10]
 gi|161383848|gb|EDQ08233.1| hydroxyacylglutathione hydrolase, putative [Phaeobacter
           gallaeciensis 2.10]
          Length = 257

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 143/255 (56%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+HN +   TA +DAP+   I   L  +GW L  I  THHH D
Sbjct: 3   MPLEIVILPCLSDNYAFLLHNAETGRTALVDAPEAAAIRSELERRGWGLDQILLTHHHWD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L+  ++  + G   +  ++P +D  +++GD+F      + ++   GHTIGHI 
Sbjct: 63  HIDGVADLRTAYDPQVIGASADVHRLPDLDLAVAEGDSFTCLGEEVSVLDVSGHTIGHIA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H  +   +   D+L +LGCGR+FE +  +M++SL+K+ +   +T +Y GHEYT++NA F
Sbjct: 123 FHISSAAAVFTADSLMALGCGRLFEGTPDQMWQSLQKLAALPGETTVYSGHEYTQSNARF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N  LQ  C  + + R++   T PS +  E   NPFLR    SL++ + M  AS
Sbjct: 183 ALTIEPDNAALQHRCKAIDAARAKGEATVPSQLQEELDTNPFLRAHLDSLKQAVGMTGAS 242

Query: 241 NLAVFTELRIRKNQS 255
              VF E+R RK++ 
Sbjct: 243 AAEVFAEIRARKDKF 257


>gi|156403564|ref|XP_001639978.1| predicted protein [Nematostella vectensis]
 gi|156227110|gb|EDO47915.1| predicted protein [Nematostella vectensis]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/254 (33%), Positives = 126/254 (49%), Gaps = 9/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + K +  A +D  +   +   ++E+G  LT +  THHH DH   N  
Sbjct: 6   LPALSDNYMYLLVDPKTKEAAVVDPVEPEKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEG 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND- 126
           L K  +           +I  +   +S  + F  GS  +K + TP HT GHIC+H   D 
Sbjct: 66  LVKLVSGLTVY--GGDERIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDA 123

Query: 127 ---HFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                +  GDTLFS GCGR FE S  EM+ + +E + S  + T ++ GHEYT NN  +AL
Sbjct: 124 GKPTAVFTGDTLFSGGCGRFFEGSPPEMYSALIEVLGSLPENTRVFCGHEYTVNNLKYAL 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
             +P N  +Q+  +  K  R+ N  T PSTI  E   NPF+R+   S++K+        +
Sbjct: 184 HVEPDNKAVQQRMAWAKEKRAHNEPTIPSTIGEEFSFNPFMRVREPSVQKHTG--ETDPV 241

Query: 243 AVFTELRIRKNQSK 256
            V   LR  K+  +
Sbjct: 242 KVMGVLRKEKDSFR 255


>gi|158421848|ref|YP_001523140.1| glyoxalase II [Azorhizobium caulinodans ORS 571]
 gi|158328737|dbj|BAF86222.1| glyoxalase II [Azorhizobium caulinodans ORS 571]
          Length = 257

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 98/249 (39%), Positives = 138/249 (55%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+ +L+H+     TA +DAP+   I   L  +GW LTHI  THHH DH    L 
Sbjct: 8   IPCLSDNYAVLLHDPLTEATAVVDAPEPGPIMDALELEGWDLTHILITHHHADHVDGVLA 67

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +  T+ GP  E++ IP +D  + D D    GS   ++I TPGHT GHI + F  + 
Sbjct: 68  LKAQYGATVVGPKAEAATIPALDVEVVDADPVGLGSAIGRVIETPGHTAGHISFVFPEEK 127

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF +GCGR  E     ++ SL+++++  D   +Y GHEYT  N  FALS DP 
Sbjct: 128 LLFAGDTLFVMGCGRALECDPPVLWHSLQRLRTLPDDFSLYCGHEYTVANGRFALSVDPD 187

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L+   +  ++ R +   T P+ +  E+  NPFLR ++  + + L +  A   AVFTE
Sbjct: 188 NGALRARVADAEAARREGKPTIPALLGDERLTNPFLRADDPDMAERLGLAGADPAAVFTE 247

Query: 248 LRIRKNQSK 256
           LR RKN  +
Sbjct: 248 LRARKNVFR 256


>gi|146337699|ref|YP_001202747.1| putative hydroxyacylglutathione hydrolase (glyoxalase II)
           [Bradyrhizobium sp. ORS278]
 gi|160386199|sp|A4YKS8|GLO2_BRASO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|146190505|emb|CAL74504.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II)
           [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 140/245 (57%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF  LIH+     TA++DAP+   I + L   GW LT I  THHH DH      LK
Sbjct: 10  CLSDNFGYLIHDPATGATASVDAPEAGPIVRQLEANGWTLTDILITHHHYDHVGGVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + + C + GP +  + I  +D  ++ GD    G    +++ TPGHT+ H+ Y F  D  +
Sbjct: 70  QRYGCRVIGPHDRKAAIADVDLRVAHGDVVKVGELLARVLETPGHTLDHVSYVFDADKAV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ DP N 
Sbjct: 130 FAADTLFSIGCGRVFEGTYPMMWDSLLKLRTLPDDFRLYCGHEYTASNVKFALTVDPDNE 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L+   ++V  +R+ N  T P  +  EK+ N FLR ++ ++   L M+ AS   VF ELR
Sbjct: 190 ALKARAAEVTRLRAANQPTIPVLLGEEKQANVFLRADDPAIAVRLRMKGASAEEVFGELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|254454033|ref|ZP_05067470.1| hydroxyacylglutathione hydrolase [Octadecabacter antarcticus 238]
 gi|198268439|gb|EDY92709.1| hydroxyacylglutathione hydrolase [Octadecabacter antarcticus 238]
          Length = 253

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 88/255 (34%), Positives = 136/255 (53%), Gaps = 2/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    DN+  L+HN +   T  +DAPD   I   L  +GW LT +  THHH D
Sbjct: 1   MPLDLVTIPCLADNYAFLLHNARTNETLLVDAPDAPPIQAALDARGWTLTDVLLTHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H           +  + G   ++ ++P +D  + DGDT        ++    GHT+GHI 
Sbjct: 61  HI--VGLGPLRGSARVIGAAADAHRLPPLDLAVGDGDTVTICGEAAQVFDVSGHTMGHIA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            HF     L   D+L +LGCGR+FE +  +M++S+ K++S  D+T +  GHEYT+ NA F
Sbjct: 119 LHFAKSGVLFTADSLMALGCGRLFEGTPVQMWQSMLKLRSLPDETRVCSGHEYTQTNARF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N +L     +V   R+ N  T PS + +EK+ NPFLR +  +L+    M N+ 
Sbjct: 179 ALTIEPDNSDLISRIEEVSRARAANHPTVPSNLGIEKRTNPFLRADVPALQTAFGMTNSD 238

Query: 241 NLAVFTELRIRKNQS 255
              VFT++R +++  
Sbjct: 239 PTDVFTQIRKKRDNF 253


>gi|33594120|ref|NP_881764.1| hydroxyacylglutathione hydrolase [Bordetella pertussis Tohama I]
 gi|33603255|ref|NP_890815.1| hydroxyacylglutathione hydrolase [Bordetella bronchiseptica RB50]
 gi|33564194|emb|CAE43479.1| probable hydroxyacylglutathione hydrolase [Bordetella pertussis
           Tohama I]
 gi|33577379|emb|CAE34644.1| probable hydroxyacylglutathione hydrolase [Bordetella
           bronchiseptica RB50]
 gi|332383536|gb|AEE68383.1| hydroxyacylglutathione hydrolase [Bordetella pertussis CS]
          Length = 266

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+   + +      A +D  D   + + LR  G  L  I  THHH DH    
Sbjct: 11  VPLPAFSDNYIWALAHE--GQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGV 68

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
           L L +    T++GP  E+     +     D  T    +  ++++  PGHT GHI Y    
Sbjct: 69  LELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRA 128

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLF+ GCGR+FE + A+M +SLEK+ +    T +   HEYT  N  +AL
Sbjct: 129 AGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWAL 188

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMEN 238
           + +P N  LQ++  + + +R++   T PSTI  E++ NPFLR  + ++            
Sbjct: 189 AVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSL 248

Query: 239 ASNLAVFTELRIRKNQSK 256
           A+ + VF  LR  KN  K
Sbjct: 249 ATPVEVFAALRQWKNNFK 266


>gi|311103918|ref|YP_003976771.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans A8]
 gi|310758607|gb|ADP14056.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans A8]
          Length = 273

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/258 (31%), Positives = 119/258 (46%), Gaps = 9/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  ++DN+   I        A +D  D   + + L   G  L  I  THHH DH    
Sbjct: 18  LPLPAFNDNYIWAIV--HGGEAAVVDPGDAGPVLQWLDRTGLRLRAILLTHHHGDHVGGV 75

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             L +    T++GP  E      +     D          + ++  PGHT GHI Y+   
Sbjct: 76  PELSRIEGITVYGPAHEQLPRCDVRLAEGDRVAIPELDLDLTVLDVPGHTAGHIAYYGRA 135

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLF+ GCGR+FE + A+M +SL K       T ++  HEYT  N  +AL
Sbjct: 136 AGQQPVLFCGDTLFAGGCGRLFEGTPAQMHDSLGKFAVLPPDTQVFCAHEYTLANLRWAL 195

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNMEN 238
           + DP N  LQ++  + + +R++ L T PSTI  E+  NPFLR +   +           +
Sbjct: 196 AVDPANRSLQQWHQQAQQLRAEGLPTLPSTIGQERAANPFLRTQEVEVVHAAERWAGHSH 255

Query: 239 ASNLAVFTELRIRKNQSK 256
           A+ + VF  LR  KN  K
Sbjct: 256 ATPVEVFASLRKWKNDFK 273


>gi|302755800|ref|XP_002961324.1| hypothetical protein SELMODRAFT_164521 [Selaginella moellendorffii]
 gi|300172263|gb|EFJ38863.1| hypothetical protein SELMODRAFT_164521 [Selaginella moellendorffii]
          Length = 321

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 102/268 (38%), Positives = 147/268 (54%), Gaps = 21/268 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ +        +D      + + L  +G  LTHI NTHHH DHT  N +
Sbjct: 53  IPCLKDNYAYLLRDASSGAIGVVDPSTAQPVIEALERRGLKLTHIINTHHHWDHTGGNAD 112

Query: 68  LKKFFNCT--------------------IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIK 107
           LKK +                                 IPGID  L DGDT+  G H +K
Sbjct: 113 LKKRYGAQAREFFFFFLLSSFLLRRTKLYLIVAPPGDGIPGIDVPLKDGDTWMLGEHAMK 172

Query: 108 IIATPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHI 167
           +I TPGHT GH+ Y+F +   +  GDTLFS+GCGR+FE S  +M+ SL K+ +  D+T +
Sbjct: 173 VIGTPGHTRGHVSYYFADSRAVFTGDTLFSIGCGRLFEGSAQQMWSSLSKLAALPDETRV 232

Query: 168 YFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN 227
           + GHEYT +NA FA++ +P+N  L  +  KVK +R   L T PS++  EKK NPFLR  +
Sbjct: 233 FCGHEYTLSNAKFAMTIEPNNPALNSHFEKVKQLRDSGLATIPSSVGEEKKFNPFLRPAS 292

Query: 228 TSLRKNLNM-ENASNLAVFTELRIRKNQ 254
             +R++LN+ ++AS+  VF  +R  K++
Sbjct: 293 REIRRSLNLSDDASDSDVFAAVRKAKDR 320


>gi|323526832|ref|YP_004228985.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1001]
 gi|323383834|gb|ADX55925.1| hydroxyacylglutathione hydrolase [Burkholderia sp. CCGE1001]
          Length = 263

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/265 (31%), Positives = 138/265 (52%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  ++ +        +D  +   +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFEDNYIWVVSD--GHHAVVVDPGEAAPVRACLAKRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L K     ++GP  E+ +         D  T    +    ++  PGHT GHI
Sbjct: 59  DHVGGVADLLKGQAVPVYGPAGEAIEHVTQRLKNGDRVTIAKPALEFSVLDVPGHTSGHI 118

Query: 120 CYHFMNDH----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE + A+M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQTADPGGTPHVFCGDTLFACGCGRLFEGTPAQMLASLDALAALPGATQVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----R 231
           +N  FAL+C+P N+ELQ +  K   +R++N  T P+TI+ E+ VNPFLR ++ ++    +
Sbjct: 179 SNIRFALACEPGNVELQAWRDKASELRARNQPTLPTTIAHERAVNPFLRSDSPAVHATLQ 238

Query: 232 KNLNMENASNLAVFTELRIRKNQSK 256
           + L+ + +  L  FT +R  KN+ +
Sbjct: 239 EQLHEKISDRLTAFTLMREWKNRFR 263


>gi|187479406|ref|YP_787431.1| hydroxyacylglutathione hydrolase [Bordetella avium 197N]
 gi|115423993|emb|CAJ50546.1| probable hydroxyacylglutathione hydrolase [Bordetella avium 197N]
          Length = 269

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 77/257 (29%), Positives = 113/257 (43%), Gaps = 8/257 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+   +          +D      +   L  +G  L  I  THHH DH    
Sbjct: 15  VPIEAFTDNYIWAVVCD--GWAVVVDPGQAQPVRDFLAARGLQLRAILLTHHHGDHVGGV 72

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           L L       ++GP  E+     +     D          +  +  PGHT GHI Y    
Sbjct: 73  LELLADATVPVYGPAHETLPHCDVPLQEGDRVDIPDLGISLACLDVPGHTAGHIAYAGHL 132

Query: 126 DHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
           D       GDTLF+ GCGR+FE +  +M  SLEK+ +  + T ++  HEYT  N  +A +
Sbjct: 133 DGKPLLFCGDTLFAAGCGRLFEGTPEQMLASLEKLGTLPEDTQVFCAHEYTLANLRWATA 192

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNMENA 239
            +P NL LQ++  + + MR+    T PS+I  E+  NPFLR +   +            +
Sbjct: 193 VEPANLTLQQWQVQARQMRTDGRPTLPSSIGKERDTNPFLRTQQADVINAAKIWAGQTLS 252

Query: 240 SNLAVFTELRIRKNQSK 256
           S + VF  LR  KN  K
Sbjct: 253 SPVEVFAALRNWKNNFK 269


>gi|254440799|ref|ZP_05054292.1| metallo-beta-lactamase superfamily protein [Octadecabacter
           antarcticus 307]
 gi|198250877|gb|EDY75192.1| metallo-beta-lactamase superfamily protein [Octadecabacter
           antarcticus 307]
          Length = 253

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 138/255 (54%), Gaps = 2/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + I    +N+  L+HN + + T  +DAPD   I   L  +GW LT I  THHH D
Sbjct: 1   MPLELVTIPCLANNYAFLLHNARTKETLLVDAPDAPPIQAALDAQGWTLTDILLTHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H           +  + G   ++ ++P ID  + +GDT        ++    GHTIGH  
Sbjct: 61  HVDGLEP--LRGSARVIGAAADAHRLPPIDLAVVEGDTITICGEAAQVFDVSGHTIGHFA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            HF     L  GD+L +LGCGR+FE + A+M++S+ K+++  D+T +  GHEYT+ NA F
Sbjct: 119 LHFATSDVLFTGDSLMALGCGRLFEGTPAQMWQSMLKLRALPDETRVCSGHEYTQTNARF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N +L     +V   R++   T PS + +EK+ NPFLR +  +L+    M N+ 
Sbjct: 179 ALTIEPDNSDLISRIEEVTRTRAEKQPTVPSDLGVEKRTNPFLRADVPALQTAFGMTNSD 238

Query: 241 NLAVFTELRIRKNQS 255
              VFTE+R +++  
Sbjct: 239 PTDVFTEIRKKRDNF 253


>gi|146307092|ref|YP_001187557.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina ymp]
 gi|226724007|sp|A4XU09|GLO2_PSEMY RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145575293|gb|ABP84825.1| Hydroxyacylglutathione hydrolase [Pseudomonas mendocina ymp]
          Length = 257

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 130/260 (50%), Gaps = 8/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L   G W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDPISRRCAVVDPGDAAPVLAWLEAHGDWTLSDILITHHHF 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LKK     + GP     KIP  D  L D D  +      +I+A PGHT+GHI
Sbjct: 60  DHVGGVEQLKKATGARVAGPAA--EKIPARDVDLGDNDLIEVLGLRFQIMAVPGHTLGHI 117

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+    + L  GDTLF+ GCGR+FE +  +M +SL ++ +    T +Y  HEYT +N  
Sbjct: 118 AYYHAEQNLLLCGDTLFAGGCGRLFEGTPQQMHQSLSRLAALPGATRVYCTHEYTLSNLR 177

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN- 238
           FA + +PHN ++    ++V   R +   + PS+I LE   NPFLR     + K     + 
Sbjct: 178 FAHAVEPHNPDVSARLAEVSRWRDEGRISLPSSIELELATNPFLRTGEPGVIKAAKRNDE 237

Query: 239 ---ASNLAVFTELRIRKNQS 255
              +   AVF  LR  K++ 
Sbjct: 238 RSSSEPSAVFASLRAWKDRF 257


>gi|241663704|ref|YP_002982064.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
 gi|240865731|gb|ACS63392.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
          Length = 257

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 133/261 (50%), Gaps = 11/261 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L   +  + DN+  ++H+   R    +D  ++  +   L++ G  L  I  THHH D
Sbjct: 1   MLTLR-PLPAFADNYIWVLHDE--RHAWVVDPGESAQVLDYLQKHGLVLQGILLTHHHSD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++     ++GP      IP     L  GD  D      ++I  PGHT GHI 
Sbjct: 58  HVGGVQALRQQTGAAVYGPAG--EPIPEPARRLRQGDRVDVLEQQFEVIDVPGHTAGHIA 115

Query: 121 YH---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           Y      +   L  GDTLFS GCGR+FE +  +M  SL+ + +   +T +   HEYT  N
Sbjct: 116 YFSAACPDGPLLFCGDTLFSGGCGRLFEGTPEQMLASLDTLAALPAQTQVCPAHEYTLAN 175

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-M 236
             FA + +P N  L ++    + +R+Q L T PS + LE+++NPFLR    S+R++L+ +
Sbjct: 176 LRFAQTVEPSNEALARHVRYCEMLRAQGLPTLPSRLGLERQINPFLRSREPSVRQSLSPL 235

Query: 237 ENAS--NLAVFTELRIRKNQS 255
            +AS  ++ VF  LR  KN  
Sbjct: 236 PSASLGDVHVFAALREWKNNF 256


>gi|254429099|ref|ZP_05042806.1| metallo-beta-lactamase superfamily protein [Alcanivorax sp. DG881]
 gi|196195268|gb|EDX90227.1| metallo-beta-lactamase superfamily protein [Alcanivorax sp. DG881]
          Length = 257

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 122/259 (47%), Gaps = 6/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT+  IAI  ++DN+    H         +D  D   + + L E G  L+ +  THHH D
Sbjct: 1   MTASPIAIPAFNDNYIWAFHQQD--QCVVVDPGDAAPVERYLSENGLTLSALLITHHHPD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L +  +  ++GP  ES           D  T         ++A PGHT+GHI 
Sbjct: 59  HVGGIAALIRDRDIPVYGPAAESIPAMSHPLRDGDTLTPAGTDLSFSVMAVPGHTLGHIA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +      +L  GDTLF+ GCGR+FE +  +M  SL ++ +  D T ++  HEYT+ N  F
Sbjct: 119 FINAAQGWLFCGDTLFAGGCGRLFEGTPEQMLHSLRRLAALPDTTQVFCAHEYTQANLTF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA- 239
           A +  P +  +Q     V  +R +   + PST++ EK  NPFLR ++  L+ +       
Sbjct: 179 AAAVTPEDPAVQARLQAVIDLRQKGKISLPSTLAEEKATNPFLRSDDKDLKDSCQRHEPG 238

Query: 240 ---SNLAVFTELRIRKNQS 255
              S++  F  LR  K+  
Sbjct: 239 CGDSDMQCFAALRRWKDNF 257


>gi|260466656|ref|ZP_05812843.1| hydroxyacylglutathione hydrolase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029519|gb|EEW30808.1| hydroxyacylglutathione hydrolase [Mesorhizobium opportunistum
           WSM2075]
          Length = 255

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 146/246 (59%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+ +   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK
Sbjct: 10  CRSDNFGVLVHDPESGQTAIIDAPEEAPILAAVKRTGWTPTMILTTHHHMDHVEANLALK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F   I GP  E +KIPGID  + +      G   I++IATPGHT GH+ YH       
Sbjct: 70  ERFKLRIVGPEAEKAKIPGIDETVEESSVLHLGEERIEVIATPGHTAGHVSYHLPASKVA 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE     M+ SL+K+ +    T IY GHEYT  NA FAL+ DP N 
Sbjct: 130 FTADTLFALGCGRLFECKPPVMYGSLKKLAALPAATVIYCGHEYTLANARFALTVDPTNS 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++++R+ N  T P+TI  E   NPFLR  + ++RK+L ME A +  VF E+R
Sbjct: 190 ALRERAARIEALRADNKPTLPTTIGEELSTNPFLRWHDPAIRKHLGMEKAGDAEVFAEIR 249

Query: 250 IRKNQS 255
            RK+  
Sbjct: 250 KRKDNF 255


>gi|148258776|ref|YP_001243361.1| putative hydroxyacylglutathione hydrolase (glyoxalase II)
           [Bradyrhizobium sp. BTAi1]
 gi|160386192|sp|A5ETG1|GLO2_BRASB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|146410949|gb|ABQ39455.1| putative hydroxyacylglutathione hydrolase (Glyoxalase II)
           [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 141/245 (57%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF  LIH+     TA++DAP+   I + L   GW LT I  THHH DH  A   LK
Sbjct: 10  CLSDNFGYLIHDPATGATASVDAPEAGPIIRQLEAAGWTLTDILITHHHHDHVGAVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + + C +  P ++++ I  +D  +  GD    G    +++ TPGHT+ H+ Y F  D  +
Sbjct: 70  QKYGCRVVAPHDKTTAIADVDLRVGHGDVIKVGELLARVLETPGHTLDHVSYVFDADKAV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ D  N 
Sbjct: 130 FAADTLFSVGCGRVFEGTYPMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVDGDNE 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L+   ++V  +R+ N  T PS +  EK+ N FLR ++ ++   L M+ A+   VF ELR
Sbjct: 190 ALKARAAEVTRLRAANESTIPSLLGDEKQTNVFLRADDPAVAIKLRMKGATAEQVFGELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|119944272|ref|YP_941952.1| hydroxyacylglutathione hydrolase [Psychromonas ingrahamii 37]
 gi|226724011|sp|A1SS88|GLO2_PSYIN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|119862876|gb|ABM02353.1| Hydroxyacylglutathione hydrolase [Psychromonas ingrahamii 37]
          Length = 256

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 83/259 (32%), Positives = 131/259 (50%), Gaps = 7/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++ I I  + DN+  LI + + +    +D  D   +  +L ++   +  I  THHH D
Sbjct: 1   MENV-ITIKAFEDNYIWLIKDSQSQHCIIVDPGDAAPVLTILEDQKLIVDAILLTHHHYD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L    +  I    ++           SD  +F  G   ++++  PGHT+ H+ 
Sbjct: 60  HIGGVDALLSARDEKISIYSKKKLFDRCRLVNESDTLSFFDGKLSLQVMEVPGHTLDHVA 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++  ND  L  GDTLFS GCGR+FE S+ +MF+++ ++    + T +Y  HEYT+NN  F
Sbjct: 120 FY--NDELLFCGDTLFSGGCGRVFEGSFEQMFKAVSRLALLPENTKVYCAHEYTQNNLIF 177

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKNLNM 236
           A   +P N  L  Y  +V   R Q   T PSTI LEK++NPFLR +  ++    + +L  
Sbjct: 178 AHQIEPKNKALLNYIQQVSKKRQQGQPTIPSTIGLEKEINPFLRCQQQTVINKLQSHLGK 237

Query: 237 ENASNLAVFTELRIRKNQS 255
           E    L+ F+ LR  K+  
Sbjct: 238 ELNDPLSCFSALRQYKDNF 256


>gi|329900788|ref|ZP_08272592.1| Hydroxyacylglutathione hydrolase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549377|gb|EGF33945.1| Hydroxyacylglutathione hydrolase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 259

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/261 (31%), Positives = 127/261 (48%), Gaps = 7/261 (2%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L +  I  + DN+  L+H+      A +D  D   I   L      L  I  THHH 
Sbjct: 1   MATLQVLTIPAFDDNYLWLVHDGV--HAAVVDPGDAGPILAALALHQLSLVAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      L +  +  ++GP  E            D          + ++  PGHT GHI
Sbjct: 59  DHVGGVPELLQHASVPVYGPRHEKIPTITHPLVQGDTVVVPELQWQLGVLDVPGHTSGHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y    + +L  GDTLF+ GCGR+FE +  +M  SL+K+ +   +T ++  HEYT  N  
Sbjct: 119 AYFAAAEEWLFCGDTLFAGGCGRLFEGTPEQMDASLQKLAALPGRTSVFCAHEYTMANLR 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+ LQ+   + +  R +++ T PSTI+LE++ NPFLR     +R +L     
Sbjct: 179 FAQAVEPGNVALQERIVREQDKRDRHIPTVPSTIALERETNPFLRWREADIRHSLQQAGK 238

Query: 236 MENASNLAVFTELRIRKNQSK 256
           + + + +A F  LR  KN  +
Sbjct: 239 LGDDTGIAGFAALRAWKNSYR 259


>gi|118485019|gb|ABK94374.1| unknown [Populus trichocarpa]
          Length = 328

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 146/256 (57%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        ID  +   +   L  K   LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDVDTGTVGVIDPSEAAPVIDALSRKNRNLTYILNTHHHYD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + FG H + ++ TPGHT GH+ 
Sbjct: 133 HTGGNEELKARYGAKVIGSGVDRDRIPGIDIVLNDGDNWMFGGHEVLVMETPGHTRGHVS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D T+IY GHEY  +N+ F
Sbjct: 193 FYFPGSGAIFAGDTLFSLSCGKLFEGTPEQMLSSLRKIMSLPDDTNIYCGHEYMLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS DP+N  LQ Y + V  +RS++L T P+ + +EK  NPFLR  +T++R  LN+   A
Sbjct: 253 ALSVDPNNEALQSYAAHVAHLRSKSLPTIPTKLKVEKACNPFLRTSSTAIRHTLNIPATA 312

Query: 240 SNLAVFTELRIRKNQS 255
           ++      +R  K+  
Sbjct: 313 NDSEALGVIRQAKDNF 328


>gi|187929604|ref|YP_001900091.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|309781616|ref|ZP_07676350.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
 gi|187726494|gb|ACD27659.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|308919591|gb|EFP65254.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
          Length = 257

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 133/261 (50%), Gaps = 11/261 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L   +  + DN+  ++H+   R    +D  ++  +   L++ G  L  I  THHH D
Sbjct: 1   MLTLR-PLPAFADNYIWVLHDE--RHAWVVDPGESAQVLDYLQKHGLVLQGILLTHHHSD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++     ++GP      IP     L  GD  D      ++I  PGHT GHI 
Sbjct: 58  HVGGVQALRQQTGAAVYGPAG--EPIPEPARRLRQGDRVDVLEQQFEVIDVPGHTAGHIA 115

Query: 121 YH---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           Y      +   L  GDTLFS GCGR+FE +  +M  SL+ + +   +T +   HEYT  N
Sbjct: 116 YFSAACPDGPLLFCGDTLFSGGCGRLFEGTPEQMLASLDTLAALPAQTQVCPAHEYTLAN 175

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-M 236
             FA + +P N  L ++    + +R+Q L T PS + LE+++NPFLR    S+R++L+ +
Sbjct: 176 LRFAQTVEPSNEALARHVPYCEMLRAQGLPTLPSRLGLERQINPFLRSREPSVRQSLSRL 235

Query: 237 ENAS--NLAVFTELRIRKNQS 255
            +AS  ++ VF  LR  KN  
Sbjct: 236 PSASLGDVHVFAALREWKNNF 256


>gi|33598345|ref|NP_885988.1| hydroxyacylglutathione hydrolase [Bordetella parapertussis 12822]
 gi|33566903|emb|CAE39119.1| probable hydroxyacylglutathione hydrolase [Bordetella
           parapertussis]
          Length = 266

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+   + +      A +D  D   + + LR  G  L  I  THHH DH    
Sbjct: 11  VPLPAFSDNYIWALAHE--GQAAVVDPGDAAPVLRWLRATGATLCAILLTHHHPDHVGGV 68

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
           L L +    T++GP  E+     +     D  T    +  ++++  PGHT GHI Y    
Sbjct: 69  LELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRA 128

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLF+ GCGR+FE + A+M +SLEK+ +    T +   HEYT  N  +AL
Sbjct: 129 AGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWAL 188

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMEN 238
           + +P N  LQ++  + + +R++   T PSTI  E++ NPFLR  + ++            
Sbjct: 189 AVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSL 248

Query: 239 ASNLAVFTELRIRKNQSK 256
           A+ + VF  LR  KN  K
Sbjct: 249 ATPVEVFAALRQWKNNFK 266


>gi|83313291|ref|YP_423555.1| Zn-dependent hydrolase, including glyoxylase [Magnetospirillum
           magneticum AMB-1]
 gi|82948132|dbj|BAE52996.1| Zn-dependent hydrolase, including glyoxylase [Magnetospirillum
           magneticum AMB-1]
          Length = 270

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 99/257 (38%), Positives = 142/257 (55%), Gaps = 2/257 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  + +  I +  DN+  L H      TAAID   +  + + L  +GW LTHI NTHHH 
Sbjct: 14  MAKIIVEQIPVLSDNYVYLAHEPLGGATAAIDPAVSEPVLERLAARGWTLTHILNTHHHG 73

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT ANL+L +   C + G   +S +IPGI   +S+G+TF  G   + ++  PGHT GH+
Sbjct: 74  DHTGANLDLARRTGCAVVGAARDSERIPGITLEVSEGETFMLGHAAVTVLEVPGHTSGHV 133

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y   + H L  GDTLFSLGCGR+FE +  EM+ SL+K++     T  Y  HEYT  N  
Sbjct: 134 AYWLADSHVLFCGDTLFSLGCGRLFEGTAEEMWASLKKLRDLPPDTLAYPAHEYTAGNGR 193

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-N 238
           FA   +  N  L+    +V+ +R+ N  T P  ++ E+  NPFLR +  ++ + + +E  
Sbjct: 194 FARLVERDNGALKARLDEVERLRAHNRPTVPVRLADERAANPFLRADTAAIARAVGLEPG 253

Query: 239 ASNLAVFTELRIRKNQS 255
                VF ELR RK+  
Sbjct: 254 TDPALVFAELRRRKDVF 270


>gi|91223497|ref|ZP_01258762.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           alginolyticus 12G01]
 gi|91191583|gb|EAS77847.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           alginolyticus 12G01]
          Length = 252

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   + + L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAKPVLEFLQANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP +   + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVRAFPNVAVVGPKS-EPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKLTSLPEETQVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N
Sbjct: 176 ALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTSNPDVVQSVASRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|229524239|ref|ZP_04413644.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
 gi|229337820|gb|EEO02837.1| hydroxyacylglutathione hydrolase [Vibrio cholerae bv. albensis
           VL426]
          Length = 252

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  + DN+  LI N   R  A +D      +   L++    L  +  THHH D
Sbjct: 1   MLQIK-SIPAFDDNYIWLIQNRD-RDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDECFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 LDPLTIFTALREWKNEF 252


>gi|307179408|gb|EFN67738.1| Hydroxyacylglutathione hydrolase [Camponotus floridanus]
          Length = 302

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 133/260 (51%), Gaps = 9/260 (3%)

Query: 2   TSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +++ + I     DN+  LI +   +  A +D  D   ++  +++    LT +  THHH D
Sbjct: 46  SNMKVQILPALQDNYMYLIIDEATQEAAVVDPVDPETVAAAVQQNNVKLTKVLTTHHHWD 105

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  L K FN           +I  I+H ++  DTF+ G+  +K +ATP HT GHIC
Sbjct: 106 HAGGNAKLLKSFNDLTIY--GGDDRIEAINHKITHNDTFNIGNLSVKCLATPCHTRGHIC 163

Query: 121 YHFMNDHFL---CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTEN 176
           Y+   +        GDTLF+ GCGR FE +  +M+++ +E + S  ++T +Y GHEYT N
Sbjct: 164 YYVTGEEHPPSVFTGDTLFAGGCGRFFEGTADQMYKALIEILGSLPEETKVYCGHEYTAN 223

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  F L  +P N  +Q+        R+ NL T PSTI  EK  NPF+R+   ++ K+   
Sbjct: 224 NLKFGLHVEPENKAIQQKLDWSHEQRANNLPTVPSTIKDEKLTNPFMRVHEPTVMKHAQQ 283

Query: 237 ENASNLAVFTELRIRKNQSK 256
                +   + LR  K+  K
Sbjct: 284 N--DPIQTMSYLRREKDNFK 301


>gi|159489683|ref|XP_001702826.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158271043|gb|EDO96871.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 261

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 139/258 (53%), Gaps = 8/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYR------LTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + +    DN+  L+H            TA +D  +   + + L  +GW L  + NTHHH 
Sbjct: 4   VRVPCLSDNYVWLLHEAAPAGGSGGGRTAVVDPAEEAPVVEALAARGWSLDAVLNTHHHG 63

Query: 60  DHTRAN-LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT AN    ++F    I GP  +  +IPGID  +  GDT+  G   +++  TPGHT GH
Sbjct: 64  DHTGANLALKRRFPGLVIVGPRADKDRIPGIDVQVGTGDTWHLGGLEVRVFDTPGHTRGH 123

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y       L  GDTLF+LGCGR+FE S  +M+ SL ++    D T +Y  HEYT++NA
Sbjct: 124 ITYWVPQAASLFPGDTLFALGCGRLFEGSPQQMWTSLSQLAPLPDDTLVYCAHEYTQSNA 183

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME- 237
            FA++ DP N  L +  + + + R++   T PS +  EK  NPFLR  + ++R+ L  + 
Sbjct: 184 RFAVTVDPGNAALAQRKAAIDAARARGEPTVPSRLGEEKATNPFLRPHDPAIRQQLGFDA 243

Query: 238 NASNLAVFTELRIRKNQS 255
            A +  VF  +R  K++ 
Sbjct: 244 AAPDWQVFGAIRAAKDRF 261


>gi|15966417|ref|NP_386770.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sinorhizobium meliloti 1021]
 gi|307300546|ref|ZP_07580326.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti BL225C]
 gi|307318411|ref|ZP_07597846.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti AK83]
 gi|81634016|sp|Q92MF8|GLO2_RHIME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|15075688|emb|CAC47243.1| Putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sinorhizobium meliloti 1021]
 gi|306896093|gb|EFN26844.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti AK83]
 gi|306904712|gb|EFN35296.1| hydroxyacylglutathione hydrolase [Sinorhizobium meliloti BL225C]
          Length = 256

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 159/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +L+H+     TA+IDAP+   I   L  +GW LTHI  THHH DH  AN +LK
Sbjct: 11  CRTDNYGVLLHDRLSGATASIDAPEERPILDALERRGWQLTHILTTHHHGDHVAANASLK 70

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  TI GP  E+SKIPGID  +  GD FDF  HP+ +I TPGHT GH+CYH   D  L
Sbjct: 71  ERFGLTIIGPKNEASKIPGIDRTVGHGDRFDFAGHPVDVIETPGHTSGHVCYHLPEDKLL 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE +   M++SL ++ +  D T IYFGHEYT  NA+FA++ DP N 
Sbjct: 131 FAADTLFALGCGRLFEGTADTMWQSLSRLMALPDDTAIYFGHEYTLANAHFAITVDPENS 190

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++  RS   +T P+T+ LEK+ NPFLR  +  +R  L ME AS+ AVF E+R
Sbjct: 191 ALKERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRAGDPKIRALLGMEKASDAAVFAEIR 250

Query: 250 IRKNQS 255
            RK+  
Sbjct: 251 KRKDNF 256


>gi|269966274|ref|ZP_06180363.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio
           alginolyticus 40B]
 gi|269829189|gb|EEZ83434.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio
           alginolyticus 40B]
          Length = 252

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   + + L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAIVDPGDAKPVLEFLQANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP +   + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVRAFPNVAVVGPKS-EPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKLTSLPEETQVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N
Sbjct: 176 ALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTSNPDVVQSVASRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|261211356|ref|ZP_05925644.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
 gi|260839311|gb|EEX65937.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC341]
          Length = 252

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 130/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  +   +   L++    L  I  THHH D
Sbjct: 1   MLQIK-SIPAFNDNYIWLIQNSD-RDCAVVDPGNAEPVLAYLKQHDLNLKAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L                 IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPHTHVVGPAQEPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTASNLSF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK +NPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNHPTLPTTLGREKWINPFLRTQEPSVIRSVANRVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 LDPLTIFTALREWKNEF 252


>gi|15642234|ref|NP_231867.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121586283|ref|ZP_01676073.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           2740-80]
 gi|121726557|ref|ZP_01679806.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V52]
 gi|147673202|ref|YP_001217752.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|153213781|ref|ZP_01948989.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           1587]
 gi|153817113|ref|ZP_01969780.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           NCTC 8457]
 gi|153820855|ref|ZP_01973522.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           B33]
 gi|153825354|ref|ZP_01978021.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-2]
 gi|153829953|ref|ZP_01982620.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           623-39]
 gi|183179464|ref|ZP_02957675.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-3]
 gi|227082360|ref|YP_002810911.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           M66-2]
 gi|229507689|ref|ZP_04397194.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229512116|ref|ZP_04401595.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229519251|ref|ZP_04408694.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229522183|ref|ZP_04411600.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229528760|ref|ZP_04418150.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229607193|ref|YP_002877841.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254286455|ref|ZP_04961412.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           AM-19226]
 gi|254849367|ref|ZP_05238717.1| hydroxyacylglutathione hydrolase GloB [Vibrio cholerae MO10]
 gi|255747066|ref|ZP_05421011.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262161389|ref|ZP_06030499.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262167741|ref|ZP_06035443.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|262192143|ref|ZP_06050304.1| hydroxyacylglutathione hydrolase [Vibrio cholerae CT 5369-93]
 gi|298500389|ref|ZP_07010194.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MAK 757]
 gi|81544528|sp|Q9KPX6|GLO2_VIBCH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|172047617|sp|A5F635|GLO2_VIBC3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798851|sp|C3LPP0|GLO2_VIBCM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|9656795|gb|AAF95380.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121549549|gb|EAX59575.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           2740-80]
 gi|121631010|gb|EAX63389.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V52]
 gi|124115705|gb|EAY34525.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           1587]
 gi|126512381|gb|EAZ74975.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           NCTC 8457]
 gi|126521647|gb|EAZ78870.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           B33]
 gi|146315085|gb|ABQ19624.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|148874588|gb|EDL72723.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           623-39]
 gi|149741038|gb|EDM55107.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-2]
 gi|150423404|gb|EDN15348.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           AM-19226]
 gi|183012875|gb|EDT88175.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           MZO-3]
 gi|227010248|gb|ACP06460.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           M66-2]
 gi|227014132|gb|ACP10342.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio cholerae
           O395]
 gi|229332534|gb|EEN98020.1| hydroxyacylglutathione hydrolase [Vibrio cholerae 12129(1)]
 gi|229341108|gb|EEO06113.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TM 11079-80]
 gi|229343940|gb|EEO08915.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC9]
 gi|229352081|gb|EEO17022.1| hydroxyacylglutathione hydrolase [Vibrio cholerae B33]
 gi|229355194|gb|EEO20115.1| hydroxyacylglutathione hydrolase [Vibrio cholerae BX 330286]
 gi|229369848|gb|ACQ60271.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MJ-1236]
 gi|254845072|gb|EET23486.1| hydroxyacylglutathione hydrolase GloB [Vibrio cholerae MO10]
 gi|255735468|gb|EET90868.1| hydroxyacylglutathione hydrolase [Vibrio cholera CIRS 101]
 gi|262023806|gb|EEY42505.1| hydroxyacylglutathione hydrolase [Vibrio cholerae RC27]
 gi|262028700|gb|EEY47354.1| hydroxyacylglutathione hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262031992|gb|EEY50569.1| hydroxyacylglutathione hydrolase [Vibrio cholerae CT 5369-93]
 gi|297541082|gb|EFH77136.1| hydroxyacylglutathione hydrolase [Vibrio cholerae MAK 757]
 gi|327484754|gb|AEA79161.1| Hydroxyacylglutathione hydrolase [Vibrio cholerae LMA3894-4]
          Length = 252

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  + DN+  LI N   R  A +D      +   L++    L  +  THHH D
Sbjct: 1   MLQIK-SIPAFDDNYIWLIQNRD-RDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 LDPLTIFTALREWKNEF 252


>gi|307153559|ref|YP_003888943.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7822]
 gi|306983787|gb|ADN15668.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7822]
          Length = 257

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 92/261 (35%), Positives = 143/261 (54%), Gaps = 10/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L   +    DN+  L+H+ +  + A +D      + + L+E G  L  IFNTHHH D
Sbjct: 1   MKILR--LPALSDNYIFLLHDPQENIAAVVDPAQPQPVLECLKELGASLVAIFNTHHHQD 58

Query: 61  HTRANLNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           H   N  L + F   T++G  ++  +IPG    L++GD   F     ++   PGHT  HI
Sbjct: 59  HVGGNRELMQHFPDLTVYGGEQDRGRIPGQQVFLTEGDRVKFAHREAEVFFVPGHTKAHI 118

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y+F             GDT+F+ GCGR+FE + A+M +S+ K+++  D T ++  HEYT
Sbjct: 119 AYYFPPTEGQDTGELFCGDTIFAGGCGRLFEGTPAQMVDSIGKLRALPDHTRVWCAHEYT 178

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            NN  FAL+ +P N +LQ   S+V+  RSQ   T PS + +EK  NPFLR ++ +++  +
Sbjct: 179 LNNLKFALTVEPENSDLQNRYSQVQMARSQGEATVPSLLGIEKLTNPFLRWDSPAIQSAM 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
           N ++A  + VF  LR +K+  
Sbjct: 239 NSDDA--VQVFGRLRGKKDHF 257


>gi|13473061|ref|NP_104628.1| putative glyoxalase II [Mesorhizobium loti MAFF303099]
 gi|81779472|sp|Q98G02|GLO2_RHILO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|14023809|dbj|BAB50414.1| putative glyoxalase II [Mesorhizobium loti MAFF303099]
          Length = 255

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 110/246 (44%), Positives = 146/246 (59%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+ K   TA IDAP+   I   ++  GW  T I  THHH+DH  ANL LK
Sbjct: 10  CRSDNFGVLVHDPKSGQTAIIDAPEEAPILAAIKRTGWTPTMILTTHHHMDHVEANLALK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F   I GP  E +KIPGID  + +G     G   I++IATPGHT GH+ YH       
Sbjct: 70  ERFKLRIVGPEAEKAKIPGIDETVEEGSVLHLGDERIEVIATPGHTAGHVSYHLPASKVA 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE     M+ESL K+ +    T IY GHEYT  NA FAL+ DP N 
Sbjct: 130 FTADTLFALGCGRLFECKPPVMYESLRKLAALPAATTIYCGHEYTLANARFALTVDPTNS 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++++R  N  T P+TI  E   NPFLR  + ++RK+L ME A +  VF E+R
Sbjct: 190 ALKERATRIEALRVDNKPTLPTTIGEELSTNPFLRWHDPAIRKHLGMEKAGDAEVFAEIR 249

Query: 250 IRKNQS 255
            RK+  
Sbjct: 250 KRKDNF 255


>gi|261253705|ref|ZP_05946278.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
 gi|260937096|gb|EEX93085.1| hydroxyacylglutathione hydrolase [Vibrio orientalis CIP 102891]
          Length = 252

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 132/257 (51%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LI N   R  A +D  D   +   L E    L  I  THHH D
Sbjct: 1   MLNIK-SIPAFNDNYIWLIENSD-RRCAVVDPGDAKPVLDYLAEHDLSLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F             +P + H +  GD  +       ++   GHT+GHI 
Sbjct: 59  HIGGIAELVRQFPNIDVVGPAN-EPVPTLTHAVETGDQIELFDEVFFVLGLEGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DSKLFCGDVLFSAGCGRVFEGTMEQMHTSLSKLAALPEETQVFCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +LQ+Y  +V  +R+QN  T PS+I  EK +NPFLR +  ++ +++      
Sbjct: 176 ALAVEPDNEQLQQYRDEVNRLRAQNKPTLPSSIRREKWINPFLRTDQPTVMRSVANRTSE 235

Query: 239 ASNLAVFTELRIRKNQS 255
             +L++FT LR  KN+ 
Sbjct: 236 TDSLSIFTALREWKNEF 252


>gi|126734141|ref|ZP_01749888.1| Hydroxyacylglutathione hydrolase [Roseobacter sp. CCS2]
 gi|126717007|gb|EBA13871.1| Hydroxyacylglutathione hydrolase [Roseobacter sp. CCS2]
          Length = 257

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 85/250 (34%), Positives = 137/250 (54%), Gaps = 2/250 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LIHN +   TA +DAP+   I   L  +GW LT I  THHH DH    
Sbjct: 10  VVVPCLRDNYAFLIHNAETDETALVDAPEAEPIQAELNARGWTLTDILITHHHNDHIDGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
                  +  + G   ++ ++P +D  +++G+         ++    GHT+GHI +H   
Sbjct: 70  DA--LRGDARVIGAEADAHRLPDLDLAVTEGNQITVCGQQTEVFDVSGHTVGHIAFHMPA 127

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGR+FE + A+M++SL+K+++  D T +  GHEYT  NA FA S D
Sbjct: 128 AQLVFTADSLMALGCGRLFEGTPAQMWDSLQKLRALPDDTLVCSGHEYTAANARFAASLD 187

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L     +++  R+    T PST++ EK+ NPFLR +    +  ++M +AS + VF
Sbjct: 188 PDNSDLISRIKRIEMARAAGQLTVPSTLTEEKRTNPFLRADVPEFKAAIDMSDASAVDVF 247

Query: 246 TELRIRKNQS 255
           T  R +K++ 
Sbjct: 248 TYTRAQKDKF 257


>gi|217970692|ref|YP_002355926.1| hydroxyacylglutathione hydrolase [Thauera sp. MZ1T]
 gi|217508019|gb|ACK55030.1| hydroxyacylglutathione hydrolase [Thauera sp. MZ1T]
          Length = 257

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 77/256 (30%), Positives = 123/256 (48%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  L+H+   R    +D  D   + + LRE G  L  I  THHH DHT   
Sbjct: 4   IPVPAFRDNYIWLVHD--GRHALVVDPGDATPVEEALREHGLVLGAILVTHHHPDHTGGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L       ++GP  ES           D       +  ++++  PGHT GH+ Y  M+
Sbjct: 62  AALVASHRVPVYGPARESIAGVVHAVSDGDEIHLPAPAIALRVLDVPGHTAGHVAYVGMD 121

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                +  GDTLFS GCGR+FE +  ++  SL ++ +    T ++  HEYT +N  FA +
Sbjct: 122 IEPGLVFCGDTLFSAGCGRLFEGTPTQLEHSLARLAALPPDTRVFCTHEYTLSNLAFARA 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN-- 241
            +P N+E   + +  +++R++   T PST+S E  +NPFLR +   + + +     S   
Sbjct: 182 AEPENVERDAWAAHCETLRARGEPTLPSTVSRELAINPFLRCDQPGVIEAVAAHTGSRPQ 241

Query: 242 --LAVFTELRIRKNQS 255
             L     LR  K++ 
Sbjct: 242 DALECLAALRAWKDRF 257


>gi|229513879|ref|ZP_04403341.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
 gi|229349060|gb|EEO14017.1| hydroxyacylglutathione hydrolase [Vibrio cholerae TMA 21]
          Length = 252

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  + DN+  LI N   R  A +D      +   L++    L  +  THHH D
Sbjct: 1   MLQIK-SIPAFDDNYIWLIQNRD-RDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 QDPLTIFTALREWKNEF 252


>gi|75674571|ref|YP_316992.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
 gi|123614205|sp|Q3SVQ1|GLO2_NITWN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|74419441|gb|ABA03640.1| beta-lactamase-like protein [Nitrobacter winogradskyi Nb-255]
          Length = 255

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 148/245 (60%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     TAAIDAP+   + + L  +GW LT I  THHH DH      LK
Sbjct: 10  CLTDNFGVLIHDPATGATAAIDAPEAEPVIQALDREGWVLTDILITHHHSDHVGGVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + + C +  P + S++I  +D  +  GD    G+   +++ TPGHT+ H+ Y F ++  +
Sbjct: 70  RKYACRVVAPHDRSAEIANVDLRVGQGDIIKVGTLLGRVLETPGHTLDHVSYVFDDEKVV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE +Y  M++SL K+++  D   +Y GHEYT++N  FAL+ +P+N 
Sbjct: 130 FAADTLFSIGCGRVFEGTYPMMWDSLLKLRALPDSFRLYCGHEYTDSNIKFALTIEPNNP 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L+    +V  +R++   T P+ +  EKK N FLR ++ ++   ++M+ AS + VF ELR
Sbjct: 190 VLKARAEEVTRLRAEGRPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGVEVFAELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|254228409|ref|ZP_04921835.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|262393543|ref|YP_003285397.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
 gi|151938997|gb|EDN57829.1| Zn-dependent hydrolases, including glyoxylases [Vibrio sp. Ex25]
 gi|262337137|gb|ACY50932.1| hydroxyacylglutathione hydrolase [Vibrio sp. Ex25]
          Length = 252

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   + + L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAKPVLEYLQANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP +   + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVRAFPEVAVVGPKS-EPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL K+ S  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTPEQMFESLNKLTSLPEETQVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L++Y   V  +R+ N+ T P+TI  EK +NPFLR  N  + +++   ++N
Sbjct: 176 ALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTIRKEKWINPFLRTTNPDVVQSVASRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|114769423|ref|ZP_01447049.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [alpha proteobacterium HTCC2255]
 gi|114550340|gb|EAU53221.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [alpha proteobacterium HTCC2255]
          Length = 255

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 95/255 (37%), Positives = 139/255 (54%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   I +    DN+  LI   +   TA ID PD Y I  M+ E GW L  I  THHH D
Sbjct: 1   MSLSVIIVPCLIDNYAYLIRCEETGHTAVIDVPDAYPILNMINELGWKLNSILITHHHSD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+K     + G   +S ++P ++  +S GD    G+   +I+ TPGHTIGHI 
Sbjct: 61  HVDGVEQLQKLTGANVIGAKSDSHRLPNLNISVSTGDVISIGNQQAEILNTPGHTIGHIS 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y F +   +  GD+L SLGCGR+FE ++  M+ +L+       +T +Y GHEY+ +NA F
Sbjct: 121 YFFKDSKKVFTGDSLMSLGCGRLFEGTHKMMWNTLKLFMKLPKETLVYSGHEYSYSNAKF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS D  N  L++Y  +++ +   N YT P+++ LE  +NPFLR      +  L+M   +
Sbjct: 181 ALSVDSSNTRLKEYYKEIQDLLKDNKYTVPTSLELEFAINPFLRSALPEFKLGLDMCQKT 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF  LRI K+  
Sbjct: 241 DHEVFQYLRILKDNF 255


>gi|260775263|ref|ZP_05884160.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608444|gb|EEX34609.1| hydroxyacylglutathione hydrolase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 252

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 132/257 (51%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L++    L  I  THHH D
Sbjct: 1   MLDIK-SIPAFNDNYIWLIKNSDQR-CAVVDPGDAAPVLEYLKQHELSLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F             +P + H +  G+  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPGVDVVGPAN-EPVPTLTHAVEAGEQIELFGEIFFVLGLEGHTRGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +M  SL K+ +  ++T +Y  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMHTSLNKLVALPEETEVYCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  LQ+Y  +V  +R+QN  T P+TI  EK +NPFLR +  S+ +++    + 
Sbjct: 176 ALAVEPDNELLQQYRDEVNRLRAQNKPTLPTTIRKEKWINPFLRTDQQSVIRSVANRTQQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
             +LA+F+ LR  KN+ 
Sbjct: 236 TDSLAIFSALREWKNEF 252


>gi|332019079|gb|EGI59609.1| Hydroxyacylglutathione hydrolase, mitochondrial [Acromyrmex
           echinatior]
          Length = 299

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/259 (33%), Positives = 136/259 (52%), Gaps = 8/259 (3%)

Query: 2   TSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +++ I I     DN+  LI + + +  A +D  D   ++  +++    LT +  THHH D
Sbjct: 44  SNMKIQILPALQDNYMYLIIDEETQEAAIVDPVDPEAVTAAVQQNDVKLTKVLTTHHHWD 103

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  L K F   +        +I  I+  +   DTF+ G+  +K +ATP HT GHIC
Sbjct: 104 HAGGNAKLSKSFADLVIY--GGDDRIEAINRKIMHNDTFNIGNLSVKCLATPCHTRGHIC 161

Query: 121 YHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
           Y+   +       GDTLF+ GCG+ FE +  +M+++ +E + S  ++T +Y GHEYT NN
Sbjct: 162 YYVTGEGQHSVFTGDTLFAGGCGKFFEGTADQMYKALIEILGSLPEETKVYCGHEYTVNN 221

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             F L  +P N+ +Q+   +V   R+ NL T PSTI  EK  NPF+R+   S+ K++   
Sbjct: 222 LKFGLHVEPENVAIQQKLDQVHIQRANNLPTVPSTIKDEKLTNPFMRVHEPSVMKHVRQN 281

Query: 238 NASNLAVFTELRIRKNQSK 256
               +   + LR  K+  K
Sbjct: 282 --DPIQTMSHLRREKDNFK 298


>gi|297580878|ref|ZP_06942803.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297534704|gb|EFH73540.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 252

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  + DN+  LI N   R  A +D      +   L++    L  +  THHH D
Sbjct: 1   MLQIK-SIPAFDDNYIWLIQNRD-RDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  F
Sbjct: 118 YIG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAGNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 LDPLTIFTALREWKNEF 252


>gi|186475635|ref|YP_001857105.1| hydroxyacylglutathione hydrolase [Burkholderia phymatum STM815]
 gi|184192094|gb|ACC70059.1| hydroxyacylglutathione hydrolase [Burkholderia phymatum STM815]
          Length = 267

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 84/269 (31%), Positives = 135/269 (50%), Gaps = 15/269 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M SL  + +  + DN+  ++ +        +D  D   +   L ++GW L+ I  THHH 
Sbjct: 1   MNSLEYVPVPAFDDNYIWVVSD--GHHAVVVDPGDAAPVKAYLAKRGWRLSAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH     +L    + +     +GP  E+           D       S    I+  PGHT
Sbjct: 59  DHVGGVADLLNGQDASQALPVYGPAGEAIPWLTERLVQGDTVHIAAPSLTFTILDVPGHT 118

Query: 116 IGHICYHFMND----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
            GHI Y    D      +  GDTLF+ GCGR+FE + A+M ESL+ + +   +T ++  H
Sbjct: 119 RGHIAYFQAADSRGTPHVFCGDTLFACGCGRLFEGTPAQMLESLDALAALPGETEVHCAH 178

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT +N  FAL+C+P N  L+ +  +  ++R++++ T P+TI+ E+ VNPFLR    S++
Sbjct: 179 EYTLSNIRFALACEPDNPVLRAWRDEAAALRARHMPTLPTTIAHERAVNPFLRAGEASVQ 238

Query: 232 ----KNLNMENASNLAVFTELRIRKNQSK 256
               + L+      LA FT +R  KN+ +
Sbjct: 239 STLAEQLHESVPDRLAAFTLMREWKNRFR 267


>gi|253999160|ref|YP_003051223.1| hydroxyacylglutathione hydrolase [Methylovorus sp. SIP3-4]
 gi|253985839|gb|ACT50696.1| hydroxyacylglutathione hydrolase [Methylovorus sp. SIP3-4]
          Length = 250

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/250 (33%), Positives = 128/250 (51%), Gaps = 4/250 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  ++H   +   A +D  D   + + L   G  L  I  THHH DH    
Sbjct: 5   IPIQAFSDNYIWMLH--AHGQAAVVDPGDAEPVLQQLAASGLQLQTILITHHHNDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+      ++ P  E+           D    DF    + ++  PGHT+GH+ Y+   
Sbjct: 63  ERLQHETGARVYAPARENYAFTHQPVHEGDQIELDFLPLSLTVLEVPGHTLGHVAYYG-- 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE + A+M +SL K+ +   +T +Y  HEYTE+N  FA   D
Sbjct: 121 AKLLFCGDTLFSAGCGRLFEGTPAQMLDSLNKLAALPAETAVYCTHEYTEHNLKFARQLD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L    ++V  +R Q L + PST+++E++ NPFLR  + ++++   +  A+ L VF
Sbjct: 181 PTNTALLARQAQVAQLRQQGLPSLPSTLAIERESNPFLRCASPAIQQASGIHEANPLVVF 240

Query: 246 TELRIRKNQS 255
           T +R  +N  
Sbjct: 241 TAIREMRNHF 250


>gi|332529403|ref|ZP_08405364.1| hydroxyacylglutathione hydrolase [Hylemonella gracilis ATCC 19624]
 gi|332041201|gb|EGI77566.1| hydroxyacylglutathione hydrolase [Hylemonella gracilis ATCC 19624]
          Length = 265

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/271 (28%), Positives = 126/271 (46%), Gaps = 21/271 (7%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT L   +    DN+  L+H+ +      +D  +   +   LR +   L  I  THHH D
Sbjct: 1   MTLL--PLPALTDNYIWLLHDEQ--HAIVVDPAEAAPVLDTLRARRLTLRAILVTHHHTD 56

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+      ++GP     ++P     +S+GD  +      +++  PGHT GHI 
Sbjct: 57  HVGGVPELRDATGAAVYGPAS--EEMPEPITRVSEGDAVELLGLRFEVLDVPGHTAGHIA 114

Query: 121 YHFM-------NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           ++             L  GDTLFS GCGRIFE + A+M  SL+K+      T +   HEY
Sbjct: 115 WYCAEATALGAPSPLLFCGDTLFSGGCGRIFEGTPAQMLASLDKLNRLPAATRVCCAHEY 174

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FA + +P N  L++Y    +++R++   T PST++ E+ +NPF R     + + 
Sbjct: 175 TLSNLRFARAVEPANEALRQYSLDCEALRARGEPTLPSTLARERAINPFFRSRQPDVAQA 234

Query: 234 LNME--------NASNLAVFTELRIRKNQSK 256
           +             + +  F  LR  KN+ +
Sbjct: 235 VARTAGHALTGMQPAEVETFAALRQWKNEFR 265


>gi|238026774|ref|YP_002911005.1| hydroxyacylglutathione hydrolase [Burkholderia glumae BGR1]
 gi|237875968|gb|ACR28301.1| Hydroxyacylglutathione hydrolase [Burkholderia glumae BGR1]
          Length = 268

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/270 (30%), Positives = 128/270 (47%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +       A+D  D   + + L  +GW L  I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSDGS--DAVAVDPGDAAPVRRYLDARGWRLAAILLTHHHA 58

Query: 60  DHTRAN----LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH           ++     ++GP  E+                   +   +++  PGHT
Sbjct: 59  DHVGGVSALVGEREQIMPVPVYGPAGEAIAQVTQPLAGGARVRIGKPALEFEVLDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE +  +M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQAAGAGHPAPHLFCGDTLFSCGCGRLFEGTPEQMLNSLDALAALPGDTQVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + ++ R++   T P+TI+ E+ VNPFLR ++ ++
Sbjct: 179 HEYTLSNIRFALACEPDNAALAAWRDRAEACRARGEPTLPTTIAHERAVNPFLRADSAAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E     AS LA FT LR  KN+ +
Sbjct: 239 AATLEAELHEAPASRLAAFTLLREWKNRFR 268


>gi|84514771|ref|ZP_01002134.1| hydroxyacylglutathione hydrolase, putative [Loktanella
           vestfoldensis SKA53]
 gi|84510930|gb|EAQ07384.1| hydroxyacylglutathione hydrolase, putative [Loktanella
           vestfoldensis SKA53]
          Length = 258

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/250 (34%), Positives = 144/250 (57%), Gaps = 2/250 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  ++HN     T  IDAP+   I  +L ++GW LT I  THHH DH    
Sbjct: 11  VTVPCLRDNYAFVLHNAVTEQTVLIDAPEASPIKAVLAQRGWQLTDILLTHHHDDHVGGL 70

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +     +  + G   ++ ++P +D  +++GD          +I  PGHTIGHI +H  +
Sbjct: 71  QS--LRGDARVIGARADAHRLPPLDLAVAEGDLLHICGQATHVIDVPGHTIGHIAFHMPD 128

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +  GD+L +LGCGR+FE + A+M+ESL K+++   +T +  GHEYTE+NA FA+S D
Sbjct: 129 AGLVFTGDSLMALGCGRLFEGTPAQMWESLLKLRALPQQTMVCSGHEYTESNARFAVSLD 188

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N +L+     +++ R+    T PS +  E++ NPFLR ++  L+ +L M+N  ++ VF
Sbjct: 189 PDNADLRLRIKTIETARAAGRPTVPSGLDEERRTNPFLRADDAGLKAHLGMQNQPDVDVF 248

Query: 246 TELRIRKNQS 255
            ++R  K++ 
Sbjct: 249 AQIRASKDRF 258


>gi|269960614|ref|ZP_06174986.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio harveyi
           1DA3]
 gi|269834691|gb|EEZ88778.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio harveyi
           1DA3]
          Length = 252

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 134/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   + + L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAKPVLEYLKANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L   F        +    IP + + + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVHAFPHVSVVGPKA-EPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  F
Sbjct: 118 Y--AGDGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + K++   +EN
Sbjct: 176 ALAVEPDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIKSVTNRIEN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|28899069|ref|NP_798674.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153839746|ref|ZP_01992413.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ3810]
 gi|260366045|ref|ZP_05778517.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus K5030]
 gi|260876849|ref|ZP_05889204.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|260897330|ref|ZP_05905826.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|81727122|sp|Q87MG0|GLO2_VIBPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|28807293|dbj|BAC60558.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149746730|gb|EDM57718.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ3810]
 gi|308088245|gb|EFO37940.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|308091380|gb|EFO41075.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|308115293|gb|EFO52833.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus K5030]
 gi|328474394|gb|EGF45199.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus 10329]
          Length = 252

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 136/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   +   L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAQPVLDYLQANELTLEAILVTHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP +   + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVRAFPHVTVVGPKA-EPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL KI +  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DSKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIAALPEETQVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L++Y   V  +R+ N+ T P+T+  EK +NPFLR  N  + K++   ++N
Sbjct: 176 ALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTLRKEKWINPFLRTTNPDVVKSVANRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|254225773|ref|ZP_04919378.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V51]
 gi|125621679|gb|EAZ50008.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio cholerae
           V51]
          Length = 252

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 127/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  + DN+  LI N   R  A +D      +   L++    L  +  THHH D
Sbjct: 1   MLQIK-SIPAFDDNYIWLIQNRD-RDCAVVDPGSAEPVLAYLKQHDLNLKAVLITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ S  ++T +Y  HEYT  N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLSLPEETQVYSAHEYTAANVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y   V  +R+QN  T P+T+  EK VNPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDDVSRLRAQNQPTLPTTLGREKWVNPFLRTQEPSVIRSVASQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 LDPLTIFTALREWKNEF 252


>gi|163801801|ref|ZP_02195698.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio sp. AND4]
 gi|159174309|gb|EDP59113.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio sp. AND4]
          Length = 252

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 134/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   +   L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KQCAVVDPGDAKPVLAYLQANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP + + + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVSDLVRAFPHVSVVGPKT-EPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + +++   ++N
Sbjct: 176 ALAVEPDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIQSVTNRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|260899806|ref|ZP_05908201.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ4037]
 gi|308107251|gb|EFO44791.1| hydroxyacylglutathione hydrolase [Vibrio parahaemolyticus AQ4037]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 136/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   +   L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAQPVLDYLQANELTLEAILVTHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP +   + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPDLVRAFPHVTVVGPKA-EPIPTLTTPMEEGDKLELFGEIFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MF+SL KI +  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DSKLFCGDVLFSAGCGRIFEGTPEQMFDSLSKIAALPEETQVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L++Y   V  +R+ N+ T P+T+  EK +NPFLR  N  + K++   ++N
Sbjct: 176 ALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTLRKEKWINPFLRTTNPDVVKSVANRIKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|91775834|ref|YP_545590.1| hydroxyacylglutathione hydrolase [Methylobacillus flagellatus KT]
 gi|122985520|sp|Q1H188|GLO2_METFK RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91709821|gb|ABE49749.1| Hydroxyacylglutathione hydrolase [Methylobacillus flagellatus KT]
          Length = 250

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 81/255 (31%), Positives = 126/255 (49%), Gaps = 5/255 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + I I  + DN+  L+H  ++     +D  D + + ++L  +G  L  I  THHH D
Sbjct: 1   MFEI-IPILAFEDNYIWLLH--QHGHALVVDPGDAHPVLEILDARGLQLRAILVTHHHQD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L +  +  +F P +E    P       D       +  + ++  PGHT+GH+ 
Sbjct: 58  HTGGVEELIQATSAQVFAPAKEQFSFPHHPVTAGDRLDIPGIALSLSVLDVPGHTVGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+   D  L  GDTLF  GCGR+FE +  +M+ SL+++      T +Y GHEYTE N  F
Sbjct: 118 YYG--DGMLFSGDTLFGAGCGRLFEGTPGQMYSSLQQLAQLPVNTRVYCGHEYTERNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +PH+  L        ++R+Q L + PS+++LE   NPFLR     +          
Sbjct: 176 ALSLEPHHEALLSRREATAALRAQGLPSLPSSMALELATNPFLRCHEPGIIAASKSAATD 235

Query: 241 NLAVFTELRIRKNQS 255
            ++VF  +R  +N  
Sbjct: 236 PVSVFAAIREMRNHF 250


>gi|262404572|ref|ZP_06081127.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
 gi|262349604|gb|EEY98742.1| hydroxyacylglutathione hydrolase [Vibrio sp. RC586]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 127/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  L+ N   R  A +D      +   L++    L  I  THHH D
Sbjct: 1   MLQIK-SIPAFNDNYIWLLQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L       I         IP + H + DGD  +       ++   GHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPEIHVVGPAQEPIPTLTHPVEDGDQIELFDERFLVLGLSGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ +   +T +Y  HEYT  N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLTLPQETLVYSAHEYTAANVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T P+T+  EK +NPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGREKWINPFLRTQEPSVIRSVANQVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN+ 
Sbjct: 236 QDPLTIFTALREWKNEF 252


>gi|156975482|ref|YP_001446389.1| hydroxyacylglutathione hydrolase [Vibrio harveyi ATCC BAA-1116]
 gi|171769915|sp|A7MY07|GLO2_VIBHB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|156527076|gb|ABU72162.1| hypothetical protein VIBHAR_03213 [Vibrio harveyi ATCC BAA-1116]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 135/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D   + + L+     L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSD-KRCAVVDPGDAKPVLEYLQANELTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP + + + +GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVSDLVRAFPHVSVVGPKA-EPIPTLTNAMEEGDKLELFGEIFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MFESL KI    ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTPEQMFESLSKIMKLPEETEVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  L++Y   V  +R  N+ T P+T+  EK +NPFLR  N  + +++   +EN
Sbjct: 176 ALAVEPDNEHLRQYRDDVNRLRGLNIPTIPTTLRKEKLINPFLRATNAEVIQSVTNRIEN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +   +VFT LR  KN+ 
Sbjct: 236 SDPCSVFTALREWKNEF 252


>gi|115891513|ref|XP_783848.2| PREDICTED: similar to hydroxyacyl glutathione hydrolase
           [Strongylocentrotus purpuratus]
 gi|115949376|ref|XP_001191822.1| PREDICTED: similar to hydroxyacyl glutathione hydrolase
           [Strongylocentrotus purpuratus]
          Length = 258

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 84/259 (32%), Positives = 134/259 (51%), Gaps = 10/259 (3%)

Query: 4   LNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + I + S   DN+  L+ +   +  A +D  D   + K ++E+G  LT +  THHH DH 
Sbjct: 1   MKITLLSALEDNYMYLLTDEATKEAAIVDPVDPEKVLKAVQEEGVNLTTVLTTHHHWDHA 60

Query: 63  RANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             N  L K  +           +I  ++  +  GD F  G+  ++ + TP HT GHICY 
Sbjct: 61  GGNEKLVKLTSGLTVC--GGDDRIGALNKKVGHGDEFKVGNLQVRCLFTPCHTTGHICYF 118

Query: 123 FMND----HFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
              D      +  GDTLF  GCGR FE +  +M+ + +EK+    D T+++ GHEY+ ++
Sbjct: 119 VQGDPSEAPVVFTGDTLFLSGCGRFFEGTPDQMYAALIEKLSKLPDNTNVFCGHEYSVSS 178

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FALS +P N+ +QK     K  R++ L T PST++ EK  NPF+R+   S++ ++   
Sbjct: 179 LSFALSVEPDNVSIQKKLEWAKDQRAKKLPTIPSTLAEEKAYNPFMRVGAKSIQDHVG-- 236

Query: 238 NASNLAVFTELRIRKNQSK 256
           +   + V   LR  K+  K
Sbjct: 237 STEPIEVMGRLRKEKDNFK 255


>gi|90581655|ref|ZP_01237444.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio angustum
           S14]
 gi|90437139|gb|EAS62341.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio angustum
           S14]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 95/257 (36%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LIHN        +D  D   + + + + G+ L  I  THHH D
Sbjct: 1   MLTVK-SIPAFNDNYIWLIHNKD-NHCVVVDPGDATPVLETIDKFGFTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ F  T          IPG+   + DGD  D       +++ PGHT+GH+ 
Sbjct: 59  HIGGISELKRRFPSTKVVGPVN-EPIPGLTQPVEDGDQVDIFGERFMVLSVPGHTLGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS GCGR+FE + A+MF+SL+KI S  D+T ++  HEYT +N  F
Sbjct: 118 YVG--DEKLFCGDTLFSAGCGRLFEGTPAQMFDSLQKIASLPDETEVFCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQ+Y  KV  +R+    T PST+S EK++NPFLR +  S+++++  +  +
Sbjct: 176 ALVAEQDNPHLQQYRDKVIRLRANGKSTLPSTLSQEKRINPFLRCDQPSIKRSVADKAYD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K++ 
Sbjct: 236 NSDLETFAALRRWKDKF 252


>gi|223995371|ref|XP_002287369.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
 gi|220976485|gb|EED94812.1| hydroxyacylglutathione hydrolase [Thalassiosira pseudonana
           CCMP1335]
          Length = 269

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 98/250 (39%), Positives = 142/250 (56%), Gaps = 4/250 (1%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  LIH+ K + TAAID P        L  +GW LTHIFNTHHH DH   N  +
Sbjct: 21  PCLGDNYGYLIHDPKTKQTAAIDTPSGQAYKDELERRGWKLTHIFNTHHHHDHVGGN--M 78

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           +   +           +IPG+D  L + DTF FG    ++I   GHT GHI ++F N+  
Sbjct: 79  ELKTDGVTVYGPAADGRIPGMDVALKENDTFSFGGTEARVIDVGGHTSGHIAFYFPNEKT 138

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD+LF+LGCGR+FE +  + + SL++++   D T IY  HEYTE NA FA+S +P N
Sbjct: 139 AFVGDSLFALGCGRMFEGTPTQFWASLQRLRGLPDDTTIYCAHEYTEGNAKFAMSVEPGN 198

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE-NTSLRKNLNMENASN-LAVFT 246
            +L K   ++K+ R++   T PS +  EK  NPFLR + +  +RKN+   +  +   VF 
Sbjct: 199 ADLVKRVEEIKAKRARGEPTVPSLMKEEKLTNPFLRGDVSREIRKNVGASDEESGADVFA 258

Query: 247 ELRIRKNQSK 256
           ++R  K+  +
Sbjct: 259 KIRRGKDNFR 268


>gi|260824575|ref|XP_002607243.1| hypothetical protein BRAFLDRAFT_104472 [Branchiostoma floridae]
 gi|229292589|gb|EEN63253.1| hypothetical protein BRAFLDRAFT_104472 [Branchiostoma floridae]
          Length = 602

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 126/254 (49%), Gaps = 9/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ +   +  A +D  +   +   ++E+   LT +  THHH DH+  N  
Sbjct: 349 LPALQDNYMYLLVDETTKEAAIVDPVEPDKVVAAVKEEDVKLTTVLTTHHHWDHSGGNEQ 408

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L K  +           +I  ++  +  GD F  G+  +K + TP HT GHICY+     
Sbjct: 409 LAKMVSGLTVC--GGDDRIGALNKKVGHGDQFKVGALNVKCLFTPCHTSGHICYYVTGEE 466

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             D  +  GDTLF  GCGR FE +   M+++ +E +     +T +Y GHEYT NN  +A 
Sbjct: 467 GEDPAVFTGDTLFVAGCGRFFEGTPDNMYKALVEILGILPQQTKVYCGHEYTVNNLKYAE 526

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
             +P N  +Q   +  KS R +N  T PSTI  E K NPF+R++ + ++++     +  +
Sbjct: 527 RVEPDNPAVQDKLAWAKSKRDKNQATVPSTIGDELKFNPFMRVKESPVQQHAG--TSDPV 584

Query: 243 AVFTELRIRKNQSK 256
           A    +R  K+  K
Sbjct: 585 ATMGFIRNEKDNFK 598


>gi|258627372|ref|ZP_05722156.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM603]
 gi|258580410|gb|EEW05375.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM603]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D      +   L++    L  I  THHH D
Sbjct: 1   MLQIK-SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L                 IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPHTHVVGPAHEPIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MF SL K+ +  ++T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN  
Sbjct: 236 LDPLTIFTALREWKNDF 252


>gi|90420227|ref|ZP_01228135.1| hydroxyacylglutathione hydrolase (Glyoxalase II) [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335561|gb|EAS49311.1| hydroxyacylglutathione hydrolase (Glyoxalase II) [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 324

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 108/254 (42%), Positives = 147/254 (57%), Gaps = 1/254 (0%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S+ I       DNF +L+H+     T AIDAP+   I   L   GW LTHI  THHH 
Sbjct: 69  MASIEIRQFGCRSDNFGVLVHDKDTGTTIAIDAPEEQPILDALEATGWTLTHILTTHHHG 128

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  AN  LK  F   I GP +E  +IPGID   S GDT D G   ++ I TPGHT+G +
Sbjct: 129 DHVEANEALKARFQVEIIGPAKERDRIPGIDRTASGGDTLDVGGIRVEAIDTPGHTLGEV 188

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+  +   L   D LFSLGCGR+FE   A M++SL+++++  D T +Y GHEYT  NA 
Sbjct: 189 SYYMPDAKALFAADALFSLGCGRLFEGDAAMMWDSLQRLRALPDDTMLYCGHEYTATNAR 248

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
            A+  DP NL LQ+   +V+ +R +   T P ++  EKK NPFLR ++  L+  + ME+A
Sbjct: 249 CAIDIDPQNLALQERVKEVEHLRVEGKPTLPVSLGREKKTNPFLRADDPELKAAMGMEDA 308

Query: 240 SNLAVFTELRIRKN 253
               VF  +R +++
Sbjct: 309 QPAEVFAAIRKKRD 322


>gi|197335822|ref|YP_002156767.1| hydroxyacylglutathione hydrolase [Vibrio fischeri MJ11]
 gi|226724035|sp|B5F9V3|GLO2_VIBFM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|197317312|gb|ACH66759.1| hydroxyacylglutathione hydrolase [Vibrio fischeri MJ11]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 138/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+  +I  ++DN+  LIHN+       +D  D   + + ++E  + L  I  THHH D
Sbjct: 1   MLSVK-SIPAFNDNYIWLIHNND-NHCVVVDPGDATPVLECIKEHDFILDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        E    IP + H + DGD  +       ++  PGHT GH+ 
Sbjct: 59  HIGGVPELVRQFPSVNVVGPEN-EPIPTLTHPVGDGDFVELFDEQFMVLGVPGHTNGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  F
Sbjct: 118 YVG--DEKLFCGDALFSAGCGRLFEGTAEQMFNSLQKMAALPDETEVYCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  L +Y  KV  +R+    T PST+  EK +NPFLR    +++K++   +++
Sbjct: 176 ALAVEPDNDYLLRYREKVLHLRAHGKSTIPSTLQREKLINPFLRTSEANVKKSVASKVQD 235

Query: 239 ASNLAVFTELRIRKNQS 255
           ++ + +FT LR  K++ 
Sbjct: 236 STEVEIFTALRRWKDEF 252


>gi|89075028|ref|ZP_01161473.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium sp.
           SKA34]
 gi|89049267|gb|EAR54831.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium sp.
           SKA34]
          Length = 252

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LIHN        +D  D   + + + + G+ L  I  THHH D
Sbjct: 1   MLTVK-SIPAFNDNYIWLIHNKD-NHCVVVDPGDATPVLETIDKFGFTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ F  T          IPG+   + DGD  D       +++ PGHT+GH+ 
Sbjct: 59  HIGGISELKRRFPSTKVVGPVN-EPIPGLTQPVEDGDQVDIFGERFMVLSVPGHTLGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS GCGR+FE + A+MF SL+KI +  D+T ++  HEYT +N  F
Sbjct: 118 YVG--DEKLFCGDTLFSAGCGRLFEGTPAQMFNSLQKIATLPDETEVFCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQ+Y  KV  +R+    T PST+S EK++NPFLR +  S+++++  +  +
Sbjct: 176 ALVAEQGNPHLQQYRDKVIRLRANGKSTLPSTLSQEKRINPFLRCDQPSIKRSVADKAYD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K++ 
Sbjct: 236 NSDLETFAALRRWKDKF 252


>gi|325527248|gb|EGD04627.1| hydroxyacylglutathione hydrolase [Burkholderia sp. TJI49]
          Length = 268

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 134/270 (49%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNC----TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +           T    +    ++  PGHT
Sbjct: 59  DHVGGVEALRAGQPDDLPLPVYGPAAEAIGVVTQPLAGGARVTLAAPAAHFDVLDVPGHT 118

Query: 116 IGHICYHFMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGQGAAVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPF+R ++ ++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFMRADSEAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
           R  L  E        LA F  LR  KN+ +
Sbjct: 239 RATLEAELHETVPDRLAAFRLLREWKNRFR 268


>gi|237748730|ref|ZP_04579210.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes OXCC13]
 gi|229380092|gb|EEO30183.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes OXCC13]
          Length = 265

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 120/254 (47%), Gaps = 7/254 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  ++DN+  +I     +    +D  +   +   L+++   L  I  TH H DH     
Sbjct: 13  PIPAFNDNYIWMI--DNRKEAVIVDPGEAGPVLAALQKRSLKLCAIVLTHRHEDHIGGVS 70

Query: 67  NLKKFFNCTIFGPLEES-SKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L + ++  ++GP  +    +            F+  +  + ++  PGHT GHI Y+   
Sbjct: 71  RLLQEYSVPVYGPRFDPIESVTQPVQEGDIVTIFELDNLQLSVLDVPGHTKGHIAYYAKK 130

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GD LF  GCGR+FE +  +M+ SL K+ +  D   ++ GHEYT +N  FA   +
Sbjct: 131 EKWLFCGDMLFGAGCGRMFEGTPEQMWTSLSKLAALPDDVEVFAGHEYTLSNLKFAREIE 190

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMENASN 241
           P +  L     +  + R++   T PSTI LEK  NPFLR +   + K L     +++   
Sbjct: 191 PDSKALAARIKEDVAKRNRRQPTLPSTIGLEKATNPFLRADREEVMKRLESLGKLKDHDP 250

Query: 242 LAVFTELRIRKNQS 255
           +  F  +R  KN+ 
Sbjct: 251 VNAFAAMREWKNKY 264


>gi|323497999|ref|ZP_08103008.1| hydroxyacylglutathione hydrolase [Vibrio sinaloensis DSM 21326]
 gi|323317044|gb|EGA70046.1| hydroxyacylglutathione hydrolase [Vibrio sinaloensis DSM 21326]
          Length = 252

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/257 (33%), Positives = 134/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L++    L  I  THHH D
Sbjct: 1   MLDIK-SIPAFNDNYIWLIKNSDQR-CAVVDPGDAAPVLEYLQQHDLSLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F             +P + H +  GD  +       ++   GHT+GHI 
Sbjct: 59  HIGGIAELVRQFPEVDVVGPAN-EPVPTLTHPVEGGDQIELFGEIFFVLGLEGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LF+ GCGR+FE +  +M  SL K+ +  ++T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFAAGCGRVFEGTMEQMHTSLSKLAALPEETEIYCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +LQ++  +V  +R+QN  T P+T+  EK +NPFLR +  ++ +++    + 
Sbjct: 176 ALAVEPDNEQLQQFRDEVIRLRAQNQPTLPTTLRREKWINPFLRTDQQTVIRSVATRTQQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
             +LA+FT LR  KN+ 
Sbjct: 236 TDSLAIFTALREWKNEF 252


>gi|195348363|ref|XP_002040718.1| GM22320 [Drosophila sechellia]
 gi|194122228|gb|EDW44271.1| GM22320 [Drosophila sechellia]
          Length = 348

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-LKLWQKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 205

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHVTAQDGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 266 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEAAVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPVVTMGKLRKEKDTFK 347


>gi|330816258|ref|YP_004359963.1| Hydroxyacylglutathione hydrolase [Burkholderia gladioli BSR3]
 gi|327368651|gb|AEA60007.1| Hydroxyacylglutathione hydrolase [Burkholderia gladioli BSR3]
          Length = 268

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 82/270 (30%), Positives = 124/270 (45%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +       A+D  D   + + L  +GW L  I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSDGS--DAVAVDPGDAAPVRRYLEARGWRLAAILLTHHHA 58

Query: 60  DHTRANL----NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH         +        ++GP  E                    +   ++   PGHT
Sbjct: 59  DHVGGVAELLAHAADAGPVPVYGPAGEDIAQVSEPLAGGARVRIGKPALEFEVFDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +   +T ++  
Sbjct: 119 RGHIAYFQAAGAGHPAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGETQVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +     + R++   T P+TI+ E+ VNPFLR ++ ++
Sbjct: 179 HEYTLSNIRFALACEPDNAALAAWRDDASARRARGEPTLPTTIAHERAVNPFLRADSAAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E     A  LA FT +R  KN+ +
Sbjct: 239 AATLEAELHEAPADRLAAFTLMREWKNRFR 268


>gi|257061424|ref|YP_003139312.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8802]
 gi|256591590|gb|ACV02477.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8802]
          Length = 257

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 89/254 (35%), Positives = 132/254 (51%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+++   +  A +D  +   + + L + G  L  IFNTHHH DH  AN  
Sbjct: 6   LPALSDNYIFLLYDADTQTAAVVDPAEPTPVLECLNKLGAQLVAIFNTHHHYDHVGANNQ 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L+++F    I+G  E+  +IPG    L +GD  +FG    +++  PGHT  HI Y+F   
Sbjct: 66  LQQYFPNLCIYGGSEDRGRIPGQQVFLKEGDRVEFGQRVGEVLFVPGHTRAHIAYYFPPK 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                     GDTLF  GCGR+FE +  +M  SL K+++  D T ++  HEYT  N  FA
Sbjct: 126 FPQQTGELFCGDTLFGGGCGRLFEGTPTQMVNSLTKLRNLPDNTRVWCAHEYTLKNLQFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ D  N  L+    +VK  R Q   T PS +  EK  NPFLR +N++++  + M     
Sbjct: 186 LTVDTDNSVLKNRYDQVKEFRHQGQATVPSILGEEKLTNPFLRWDNSAIQSTIGM--TDP 243

Query: 242 LAVFTELRIRKNQS 255
             VF +LR  K+  
Sbjct: 244 ARVFGKLRGMKDTF 257


>gi|182677426|ref|YP_001831572.1| hydroxyacylglutathione hydrolase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633309|gb|ACB94083.1| hydroxyacylglutathione hydrolase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 256

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 100/246 (40%), Positives = 145/246 (58%), Gaps = 1/246 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+ + R TAAIDAP+   I + L  + W LT I  THHH DH      LK
Sbjct: 10  CLKDNFGVLVHDPESRHTAAIDAPEAGPILEALAAREWTLTEILITHHHQDHIGGIPGLK 69

Query: 70  -KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
            +F    I GP  E+ KI  +D  + +GD    G     ++  PGHT GH+ Y F  D  
Sbjct: 70  AEFPEARIIGPAREADKIGHLDQAVREGDQVKVGQLEAMVLEVPGHTSGHVVYWFEQDDI 129

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
           L  GDTLF++GCGR FE+    ++ SL K+ +   +  +Y GHEYT +NA FAL+ +P N
Sbjct: 130 LFTGDTLFAMGCGRGFEEPANILYNSLMKLAALPGELQVYCGHEYTLSNAEFALTIEPDN 189

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
           + L+   ++V+ +R++N +T P+TI++E   NPFLR++  S++  + M      AVF EL
Sbjct: 190 VLLRDRVAEVRQLRAENRFTLPTTITIELGTNPFLRVDEPSVQAAVGMPGGDPAAVFAEL 249

Query: 249 RIRKNQ 254
           R RKN+
Sbjct: 250 RERKNR 255


>gi|15228389|ref|NP_187696.1| GLY2; hydroxyacylglutathione hydrolase [Arabidopsis thaliana]
 gi|3913733|sp|O24496|GLO2C_ARATH RecName: Full=Hydroxyacylglutathione hydrolase cytoplasmic;
           AltName: Full=Glyoxalase II; Short=Glx II
 gi|6630545|gb|AAF19564.1|AC011708_7 hydroxyacylglutathione hydrolase cytoplasmic (glyoxalase II) (GLX
           II) [Arabidopsis thaliana]
 gi|1924921|emb|CAA69644.1| hydroxyacylglutathione hydrolase [Arabidopsis thaliana]
 gi|15450457|gb|AAK96522.1| AT3g10850/T7M13_7 [Arabidopsis thaliana]
 gi|23507765|gb|AAN38686.1| At3g10850/T7M13_7 [Arabidopsis thaliana]
 gi|110737017|dbj|BAF00463.1| hydroxyacylglutathione hydrolase cytoplasmic [Arabidopsis thaliana]
 gi|332641442|gb|AEE74963.1| Hydroxyacylglutathione hydrolase cytoplasmic [Arabidopsis thaliana]
          Length = 258

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 68/254 (26%), Positives = 114/254 (44%), Gaps = 7/254 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +      A +D  D   +     +    +  +  THHH DH   N  
Sbjct: 6   VPCLQDNYSYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           +K+                   D   +           I  + TP HT GHI Y+     
Sbjct: 66  IKQLVPDIKVYGGSLDKVKGCTDAVDNGDKLTLGQDINILALHTPCHTKGHISYYVNGKE 125

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             +  +  GDTLF  GCG+ FE +  +M++S    + +    T +Y GHEYT  N  FAL
Sbjct: 126 GENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLAALPKPTQVYCGHEYTVKNLEFAL 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P+N ++Q+  +  +  R  +L T PST+  E + NPF+R++   +++ L  +  S +
Sbjct: 186 TVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGCK--SPI 243

Query: 243 AVFTELRIRKNQSK 256
               E+R +K+Q +
Sbjct: 244 DTMREVRNKKDQWR 257


>gi|209517194|ref|ZP_03266039.1| hydroxyacylglutathione hydrolase [Burkholderia sp. H160]
 gi|209502330|gb|EEA02341.1| hydroxyacylglutathione hydrolase [Burkholderia sp. H160]
          Length = 263

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 84/265 (31%), Positives = 132/265 (49%), Gaps = 11/265 (4%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L  + +  + DN+  +I +        +D      +   L ++GW L+ I  THHH 
Sbjct: 1   MNALEYVPVPAFEDNYIWVIAD--GHHAVVVDPGAAAPVRACLAQRGWRLSAILLTHHHQ 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH     +L    +  ++GP  E+           D  T    +    ++  PGHT GHI
Sbjct: 59  DHVGGVADLLNGQDVPVYGPAGEAIAHLTRRLKSGDHVTIAAPALEFSVLDVPGHTSGHI 118

Query: 120 CYHFMND----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
            Y    D      +  GDTLF+ GCGR+FE +  +M  SL+ + +    T ++  HEYT 
Sbjct: 119 AYFQTADSRGTPHVFCGDTLFACGCGRLFEGTPQQMLTSLDALAALPGATEVHCAHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-- 233
           +N  FAL+C+PHN ELQ +  K   +R+++  T P+TI+ E+ VNPFLR    S++ N  
Sbjct: 179 SNIRFALACEPHNAELQAWRDKANELRARHQPTLPTTIAHERAVNPFLRAGEPSVQSNLE 238

Query: 234 --LNMENASNLAVFTELRIRKNQSK 256
             L+   +  L  FT +R  KN+ +
Sbjct: 239 AQLHETVSDRLTAFTLMREWKNRFR 263


>gi|209883261|ref|YP_002287118.1| hydroxyacylglutathione hydrolase [Oligotropha carboxidovorans OM5]
 gi|209871457|gb|ACI91253.1| hydroxyacylglutathione hydrolase [Oligotropha carboxidovorans OM5]
          Length = 255

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 99/246 (40%), Positives = 141/246 (57%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN   LIH+   + TAAIDAPD   I   L  +GW LT +  THHH DHT     L
Sbjct: 9   PCLSDNIGYLIHDPVTKATAAIDAPDAKPIIAALEREGWRLTDLLITHHHADHTDGIAEL 68

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K  + C + GP E+  +I G+D  + +GDT   G+   ++  TPGHT+ HI Y F + H 
Sbjct: 69  KAKYKCRVVGPYEKGVRIDGLDVHVKEGDTVKVGNLVARVFETPGHTLDHISYMFDDAHA 128

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
           L   D +FS+GCGR+ E +Y  M+ESL K+++  + T +Y GHEYT +N  FAL  +P+N
Sbjct: 129 LFCADVIFSIGCGRVIEGTYPMMWESLLKLRALPNDTRVYCGHEYTASNVKFALGIEPNN 188

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L+K   +V  +R++   T PS +  EK+ N FLR +  ++   L M   +   VF E+
Sbjct: 189 PALKKRAEEVTKLRAEGKLTIPSLMRDEKEANVFLRADVPAVAAALGMNGKTPAEVFGEI 248

Query: 249 RIRKNQ 254
           R RKN+
Sbjct: 249 RERKNR 254


>gi|24667703|ref|NP_730568.1| CG4365, isoform C [Drosophila melanogaster]
 gi|23094188|gb|AAN12145.1| CG4365, isoform C [Drosophila melanogaster]
          Length = 348

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-LKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 205

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 266 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPVVTMGKLRKEKDTFK 347


>gi|195591960|ref|XP_002085704.1| GD14908 [Drosophila simulans]
 gi|194197713|gb|EDX11289.1| GD14908 [Drosophila simulans]
          Length = 348

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-LKLWQKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 205

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHVTAQDGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 266 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPVVTMGKLRKEKDTFK 347


>gi|332706119|ref|ZP_08426190.1| hydroxyacylglutathione hydrolase [Lyngbya majuscula 3L]
 gi|332355097|gb|EGJ34566.1| hydroxyacylglutathione hydrolase [Lyngbya majuscula 3L]
          Length = 257

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 139/259 (53%), Gaps = 9/259 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + I  +    DN+  L+H+ K  + A +D  +   + + L+E    L  IFNTHHH+DH 
Sbjct: 1   MQIHRLPALSDNYIFLLHDPKQNIAAVVDPAEAKPVIQCLKEMDADLVAIFNTHHHMDHV 60

Query: 63  RANLN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             N   +++F +  ++G  E+  +IPG    L + D  +FG    +++  PGHT GHI Y
Sbjct: 61  GGNRQLIQQFPDVCVYGGAEDRGRIPGQQVFLEECDRVEFGDRLGEVLFVPGHTRGHIAY 120

Query: 122 HFMN-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           +F          L  GDTLF+ GCGR+FE + ++M ESL K++   D T ++  HEYT  
Sbjct: 121 YFPPVVSGETGELFCGDTLFAGGCGRLFEGTASQMVESLGKLRDLPDNTRVWCAHEYTLK 180

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FALS D  N +LQ   ++V+  R +   T PS + +EK  NPFLR E  +L+  +  
Sbjct: 181 NLQFALSVDGENPDLQGRFAQVQEARHRKEATVPSQLGVEKHTNPFLRWEEPALQSAVQA 240

Query: 237 ENASNLAVFTELRIRKNQS 255
           +    +  F  LR  K++ 
Sbjct: 241 K--EPVKTFARLRGMKDRF 257


>gi|326387159|ref|ZP_08208769.1| hydroxyacylglutathione hydrolase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208340|gb|EGD59147.1| hydroxyacylglutathione hydrolase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 254

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 88/256 (34%), Positives = 137/256 (53%), Gaps = 2/256 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+ +        DN+  L+H+ +   T AID PD          +GW +T I+NTH H D
Sbjct: 1   MSLIVHQFPCLADNYGYLVHDPESGETVAIDTPDADAYLAAAESRGWRITQIWNTHWHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K    C I  P  ++ +I G+D  +  GDT   G+    +I   GHT+GH+ 
Sbjct: 61  HAGGNEAIKAQTGCLITAPEGDAPRIAGVDRTVEQGDTVTLGAFEATVIDVGGHTLGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH  +   + VGD+LF+LGCGR+FE + A+ + SL ++K+    T +Y  HEYT +NA F
Sbjct: 121 YHIPDAAMVFVGDSLFALGCGRMFEGTPAQFWASLSRLKALPGNTLVYCAHEYTASNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A+  DP N  LQ Y ++V++ R+    T P+ ++ E   NPFLR ++ +++         
Sbjct: 181 AVHADPDNAALQSYAAEVEARRANGEATVPTIMAREIATNPFLRADDPAMQARWG--GGD 238

Query: 241 NLAVFTELRIRKNQSK 256
            +A F  LR  K+  +
Sbjct: 239 AVATFAALRAAKDTYR 254


>gi|313661527|gb|ADR71718.1| AT09325p [Drosophila melanogaster]
          Length = 360

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 99  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 158

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 159 DHAGGNEKL-LKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 217

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 218 CYHVTAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 277

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 278 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 337

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 338 AGGA-TDPVVTMGKLRKEKDTFK 359


>gi|119484331|ref|ZP_01618948.1| Beta-lactamase-like protein [Lyngbya sp. PCC 8106]
 gi|119457805|gb|EAW38928.1| Beta-lactamase-like protein [Lyngbya sp. PCC 8106]
          Length = 257

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 136/254 (53%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+H+  + + A +D  +   +   LRE    L  IFNTHHH DH   N  
Sbjct: 6   LPVLSDNYIFLLHDPTHNIAAVVDPAEAAPVVHRLRELNAELVTIFNTHHHSDHVGGNRQ 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + F   T++G  E+  +IPG    LS+GD   F     ++   PGHT  HI Y+F   
Sbjct: 66  LLQHFPQATVYGGAEDQDRIPGQQVFLSEGDQVKFSDRSGEVFFVPGHTRAHIAYYFPAQ 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                     GDTLF+ GCGR+FE +  +M  SL K++S  D T ++  HEYT  N  FA
Sbjct: 126 TEGETGELFCGDTLFAGGCGRLFEGTPQQMVSSLTKLRSLPDNTRVWCAHEYTLKNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ D +N +L+    +VK  RS++  T PSTI LEK  NPF+R ++ +L+  +  ++   
Sbjct: 186 LTVDENNADLKHRFEQVKVDRSRDQATVPSTIGLEKLTNPFMRWDDVALQSKV--KSQDP 243

Query: 242 LAVFTELRIRKNQS 255
           +  F  LR  K+Q 
Sbjct: 244 VQTFARLRGMKDQF 257


>gi|172087738|ref|YP_205321.2| hydroxyacylglutathione hydrolase [Vibrio fischeri ES114]
 gi|212286064|sp|Q5E3G3|GLO2_VIBF1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|171902328|gb|AAW86433.2| hydroxyacylglutathione hydrolase [Vibrio fischeri ES114]
          Length = 252

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 138/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+  +I  ++DN+  LIHN+       +D  D   + + ++E  + L  I  THHH D
Sbjct: 1   MLSVK-SIPAFNDNYIWLIHNND-NHCVVVDPGDATPVLECIKEHDFILDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        E    IP + H + DGD  +       ++  PGHT GH+ 
Sbjct: 59  HIGGVPELVRQFPNVNVVGPEN-EPIPTLTHPVGDGDFVELFDEQFMVLGVPGHTNGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL+K+ +  D+T +Y  HEYT +N  F
Sbjct: 118 YIG--DEKLFCGDALFSAGCGRLFEGTAEQMFNSLQKMAALPDETEVYCAHEYTASNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N  L +Y  KV  +R+    T PST+  EK +NPFLR    +++K++   +++
Sbjct: 176 ALAVEPDNDYLLRYREKVLHLRAHGKSTIPSTLQREKLINPFLRTSEANVKKSVASKVQD 235

Query: 239 ASNLAVFTELRIRKNQS 255
           ++ + +FT LR  K++ 
Sbjct: 236 STEVEIFTALRRWKDEF 252


>gi|299132857|ref|ZP_07026052.1| hydroxyacylglutathione hydrolase [Afipia sp. 1NLS2]
 gi|298592994|gb|EFI53194.1| hydroxyacylglutathione hydrolase [Afipia sp. 1NLS2]
          Length = 255

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 97/246 (39%), Positives = 142/246 (57%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN   LIH+   + TAAIDAP+   I   L  +GW LT +  THHH DHT     L
Sbjct: 9   PCLSDNIGYLIHDPSTKATAAIDAPEAKPIIAALEREGWRLTDLLITHHHADHTDGIAEL 68

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K  + C + GP E+ + I G+D  + +GDT   G+   ++  TPGHT+ H+ Y F   H 
Sbjct: 69  KAKYKCRVVGPYEKRAHIDGLDIHVKEGDTVKVGNLTARVFETPGHTLDHVSYMFDEAHA 128

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
           L   DT+FS+GCGR+ E +Y  M++SL K+++  + T +Y GHEYT +N  FAL  +P+N
Sbjct: 129 LFCADTIFSIGCGRVIEGTYPMMWDSLLKLRALPNDTRVYCGHEYTASNVKFALGIEPNN 188

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L+K   +V  +R++   T PS +  EK+ N FLR +  ++  +L M   +   VF E+
Sbjct: 189 PALKKRADEVTRLRAEGKLTIPSLMRDEKEANVFLRADVPAVAASLGMSGKTPAEVFGEI 248

Query: 249 RIRKNQ 254
           R RKN+
Sbjct: 249 RERKNR 254


>gi|10334501|emb|CAC10212.1| putative mitochondrial glyoxalase II [Cicer arietinum]
          Length = 271

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 99/249 (39%), Positives = 145/249 (58%), Gaps = 1/249 (0%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  ++++        +D  +   I + L +K   LT+I NTHHH DHT  N  
Sbjct: 23  VPCLRDNYAYILYDVDTGTVGVVDPSEAAPIIEALTKKNLNLTYILNTHHHNDHTDGNAE 82

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK+ +   + G   +  +IPGID  LSDGD + F  H + I+ATPG T GHI ++F    
Sbjct: 83  LKERYGAKVIGSDLDKERIPGIDIYLSDGDKWMFAGHEVHIMATPGVTRGHISFYFPGSG 142

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            +  GDTLFSL CG+++E +  +M  SL+KI S +D T IY GHEYT NN+ FALS +P 
Sbjct: 143 AIFTGDTLFSLSCGKLYEGTPEQMLSSLKKIMSLADDTSIYCGHEYTLNNSKFALSIEPE 202

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFT 246
           N ELQ Y S V  +R++ L T P+T+ +EK  NPFLR  +T +R+ L +   A +    +
Sbjct: 203 NKELQSYASHVAHLRNKGLPTVPTTLKMEKACNPFLRTWSTEIRQKLKVAATAEDAEALS 262

Query: 247 ELRIRKNQS 255
            +R  ++  
Sbjct: 263 VIRQAEDTF 271


>gi|293392718|ref|ZP_06637037.1| hydroxyacylglutathione hydrolase [Serratia odorifera DSM 4582]
 gi|291424835|gb|EFE98045.1| hydroxyacylglutathione hydrolase [Serratia odorifera DSM 4582]
          Length = 251

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 76/252 (30%), Positives = 129/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  ++ + +      +D  +   +   LR+       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWIL-DDQQGHCTIVDPGEAQPVLDALRKLELTPDAILLTHHHHDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   +         E++   G    + DGD         ++IA PGHT+GH+ ++   
Sbjct: 63  AQILAQYPALPVYGPHETA-NKGATTLVEDGDIITVSGRKYRVIAVPGHTLGHVAFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S +++    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTLFSAGCGRLFEGTAEQMYYSFQQLSQLPDNTIICCAHEYTVSNLKFARAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + +++ Y  +V ++R++N  + P+T+ LE+++N FLR  +T L+K L  +       +
Sbjct: 180 PQDRQIETYQQQVMALRAKNQPSVPTTLQLEREINLFLRCHDTDLQKKLGFDRPPEHLHS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR+RK+  
Sbjct: 240 VFSELRLRKDSF 251


>gi|150397750|ref|YP_001328217.1| hydroxyacylglutathione hydrolase [Sinorhizobium medicae WSM419]
 gi|150029265|gb|ABR61382.1| Hydroxyacylglutathione hydrolase [Sinorhizobium medicae WSM419]
          Length = 256

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 117/246 (47%), Positives = 158/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +L+H+     TA+IDAP+   I   L  + W LTHI  THHH DH   N+ LK
Sbjct: 11  CRTDNYGVLLHDRLSGATASIDAPEERPILDALERRSWQLTHILTTHHHGDHVAGNIGLK 70

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  TI GP  ES KIPGID  +  GD FDF  HP+++I TPGHT GH+CYHF  D  L
Sbjct: 71  ERFGVTIIGPKNESPKIPGIDRSVGHGDRFDFAGHPVEVIETPGHTAGHVCYHFPEDKLL 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE +   M++SL ++ +  D T IYFGHEYT  NA FA++ DP N 
Sbjct: 131 FAADTLFALGCGRLFEGTPETMWQSLSRLMALPDDTAIYFGHEYTLANARFAVTVDPENT 190

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  ++++  RS   +T P+T+ LEK+ NPFLR ++  +R  L M+ AS+ AVF E+R
Sbjct: 191 ALKERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRADDPKIRAFLGMDKASDAAVFAEIR 250

Query: 250 IRKNQS 255
            RK+  
Sbjct: 251 KRKDSF 256


>gi|119503280|ref|ZP_01625364.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2080]
 gi|119460926|gb|EAW42017.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2080]
          Length = 255

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 89/261 (34%), Positives = 135/261 (51%), Gaps = 12/261 (4%)

Query: 1   MTS-LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHH 58
           MT+ L I  I  + DN+  L+H+        +D  D  ++   L ++   L  I  THHH
Sbjct: 1   MTAALKIEPIPAFSDNYIWLLHDDTN--AVVVDPGDAQVVLAALSKRNLSLQSILITHHH 58

Query: 59  IDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
            DH      L +  +C ++GP   + KI  + H + +GDT      P+ ++  PGHT+ H
Sbjct: 59  FDHVGGIAALTEATHCEVWGP--TNPKITPVTHRVKEGDTLQVLGEPMHVLEVPGHTLDH 116

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y    +  L  GDTLF+ GCGR+FE ++  M  SL K++    +T +Y  HEYT  N 
Sbjct: 117 IAYLG--EGVLFCGDTLFAGGCGRVFEGTHPMMRSSLAKLRGLDPETKVYCAHEYTIANL 174

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ DPHN  L +      S+R +N+ T PS ++ E   NPFLR +  S+ +NL    
Sbjct: 175 QFALAADPHNATLAERMQLCSSLRERNIPTVPSLLADEIATNPFLRWDAPSVVENLAAAS 234

Query: 235 NMENASNLAVFTELRIRKNQS 255
            +++  +  VF  LR  K+  
Sbjct: 235 RLKSPQSDDVFAGLRQWKDTF 255


>gi|37522908|ref|NP_926285.1| hydroxyacylglutathione hydrolase [Gloeobacter violaceus PCC 7421]
 gi|81709044|sp|Q7NG34|GLO2_GLOVI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|35213910|dbj|BAC91280.1| gll3339 [Gloeobacter violaceus PCC 7421]
          Length = 252

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 130/249 (52%), Gaps = 3/249 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           ++   DN+  ++ +   R  A +D  +   + + L   G  L  IFNTHHH DH   N  
Sbjct: 6   LNALKDNYVFVLEDEAARTAAVVDPAEARPVLEALVRLGLKLVAIFNTHHHHDHVGGNRE 65

Query: 68  LKKFFNCT-IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + +    ++    +  +IPG    L DGDT  FG    ++I  PGHT GHI YHF   
Sbjct: 66  LLEAYPGIAVYASRRDRGRIPGQTVELEDGDTVAFGCERARVIFVPGHTHGHIAYHFAGC 125

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF+ GCGR+FE +  +M  SL +++    +T ++  HEYT  N  FA + +P
Sbjct: 126 GHLFCGDTLFAGGCGRLFEGTARQMQHSLGRLRELPGETQVWCAHEYTLGNLRFAHTLEP 185

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N EL +    V+ +R++ + T PST++ E+  NPFLR E+  L++           VF 
Sbjct: 186 DNAELAERLRTVEVLRARKIATVPSTMAAERATNPFLRWESRQLQRAAGAI--EPEEVFA 243

Query: 247 ELRIRKNQS 255
            LR  K++ 
Sbjct: 244 HLRALKDRF 252


>gi|307545284|ref|YP_003897763.1| hydroxyacylglutathione hydrolase [Halomonas elongata DSM 2581]
 gi|307217308|emb|CBV42578.1| hydroxyacylglutathione hydrolase [Halomonas elongata DSM 2581]
          Length = 255

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 78/258 (30%), Positives = 122/258 (47%), Gaps = 6/258 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+   I  + DN+  L+          +D  D   + + L  +G  L  I  THHH D
Sbjct: 1   MLSVT-PIPAFSDNYIWLLRQDTSDSVCVVDPGDAAPVIEWLEREGLTLGTILITHHHPD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI- 119
           HT     L + ++  + G    +  I GID  + DGD         +++  PGHT+ HI 
Sbjct: 60  HTGGLAELIQRYSPRVIG--PHNPSITGIDERVGDGDEIRVMGRLFEVLELPGHTLDHIA 117

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +       L  GD LFS GCGR+FE S  +M +SL ++ +  ++  ++  HEYT  N  
Sbjct: 118 FFTAGIPPLLFSGDVLFSAGCGRLFEGSPEQMHQSLSRLDNLPEEALVFAAHEYTLANLR 177

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA + DP N ++ +  ++    R     T PST+  E+++NPFLR     +R+      A
Sbjct: 178 FAKAADPGNKDVIEAENECLRARELERPTLPSTLGRERRINPFLRCGEEGVRRAAAEHGA 237

Query: 240 SNLA--VFTELRIRKNQS 255
           ++     FT LR  K+  
Sbjct: 238 TDTELATFTTLRAWKDSF 255


>gi|194875152|ref|XP_001973539.1| GG16137 [Drosophila erecta]
 gi|190655322|gb|EDV52565.1| GG16137 [Drosophila erecta]
          Length = 348

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 85/263 (32%), Positives = 122/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K L+E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTLQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G+  +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-VKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGALNVKCLSTPCHTTGHI 205

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH              GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHVTAQEGSGKGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSSLPDTTKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++K+
Sbjct: 266 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEASVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPIVTMGKLRKEKDTFK 347


>gi|254414720|ref|ZP_05028485.1| metallo-beta-lactamase superfamily protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178568|gb|EDX73567.1| metallo-beta-lactamase superfamily protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 257

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 85/254 (33%), Positives = 131/254 (51%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H  K  + A +D  +   + + L + G  L  IFNTHHH DH   N  
Sbjct: 6   LPALSDNYIFLLHEPKQNIAAVVDPAEAQPVLQHLEKLGAELVTIFNTHHHWDHVGGNQE 65

Query: 68  LKKFFNCTI-FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + +     +G  ++  +IPG    L +GD   F     +I   PGHT GHI Y+F   
Sbjct: 66  LIQRYPDVCVYGGTQDRGRIPGQQVFLQEGDEVQFSDRTAEIFFVPGHTSGHIAYYFPPV 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                     GDT+F+ GCGR+FE +  +M +SL K++   D T ++  HEYT  N  FA
Sbjct: 126 TSDEVGELFCGDTIFAGGCGRLFEGTPKQMVDSLSKLRRLPDNTRVWCAHEYTLKNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            + DP+N +LQ   + V++ R +   T PS + +EK  NPFLR E  +L++ +  ++   
Sbjct: 186 QTVDPNNPDLQSRYTDVEAARRRKEATVPSLLGVEKLTNPFLRWEQPTLQEAV--KSTEP 243

Query: 242 LAVFTELRIRKNQS 255
           +  F  LR  K++ 
Sbjct: 244 VQTFARLRGMKDKF 257


>gi|219130110|ref|XP_002185216.1| glyoxalase [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403395|gb|EEC43348.1| glyoxalase [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 262

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 101/250 (40%), Positives = 149/250 (59%), Gaps = 5/250 (2%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  LIH      TAAID P+       L+ +GW LTHIFNTHHH+DHT  NL  
Sbjct: 15  PCLSDNYGFLIHCESTGQTAAIDTPEASAYKNELKRRGWKLTHIFNTHHHLDHTGGNL-- 72

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
            +  +  +      S KIPG+D GL  GD  +FG     II   GHT+GH+ YHF  ++ 
Sbjct: 73  -ELKSDGVLVYGPSSEKIPGMDVGLKGGDEIEFGGTKAHIIDVGGHTLGHLSYHFPKENI 131

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD+LF+LGCG++FE S ++ +ESL++++   D T IY  HEYT +NA FAL+ +P N
Sbjct: 132 AFVGDSLFALGCGKMFEGSPSQFWESLKRLRELPDDTTIYCAHEYTSSNAKFALAIEPGN 191

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE-NTSLRKNLNME-NASNLAVFT 246
             L     ++K+ R +   T PS + +EK+ NPFLR + +  +R+N+ ++ + S+  VF 
Sbjct: 192 SALVSRAEEIKATRERGEPTVPSNLGVEKQTNPFLRCDMSAEIRQNIGVKISDSDADVFG 251

Query: 247 ELRIRKNQSK 256
            +R  K++ +
Sbjct: 252 RIRKAKDKFR 261


>gi|73541875|ref|YP_296395.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha JMP134]
 gi|123624617|sp|Q46Z82|GLO2_RALEJ RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|72119288|gb|AAZ61551.1| Hydroxyacylglutathione hydrolase [Ralstonia eutropha JMP134]
          Length = 266

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 126/263 (47%), Gaps = 15/263 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+   IH+   R  A +D  +   + + L++KG  L  I  THHH DH     
Sbjct: 6   PIPAFQDNYIWAIHD--GRNAAVVDPGEAAPVERFLKDKGLALGAIVITHHHGDHQGGVA 63

Query: 67  -----NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKII--ATPGHTIGHI 119
                         +        +I G    + +GDT    +  ++      PGHT GH+
Sbjct: 64  ELLSAYPTTHDGAPMPVIGPAGERIGGRTQAVREGDTVTLPAPALQFRVLDVPGHTAGHV 123

Query: 120 CY---HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y          +  GDTLF+ GCGR+FE + A+M  SL+K+ S   +T +Y  HEYT +
Sbjct: 124 AYAGDLPGVGPVVFCGDTLFATGCGRLFEGTPAQMLASLDKLASLPGETRVYCAHEYTRS 183

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P N  L  + ++V+S+R     T PSTI LE++VNPFLR    ++R+ +  
Sbjct: 184 NVRFARAVEPGNTALADWEARVESLREAGQPTVPSTIGLERQVNPFLRSREPTVREAVKA 243

Query: 237 ENAS---NLAVFTELRIRKNQSK 256
           +  S   +   F  LR  K+  +
Sbjct: 244 QGGSVAGDAEAFGALRGWKDNFR 266


>gi|262166315|ref|ZP_06034052.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
 gi|262026031|gb|EEY44699.1| hydroxyacylglutathione hydrolase [Vibrio mimicus VM223]
          Length = 252

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D      +   L+     L  I  THHH D
Sbjct: 1   MLQIK-SIPAFNDNYIWLIQNSD-RDCAVVDPGIAEPVLAYLKLHDLNLKAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L                 IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPHTHVVGPAHEPIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN  
Sbjct: 236 LDPLTIFTALREWKNDF 252


>gi|300024273|ref|YP_003756884.1| hydroxyacylglutathione hydrolase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526094|gb|ADJ24563.1| hydroxyacylglutathione hydrolase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 266

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 104/255 (40%), Positives = 148/255 (58%), Gaps = 1/255 (0%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +  I +     DN+C+L+H+     TAAIDAP    I   L  + W L H+F THHH 
Sbjct: 11  MATFEIVLLPCLADNYCVLLHDPVSGETAAIDAPQAATIKAALDARNWRLNHLFITHHHT 70

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT     LK  +  ++ GP  E+ +IPG+  G+++    +F  HPI+++ TPGHT+GH+
Sbjct: 71  DHTAGIAELKGHYGASVTGPEAEAERIPGLTRGVTEATQLEFAGHPIRVLETPGHTLGHV 130

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +H  +D  +  GDTLFSLGCGRIFE     M+ S+ KI +    T IY GHEYT  NA 
Sbjct: 131 TFHLPDDGLVFTGDTLFSLGCGRIFEGDPQMMWNSVSKIAALPGDTRIYCGHEYTLGNAR 190

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA++ +  N  L+   + V++ R+    T P+TI LEK  NPFLR  +  +R  L ++ A
Sbjct: 191 FAMNVELENAALKARVADVEAARTAGEATIPTTIDLEKATNPFLRPGSRMIRARLGLDGA 250

Query: 240 SNLAVFTELRIRKNQ 254
            +  VF  LR  KN+
Sbjct: 251 PDWEVFARLRQLKNK 265


>gi|198463971|ref|XP_001353016.2| GA18136 [Drosophila pseudoobscura pseudoobscura]
 gi|198151486|gb|EAL30517.2| GA18136 [Drosophila pseudoobscura pseudoobscura]
          Length = 305

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 84/263 (31%), Positives = 125/263 (47%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E    L+ +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAVVDPVDPELVIKTVQEANVTLSKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   D+F  GS  ++ ++TP HT GHI
Sbjct: 104 DHAGGNEKL-VKLWEKELEVYGGDDRIGALNKMVRQDDSFTIGSLNVRCLSTPCHTTGHI 162

Query: 120 CYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 163 CYHVTAGDGKGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGHEY 222

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++K+
Sbjct: 223 TLQNMSFARHVEPDNESIQQRIEWAKLRRASQDPTVPSTIGEEKIWNPFMRVHEASVQKH 282

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 283 AGGA-TDPIVTMGKLRKEKDNFK 304


>gi|16329542|ref|NP_440270.1| glyoxalase II [Synechocystis sp. PCC 6803]
 gi|2494855|sp|P72933|GLO2_SYNY3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|1652024|dbj|BAA16950.1| glyoxalase II [Synechocystis sp. PCC 6803]
          Length = 257

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 88/254 (34%), Positives = 131/254 (51%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+ +    A +D  +   +   L   G  L  I+NTHHH DH  AN  
Sbjct: 6   LPALADNYIFLLHDRQRNQAAVVDPAEAKPVLDCLETLGADLVTIYNTHHHGDHVGANRE 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L   +    ++G +E+  +IPG    L DGD   F      +   PGHT GHI Y+F   
Sbjct: 66  LLAKYPNLEVYGGVEDQGRIPGQTVFLRDGDRLSFADREATVYFVPGHTRGHIAYYFAPG 125

Query: 127 H-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDT+F+ GCGR+FE + A+M +S+ K++   D+T ++  HEYT  N  FA
Sbjct: 126 SGETIGDLFCGDTIFAGGCGRLFEGTPAQMVQSIGKLRQLPDQTRLWCAHEYTLGNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP N +LQ+    V+  R +   T PS +  EK+ NPFLR +N +++  + M     
Sbjct: 186 LTVDPSNKDLQERFQTVQGDRQRGQATIPSWLGTEKRTNPFLRWDNPAIQARVGM--TEP 243

Query: 242 LAVFTELRIRKNQS 255
             VF +LR  K+  
Sbjct: 244 ARVFGKLRGMKDNF 257


>gi|330503131|ref|YP_004380000.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina NK-01]
 gi|328917417|gb|AEB58248.1| hydroxyacylglutathione hydrolase [Pseudomonas mendocina NK-01]
          Length = 257

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 129/260 (49%), Gaps = 8/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDTDTRRCAVVDPGDAAPVQAWLEAHPQWQLSDILITHHHF 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK      + GP     KIP  D  L+D D         +++A PGHT+GHI
Sbjct: 60  DHVGGVEKLKSATGARVAGPAA--EKIPARDLDLNDNDEIVVLGLRFQVMAVPGHTLGHI 117

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+    + L  GDTLF+ GCGR+FE +  +M +SL ++ +   +T +Y  HEYT +N  
Sbjct: 118 AYYDGEQNLLFCGDTLFAGGCGRLFEGTPQQMHQSLSRLAALPARTKVYCTHEYTLSNLR 177

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P NL L +  ++V   R +   + PS I LE   NPFLR    S+        N
Sbjct: 178 FAHAVEPDNLRLSERLAEVTRWREEGRISLPSNIELELATNPFLRTREPSIIAAAKGREN 237

Query: 236 MENASNLAVFTELRIRKNQS 255
            +++   A+F  LR  K+  
Sbjct: 238 GQSSEPSAIFASLRTWKDSF 257


>gi|172036105|ref|YP_001802606.1| glyoxalase II [Cyanothece sp. ATCC 51142]
 gi|254798841|sp|B1WUT9|GLO2_CYAA5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|171697559|gb|ACB50540.1| glyoxalase II [Cyanothece sp. ATCC 51142]
          Length = 257

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 129/254 (50%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+      A +D      +   L + G  L  IFNTHHH DH   N  
Sbjct: 6   LPALSDNYIFLLHDANNNTAAVVDPAVAEPVLNCLDQLGAKLIAIFNTHHHADHVGGNKK 65

Query: 68  LK-KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L  +F +  ++G  E+  +IPG    L +GDT +F     K+   PGHT GHI Y+F  +
Sbjct: 66  LMEQFPDLCVYGSKEDQGRIPGQQVFLEEGDTVEFAGKTGKVYFVPGHTRGHIAYYFPPN 125

Query: 127 HF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDT+F+ GCGR+FE + A+M ES+ K+++  D T I+  HEYT NN  FA
Sbjct: 126 ENEEIGDLFCGDTIFAGGCGRLFEGTPAQMVESIGKLRNLPDHTRIWCAHEYTLNNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ D  N +LQ     V   R     T PS +  EKK NPFLR +  +L+    M     
Sbjct: 186 VTVDKDNSDLQIRYQDVIKARKNEEATVPSLLGEEKKTNPFLRWDQPALQMITGMN--DP 243

Query: 242 LAVFTELRIRKNQS 255
             VF ++R  K+  
Sbjct: 244 ARVFGKIRGMKDNF 257


>gi|109898214|ref|YP_661469.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas atlantica T6c]
 gi|109700495|gb|ABG40415.1| Hydroxyacylglutathione hydrolase [Pseudoalteromonas atlantica T6c]
          Length = 257

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 123/261 (47%), Gaps = 10/261 (3%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+SL I  I  + DN+   + N +      +D  D   + K        LT I  THHH 
Sbjct: 1   MSSLKIRPIKAFEDNYIWCLINGET--CTVVDPGDAKPVIKFCSRNNLTLTDILITHHHS 58

Query: 60  DHTR-ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT   N  L+ F N  ++GP     +         D           K++  PGHT+ H
Sbjct: 59  DHTGGVNDLLQAFENVNVYGPQNPQIQSITQRLQAGDTVQLPSLDVEFKVLEVPGHTLDH 118

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y       L  GDTLFS GCGR+FE +  +M++SL ++ + +D T +Y  HEYT  N 
Sbjct: 119 IAYVG--SCGLFCGDTLFSAGCGRLFEGTPQQMYQSLGQLTALADDTKVYCTHEYTLANI 176

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----L 234
            FA + +P+N  L  Y    +S R     T PSTI  +K +NPFLR  +  + ++     
Sbjct: 177 KFAQAAEPNNEALLNYKGWAESQRVDLKPTLPSTIGQQKAINPFLRASSKEVIQHAEHYA 236

Query: 235 NMENASNLAVFTELRIRKNQS 255
               A+  +VFT LR  K+  
Sbjct: 237 GRTLATPESVFTALRAWKDNF 257


>gi|195172241|ref|XP_002026907.1| GL12815 [Drosophila persimilis]
 gi|194112675|gb|EDW34718.1| GL12815 [Drosophila persimilis]
          Length = 305

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 125/263 (47%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E    L+ +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAVVDPVDPELVIKTVQEANVTLSKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   D+F  GS  ++ ++TP HT GHI
Sbjct: 104 DHAGGNEKL-VKLWEKELEVYGGDDRIGALNKMVRQDDSFTIGSLNVRCLSTPCHTTGHI 162

Query: 120 CYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+++L    S     T ++ GHEY
Sbjct: 163 CYHVTAGDGKGEGAVFTGDTLFQGGCGRFFEGTPEEMYDALCTKLSALPDTTKVFCGHEY 222

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   S++K+
Sbjct: 223 TLQNMSFARHVEPDNESIQQRIEWAKLRRASQDPTVPSTIGEEKIWNPFMRVHEASVQKH 282

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 283 AGGA-TDPIVTMGKLRKEKDNFK 304


>gi|27365230|ref|NP_760758.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|37680716|ref|NP_935325.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio vulnificus
           YJ016]
 gi|320155615|ref|YP_004187994.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus MO6-24/O]
 gi|81587814|sp|Q8DBD8|GLO2_VIBVU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81756819|sp|Q7MII4|GLO22_VIBVY RecName: Full=Hydroxyacylglutathione hydrolase 2; AltName:
           Full=Glyoxalase II 2; Short=Glx II 2
 gi|27361377|gb|AAO10285.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus CMCP6]
 gi|37199465|dbj|BAC95296.1| putative hydroxyacylglutathione hydrolase GloB [Vibrio vulnificus
           YJ016]
 gi|319930927|gb|ADV85791.1| hydroxyacylglutathione hydrolase [Vibrio vulnificus MO6-24/O]
          Length = 252

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 135/257 (52%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   +   + +    L  I  THHH D
Sbjct: 1   MLEIK-SIPAFNDNYIWLIQNSDQR-CAVVDPGDAKPVLHYIEQHQLTLEAILITHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L + F        +    IP + H + DGD  +       ++   GHT+GHI 
Sbjct: 59  HIGGVADLVRAFPNVNVVGPKA-EPIPTLTHPVEDGDRLELFDETFLVLGLGGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE +  +MF+SL K+ +  ++T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRIFEGTAQQMFDSLNKLLALPEETEVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MEN 238
           AL+ +P N  L +Y   V  +R+QNL T P+T+  EK +NPFLR    S+  +++   +N
Sbjct: 176 ALAVEPDNELLHQYRDTVNRLRAQNLPTIPTTLRQEKWINPFLRYLQPSVIHSVSSRTKN 235

Query: 239 ASNLAVFTELRIRKNQS 255
           +  L+VFT LR  KN+ 
Sbjct: 236 SDPLSVFTALREWKNEF 252


>gi|258621018|ref|ZP_05716052.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM573]
 gi|258586406|gb|EEW11121.1| hydroxyacylglutathione hydrolase GloB, putative [Vibrio mimicus
           VM573]
          Length = 252

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D      +   L+     L  I  THHH D
Sbjct: 1   MLQIK-SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKLHDLNLKAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L                 IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAEL-VHQFPHTHVVGPAHEPIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMQQMFSSLNKLLTLPEETLIYSAHEYTSSNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +  
Sbjct: 176 ALAVEPENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVST 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN  
Sbjct: 236 LDPLTIFTALREWKNDF 252


>gi|90422032|ref|YP_530402.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisB18]
 gi|122477487|sp|Q21C03|GLO2_RHOPB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|90104046|gb|ABD86083.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisB18]
          Length = 255

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 98/245 (40%), Positives = 140/245 (57%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF  L+H+     TA+IDAP+   I   L  +GW LT I  THHH DH      LK
Sbjct: 10  CLKDNFGYLVHDSDSGATASIDAPEAAPILAALAREGWTLTDILVTHHHADHIGGIAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +  NC +  P +  + IP +D  +  GD    G    +++ TPGHT+ H+ Y F +D  L
Sbjct: 70  QATNCRVVAPHDNGAAIPLVDLRVRQGDVVKIGGLLARVLETPGHTLDHVAYVFDDDKAL 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE +Y  M+ESL K++   D   +Y GHEYT  N  FAL+ +P+N 
Sbjct: 130 FAADTLFSIGCGRVFEGTYPMMWESLLKLRVLPDDMRLYCGHEYTAANVKFALTVEPNNP 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            LQ   ++V  +R+  L T P+ +  EK+ N FLR +  ++   + ++ A  + VFTELR
Sbjct: 190 ALQARAAEVAHLRTAGLPTIPTLLGDEKRANVFLRADEPTVAAGVRLKGAGAVEVFTELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|262170793|ref|ZP_06038471.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
 gi|261891869|gb|EEY37855.1| hydroxyacylglutathione hydrolase [Vibrio mimicus MB-451]
          Length = 303

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D      +   L++    L  I  THHH D
Sbjct: 52  MLQIK-SIPAFNDNYIWLIQNSD-RDCAVVDPGTAEPVLAYLKQHDLNLKAILITHHHHD 109

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L                 IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 110 HIGGVAELI-HQFPHTHVVGPAHEPIPTLTHPVEDGDQIELFDERFLVLGLPGHTLGHIG 168

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRIFE S  +MF SL K+ +  ++T IY  HEYT +N  F
Sbjct: 169 YVG--DGKLFCGDVLFSAGCGRIFEGSMQQMFSSLNKLLTLPEETLIYSAHEYTASNVAF 226

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           AL+ +P N +L  Y  +V  +R+QN  T PST++ EK +NPFLR +  S+ +++   +  
Sbjct: 227 ALAVEPENEQLHIYREEVSRLRAQNQPTLPSTLAREKWINPFLRTQEPSVIRSVANRVST 286

Query: 239 ASNLAVFTELRIRKNQS 255
              L +FT LR  KN  
Sbjct: 287 LDPLTIFTALREWKNDF 303


>gi|271501674|ref|YP_003334700.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech586]
 gi|270345229|gb|ACZ77994.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech586]
          Length = 251

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 124/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  + DN+  L+ N +      +D  D   + + L   G     I  THHH DHT   
Sbjct: 4   ISVPAFKDNYIWLLANDE-NDCVIVDPGDAAPVLQALEHHGLSPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +        +E+ +       + +GD          I   PGHT GHI Y+   
Sbjct: 63  EQLAAHYPDIQIYGPQETKRCGVTHT-VQEGDKITVAGSEFSIFFVPGHTAGHIAYYSHP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +MFESL K+    D+T +   HEYT +N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRIFEGTAQQMFESLIKLADLPDETQVCCAHEYTLSNLAFAHHVW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NLA 243
           P ++++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L++ + +  +  
Sbjct: 180 PEDVDIYDYLVKIRQLREKGESSLPSTLGRERRINIFLRYHDIDLKRKLSINSDTQGDWQ 239

Query: 244 VFTELRIRKNQS 255
           +F  LR  K+Q 
Sbjct: 240 IFAHLRALKDQF 251


>gi|254252711|ref|ZP_04946029.1| Hydroxyacylglutathione hydrolase [Burkholderia dolosa AUO158]
 gi|124895320|gb|EAY69200.1| Hydroxyacylglutathione hydrolase [Burkholderia dolosa AUO158]
          Length = 268

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 135/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLDERGWRLTAILLTHHHA 58

Query: 60  DHTRANLN----LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH                 T++GP  E+  +        D  +    +    ++  PGHT
Sbjct: 59  DHVGGVAALLDGRSDDAPVTVYGPAAEAIGVVTHALAGGDRVSVAAPAVAFDVLDVPGHT 118

Query: 116 IGHICYHFMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y     H      +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQHAGHGAAVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPF+R ++ ++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFMRSDSDAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
           R  L  E        L  FT +R  KN+ +
Sbjct: 239 RATLEAELHETVPDRLTAFTLMREWKNRFR 268


>gi|218247241|ref|YP_002372612.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8801]
 gi|226723987|sp|B7K3R6|GLO2_CYAP8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218167719|gb|ACK66456.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 8801]
          Length = 257

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 135/254 (53%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+++   +  A +D  +   + + L + G  L  IFNTHHH DH  AN  
Sbjct: 6   LPALSDNYIFLLYDADTQTAAVVDPAEPTPVLECLNKLGAQLVAIFNTHHHYDHVGANNQ 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN- 125
           L+++F    I+G  E+  +IPG    L +GD  +FG    +++  PGHT  HI Y+F   
Sbjct: 66  LQQYFPNLCIYGGSEDRGRIPGQQVFLKEGDRVEFGQRVGEVLFVPGHTRAHIAYYFPPK 125

Query: 126 ----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLF  GCGR+FE +  +M  SL K+++  D T ++  HEYT  N  FA
Sbjct: 126 LSQETGELFCGDTLFGGGCGRLFEGTPTQMVNSLTKLRNLPDNTRVWCAHEYTLKNLQFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP NL L+    +VK  R Q   T PS +  EK  NPFLR +N++++  + M     
Sbjct: 186 LTVDPDNLVLKNRYHQVKEFRHQGQATVPSILGEEKLTNPFLRWDNSAIQLTIGM--TDP 243

Query: 242 LAVFTELRIRKNQS 255
             VF +LR  K+  
Sbjct: 244 ARVFGKLRGMKDTF 257


>gi|195495777|ref|XP_002095411.1| GE19707 [Drosophila yakuba]
 gi|194181512|gb|EDW95123.1| GE19707 [Drosophila yakuba]
          Length = 348

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 124/263 (47%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G+  +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-VKLWEKELDVYGGDDRIGALNKRVQQDDTFTIGALNVKCLSTPCHTTGHI 205

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHVTGPEGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 266 TLQNMSFARHVEPDNELIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPIVTMGKLRKEKDTFK 347


>gi|161525203|ref|YP_001580215.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|189350058|ref|YP_001945686.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|160342632|gb|ABX15718.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
 gi|189334080|dbj|BAG43150.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans ATCC
           17616]
          Length = 268

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 136/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAEPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNC----TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP +E+  +           T D  +    ++A PGHT
Sbjct: 59  DHVGGVAALQDSQPADVPLPVYGPADEAIGVVTHPLAGGARVTLDAPAATFDVLAVPGHT 118

Query: 116 IGHICYH-----FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPHTPVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPFLR +  ++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFLRADAAAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E        LA FT +R  KN+ +
Sbjct: 239 HATLEAELHESVPDRLAAFTLMREWKNRFR 268


>gi|328541842|ref|YP_004301951.1| Hydroxyacylglutathione hydrolase (Glyoxalase II) [polymorphum
           gilvum SL003B-26A1]
 gi|326411593|gb|ADZ68656.1| Hydroxyacylglutathione hydrolase (Glyoxalase II) [Polymorphum
           gilvum SL003B-26A1]
          Length = 257

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 103/246 (41%), Positives = 138/246 (56%), Gaps = 1/246 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+     T AID PD      +L E GW L HI  THHH DH +    LK
Sbjct: 11  CLSDNFGVLVHDPDSGATVAIDVPDAEPYLAVLSETGWTLGHILITHHHWDHVQGLAALK 70

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +     + GP     KI G+D  + DGDT   G   +K IATPGHT+  I + F ++   
Sbjct: 71  EATGARVVGPALSRDKIAGLDDTVEDGDTVHVGPWEVKAIATPGHTLDQISWWFPSEGIA 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSF-SDKTHIYFGHEYTENNAYFALSCDPHN 188
             GDTLF+LGCGR+FE     M+ SL+K+      +T IY GHEYT  NA FAL+ DPHN
Sbjct: 131 HTGDTLFALGCGRVFEGDMEMMWASLDKLARLLPPETVIYCGHEYTAANARFALAVDPHN 190

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L+    +V ++R+    T P+T++ E   NPFLR  +  L++ L  E A   AVF E+
Sbjct: 191 AALRARADEVAALRAAGRPTLPTTMARELATNPFLRARDPGLQRALGFEGADPAAVFAEV 250

Query: 249 RIRKNQ 254
           R RK++
Sbjct: 251 RRRKDK 256


>gi|254455862|ref|ZP_05069291.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082864|gb|EDZ60290.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 239

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/249 (40%), Positives = 136/249 (54%), Gaps = 14/249 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I    DN+  LI +   +    +D  +   I   L+ K   L +I NTHHH DH   N 
Sbjct: 5   IIPCLKDNYSYLIIDDSNKSACVVDPSEAEPIINYLKNKDINLKYILNTHHHFDHIGGNE 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           +LKK F+  + G  ++S +IPGID  L DG  ++  +   KII  PGHT GHIC++F  +
Sbjct: 65  DLKKEFSSIVVGFKKDSERIPGIDIFLEDGQIWEADNFKAKIIHVPGHTTGHICFNFFQE 124

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
                GDTLFSLGCGRIFE +Y +M+ESL KIKS   +T IY GHEYT +N+ F +  DP
Sbjct: 125 KLAFTGDTLFSLGCGRIFEGTYEQMYESLNKIKSLPKETKIYCGHEYTLSNSKFCMENDP 184

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  LQK   ++K + S  L T P+TI  E   N FLR +N              L  F+
Sbjct: 185 DNQNLQKKIEQIKKLTSNGLPTIPTTIKEELDCNIFLRAKN--------------LESFS 230

Query: 247 ELRIRKNQS 255
           +LR  K+  
Sbjct: 231 KLRDLKDNF 239


>gi|195495786|ref|XP_002095415.1| GE19704 [Drosophila yakuba]
 gi|194181516|gb|EDW95127.1| GE19704 [Drosophila yakuba]
          Length = 348

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 124/263 (47%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 87  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 146

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G+  +K ++TP HT GHI
Sbjct: 147 DHAGGNEKL-VKLWEKELDVYGGDDRIGALNKRVQQDDTFTIGALNVKCLSTPCHTTGHI 205

Query: 120 CYHFMN-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 206 CYHVTTPEGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDTTKVFCGHEY 265

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 266 TLQNMSFARHVEPDNELIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 325

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 326 AGGA-TDPIVTMGKLRKEKDTFK 347


>gi|75906553|ref|YP_320849.1| beta-lactamase-like protein [Anabaena variabilis ATCC 29413]
 gi|123610796|sp|Q3MGD2|GLO2_ANAVT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|75700278|gb|ABA19954.1| Beta-lactamase-like protein [Anabaena variabilis ATCC 29413]
          Length = 257

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 95/256 (37%), Positives = 135/256 (52%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  L+H+ +  + A +D  +   + K L +    L  IFNTHHH DH   N
Sbjct: 4   IRLAALSDNYIFLLHDSQKNIAAVVDPAEAEPVLKQLAQLNAELVAIFNTHHHNDHVGGN 63

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              ++ F    ++G  E+  +IPG    L  GD   F     ++I  PGHT  HI Y+F 
Sbjct: 64  QQLIQNFPQLKVYGGAEDKGRIPGQQVFLQPGDRVQFTDRVAEVIFVPGHTRAHIAYYFP 123

Query: 125 NDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                       GDTLF+ GCGR+FE + A+M ESL K++S  + T ++  HEYT  N  
Sbjct: 124 PQTADTPGELFCGDTLFAGGCGRLFEGTPAQMVESLTKLRSLPENTRVWCAHEYTLKNLQ 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS D  N ELQK   +VK+ RSQ + T PS + +EK  NPFLR E  SL+  +N    
Sbjct: 184 FALSVDSENTELQKRFDEVKTKRSQGIATVPSLLGVEKLTNPFLRWEQPSLQSAVNSN-- 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F  +R  K++ 
Sbjct: 242 DPVQTFARIRGLKDKF 257


>gi|167836208|ref|ZP_02463091.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis
           MSMB43]
          Length = 268

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHR 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L            FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLATAREGEPLAVFGPAHEAIEHITRRVTGGERVRIGSPALEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+
Sbjct: 179 HEYTLSNIQFALACEPENAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSI 238

Query: 231 RK----NLNMENASNLAVFTELRIRKNQSK 256
           R      L+      LA FT +R  KN+ +
Sbjct: 239 RATLETQLHEAAPDRLAAFTLMREWKNRFR 268


>gi|195019128|ref|XP_001984915.1| GH16754 [Drosophila grimshawi]
 gi|193898397|gb|EDV97263.1| GH16754 [Drosophila grimshawi]
          Length = 303

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/261 (31%), Positives = 127/261 (48%), Gaps = 7/261 (2%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           + S+ + I     DN+  LI ++K R  A +D  D  ++ K ++E+   L  +  THHH 
Sbjct: 44  LESMQVKILPALQDNYMYLIVDNKTREAAIVDPVDPELVIKTVQEENVKLNKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +S   TF+ G   ++ ++TP HT GHI
Sbjct: 104 DHAGGNEKL-VKLWSGELQVYGGDDRIGAMNQKVSQDVTFNIGELKVRCLSTPCHTTGHI 162

Query: 120 CYHFMNDHF---LCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           CYH  N      +  GDTLF  GCGR FE +  EM+++   K+ +  D T ++ GHEYT 
Sbjct: 163 CYHVTNGQNAGAVFTGDTLFQGGCGRFFEGTPEEMYDALCAKLSALPDDTKVFCGHEYTL 222

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+   +++++  
Sbjct: 223 QNMSFARHVEPDNKLIQNRIEWAKLRRASKDPTVPSTIGEEKSWNPFMRVHEATVQRHAG 282

Query: 236 MENASNLAVFTELRIRKNQSK 256
            E  + +     LR  K+  K
Sbjct: 283 GEK-NPILTMGALRKEKDNFK 302


>gi|154707223|ref|YP_001425097.1| hydroxyacylglutathione hydrolase [Coxiella burnetii Dugway
           5J108-111]
 gi|161830842|ref|YP_001596265.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 331]
 gi|212213176|ref|YP_002304112.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuG_Q212]
 gi|154356509|gb|ABS77971.1| hydroxyacylglutathione hydrolase [Coxiella burnetii Dugway
           5J108-111]
 gi|161762709|gb|ABX78351.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 331]
 gi|212011586|gb|ACJ18967.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuG_Q212]
          Length = 257

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 127/259 (49%), Gaps = 6/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH D
Sbjct: 1   MPHNILAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     + +     ++G +E +              +  +      ++A PGHT+ H+ 
Sbjct: 61  HTNGIQGILQKHPAPVYGSVESAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+   D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  F
Sbjct: 121 YY--ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLDPTTRVYCGHEYTVKNLEF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           A + +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +      
Sbjct: 179 AETVEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGY 238

Query: 237 ENASNLAVFTELRIRKNQS 255
             A  +AVF  LR  K++ 
Sbjct: 239 PLADTVAVFAALRRWKDEF 257


>gi|297538711|ref|YP_003674480.1| hydroxyacylglutathione hydrolase [Methylotenera sp. 301]
 gi|297258058|gb|ADI29903.1| hydroxyacylglutathione hydrolase [Methylotenera sp. 301]
          Length = 260

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 121/251 (48%), Gaps = 3/251 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+HN      A +D  D   +   L      LT I  THHH DH    
Sbjct: 12  IPIPAFKDNYIWLVHNDAQG--AVVDPGDAAPVIAALNHLKLTLTTILITHHHHDHIGGV 69

Query: 66  LNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + F    ++ P  E      I     +       +    I+  PGHT GHI Y+  
Sbjct: 70  AELLEAFPQAIVYAPALEQYAFEHIAISEQNSVHLKDLNISFSILDLPGHTSGHIAYYSA 129

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               +  GDTLF  GCGR+FE +  +M+ SL+K+ +    T +Y  HEYT +N  FAL+ 
Sbjct: 130 QHKLIFCGDTLFGAGCGRLFEGTPTQMYHSLQKLAALPSATKVYCTHEYTMHNINFALTF 189

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           +P N  L +     + +R  N+ + PSTI LE   NPFLR  +  ++ ++ + NAS +  
Sbjct: 190 EPSNQILIERHKNTQKLRDSNIPSLPSTIELELATNPFLRCNHQEIKSSIQLTNASEIET 249

Query: 245 FTELRIRKNQS 255
           FT+LR  +N  
Sbjct: 250 FTKLRELRNHY 260


>gi|163869372|ref|YP_001610628.1| hydroxyacylglutathione hydrolase [Bartonella tribocorum CIP 105476]
 gi|189041217|sp|A9IZW8|GLO2_BART1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|161019075|emb|CAK02633.1| hydroxyacylglutathione hydrolase [Bartonella tribocorum CIP 105476]
          Length = 253

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 158/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+ K  +TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK
Sbjct: 8   CRKDNFGVLIHDEKSGMTAAIDAPESKAIHNALKRRNWTLHTIFVTHHHHDHVEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +N  +FGP  E +KI  +D  L   +   FGS  +  ++TPGHT+G + Y+F     L
Sbjct: 68  QVYNAIVFGPAAEKNKIYHLDQTLQSDEKLLFGSQSLLALSTPGHTLGALSYYFPEKKLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE +  +M  SL+K+    D+T +Y GHEYT+NNA FAL+ DPHN 
Sbjct: 128 FAGDTLFSLGCGRLFEGTAVQMLNSLKKLCKLPDETLLYCGHEYTKNNALFALTLDPHNQ 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +LQ+   +V S+R++N  T P T+  EK  NPFLR  + ++RKNL+M+++++  VF E+R
Sbjct: 188 KLQQRAEEVLSLRAKNAMTLPVTLGQEKATNPFLRWNDPAIRKNLSMKDSTDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDNF 253


>gi|21356335|ref|NP_649258.1| CG4365, isoform A [Drosophila melanogaster]
 gi|10726918|gb|AAF51642.2| CG4365, isoform A [Drosophila melanogaster]
 gi|16769332|gb|AAL28885.1| LD26447p [Drosophila melanogaster]
 gi|220944250|gb|ACL84668.1| CG4365-PA [synthetic construct]
 gi|220954192|gb|ACL89639.1| CG4365-PA [synthetic construct]
          Length = 305

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 44  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 104 DHAGGNEKL-LKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 162

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 163 CYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 222

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 223 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 282

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 283 AGGA-TDPVVTMGKLRKEKDTFK 304


>gi|2570342|gb|AAC49867.1| glyoxalase II cytoplasmic isozyme [Arabidopsis thaliana]
          Length = 256

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 68/254 (26%), Positives = 117/254 (46%), Gaps = 9/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +      A +D  D   +     +    +  +  THHH DH   N  
Sbjct: 6   VPCLQDNYTYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           +K+                  +   +   D   +  + I  + TP HT GHI Y+     
Sbjct: 66  IKQLVPDIKVYGGSLDKVKVALMRLI--CDKLTWSGYNILALHTPCHTKGHISYYVTGKE 123

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             +  +  GDTLF  GCG+ FE +  +M++S    + +    T +Y GHEYT  N  FAL
Sbjct: 124 GENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLAALPKPTQVYCGHEYTVKNLEFAL 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P+N ++Q+  +  +  R  +L T PST+  E + NPF+R++   +++ L  +  S +
Sbjct: 184 TVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGCK--SPI 241

Query: 243 AVFTELRIRKNQSK 256
               E+R +K+Q +
Sbjct: 242 DTMREVRNKKDQWR 255


>gi|119898348|ref|YP_933561.1| hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
 gi|119670761|emb|CAL94674.1| probable hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
          Length = 253

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 120/254 (47%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++H+        +D  D   +   L E+G  L  +  THHH DH    
Sbjct: 4   IPLPAFRDNYIWVLHDDH--RAVVVDPGDAAPVLGFLAERGLALEAVLVTHHHPDHVDGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +       ++GP  E+     +     D          + ++  PGHT GHI YH   
Sbjct: 62  AGIVSRHPAPVYGPAAEAIAGVTVRLREGDTVLLPGLRMQLGVLDVPGHTAGHIAYHGKG 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M  SL+K+ +  D T +Y  HEYT +N  FA + +
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTAAQMAASLDKLAALPDDTVVYCTHEYTLSNLAFAAAAE 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASN 241
           P N+E   Y    +++R Q L T P++I  EK +NPFLR     +      +      + 
Sbjct: 180 PVNIERDNYRKACEALRQQGLPTLPTSIGREKAINPFLRTRQPGVVAGVAAHTGTTPDTP 239

Query: 242 LAVFTELRIRKNQS 255
           LA F  LR  KN  
Sbjct: 240 LACFAALREWKNVF 253


>gi|29653665|ref|NP_819357.1| hydroxyacylglutathione hydrolase [Coxiella burnetii RSA 493]
 gi|29540927|gb|AAO89871.1| hydroxyacylglutathione hydrolase [Coxiella burnetii RSA 493]
          Length = 257

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 128/259 (49%), Gaps = 6/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH D
Sbjct: 1   MPHNILAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     + +     ++G +E +              +  +      ++A PGHT+ H+ 
Sbjct: 61  HTNGIQGILQKHPAPVYGSVESAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+   D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  F
Sbjct: 121 YY--ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLGPTTRVYCGHEYTVKNLEF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           A + +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +      
Sbjct: 179 AETVEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGY 238

Query: 237 ENASNLAVFTELRIRKNQS 255
             A  +AVF+ LR  K++ 
Sbjct: 239 PLADTVAVFSALRRWKDEF 257


>gi|82702748|ref|YP_412314.1| hydroxyacylglutathione hydrolase [Nitrosospira multiformis ATCC
           25196]
 gi|82410813|gb|ABB74922.1| Hydroxyacylglutathione hydrolase [Nitrosospira multiformis ATCC
           25196]
          Length = 264

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 125/268 (46%), Gaps = 17/268 (6%)

Query: 1   MTSLN--IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHH 58
           MT+    + I  + DN+  LI +  +   A ID  D   +   L  +   L  I NTHHH
Sbjct: 1   MTTTPNIVPIHAFKDNYIWLIRD--HYHAAVIDPGDASPVLDYLSREKLKLIAILNTHHH 58

Query: 59  IDHTRANLNLKKFFNCTIFGPLE-------ESSKIPGIDHGLSDGDTFDFGSHPIKIIAT 111
            DH   N  L + F   +FGP +          K                 S   +++  
Sbjct: 59  PDHVGGNAELLREFAVPVFGPAKESIPTLTHRLKECSDIENEEGCVYLPEFSLSFRVLDI 118

Query: 112 PGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGH 171
           PGHT GHI Y+    + L  GDTLF  GCGR+FE +  +M +SL+K+      T IY GH
Sbjct: 119 PGHTSGHIAYYG--ANMLFCGDTLFGCGCGRLFEGTAQQMVDSLKKLADLPKDTLIYCGH 176

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR 231
           EYT +N  FA + +P N  L K   + + +R++ L T PSTI+LEK  NPFLR     + 
Sbjct: 177 EYTLSNIRFARTVEPGNQALAKREVEAEKLRNEGLPTLPSTIALEKATNPFLRCTEAEVI 236

Query: 232 K----NLNMENASNLAVFTELRIRKNQS 255
           +    +        ++VF  +R  KN  
Sbjct: 237 ESASNHAGKPLNDRVSVFAAIREWKNHF 264


>gi|297743843|emb|CBI36726.3| unnamed protein product [Vitis vinifera]
          Length = 300

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           ++L I  +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH D
Sbjct: 45  STLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHD 104

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI 
Sbjct: 105 HTGGNAELKARYGAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHIS 164

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ F
Sbjct: 165 FYFPGSGAIFTGDTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKF 224

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS +P N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +   A
Sbjct: 225 ALSIEPKNEVLQSYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATA 284

Query: 240 SNLAVFTELRIRKNQS 255
            +      +R  K+  
Sbjct: 285 DDSEALGIIREAKDNF 300


>gi|90414052|ref|ZP_01222035.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum 3TCK]
 gi|90324847|gb|EAS41375.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum 3TCK]
          Length = 252

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 98/257 (38%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH D
Sbjct: 1   MLTVQ-SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ +             IPGI   + DGD  +       ++  PGHT+GH+ 
Sbjct: 59  HIGGISELKRHYPNLNVVGPAS-EPIPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQ+Y  +V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  +
Sbjct: 176 ALVAEQDNPHLQRYREEVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K+  
Sbjct: 236 DSDLETFAALRRWKDNF 252


>gi|225433994|ref|XP_002271863.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
          Length = 321

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           ++L I  +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH D
Sbjct: 66  STLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHD 125

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI 
Sbjct: 126 HTGGNAELKARYGAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHIS 185

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ F
Sbjct: 186 FYFPGSGAIFTGDTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKF 245

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS +P N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +   A
Sbjct: 246 ALSIEPKNEVLQSYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATA 305

Query: 240 SNLAVFTELRIRKNQS 255
            +      +R  K+  
Sbjct: 306 DDSEALGIIREAKDNF 321


>gi|225433992|ref|XP_002271795.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
          Length = 329

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 101/256 (39%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           ++L I  +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH D
Sbjct: 74  STLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHD 133

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L DGD + F  H + +I TPGHT GHI 
Sbjct: 134 HTGGNAELKARYGAKVIGSGIDKDRIPGIDIVLKDGDKWMFAGHEVVVIETPGHTRGHIS 193

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL KI S  D+T+IY GHEYT +N+ F
Sbjct: 194 FYFPGSGAIFTGDTLFSLSCGKLFEGTPEQMHSSLSKIMSLPDETNIYCGHEYTLSNSKF 253

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS +P N  LQ Y + V  +RS+ L T P+T+ +EK  NPFLR  +  +RK+L +   A
Sbjct: 254 ALSIEPKNEVLQSYATHVAHLRSKGLPTIPTTLKMEKMCNPFLRTSSPEIRKSLKITATA 313

Query: 240 SNLAVFTELRIRKNQS 255
            +      +R  K+  
Sbjct: 314 DDSEALGIIREAKDNF 329


>gi|312282419|dbj|BAJ34075.1| unnamed protein product [Thellungiella halophila]
          Length = 258

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 73/254 (28%), Positives = 116/254 (45%), Gaps = 7/254 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +      A +D  D   +    ++ G  +  +  THHH DH   N  
Sbjct: 6   VPCLQDNYSYLIIDESTGDAAVVDPVDPEKVIISAQQHGANIKFVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           +K+                   +   +           I  + TP HT GHI Y+     
Sbjct: 66  MKELVPGIKVYGGSLDKVKGCTNEVDNGDKLSLGHGVNILALHTPCHTKGHISYYVTCKD 125

Query: 126 --DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             +  +  GDTLF  GCG+ FE +  +M +S    + S    T +Y GHEYT  N  FAL
Sbjct: 126 GENPTVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVKNLEFAL 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P+N ++Q+  S     R +NL T PSTI  E + NPF+R++N  +++ L  +  S +
Sbjct: 186 TVEPNNEKIQQKLSWACQQRQENLPTIPSTIEEELETNPFMRVDNPEIQEKLGCK--SPI 243

Query: 243 AVFTELRIRKNQSK 256
               E+R +K+Q +
Sbjct: 244 DTLREIRNKKDQWR 257


>gi|221201958|ref|ZP_03574994.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2M]
 gi|221204912|ref|ZP_03577929.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2]
 gi|221213889|ref|ZP_03586862.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD1]
 gi|221166066|gb|EED98539.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD1]
 gi|221175769|gb|EEE08199.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2]
 gi|221178041|gb|EEE10452.1| hydroxyacylglutathione hydrolase [Burkholderia multivorans CGD2M]
          Length = 268

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 85/270 (31%), Positives = 135/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAEPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNC----TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP +E+  +           T D  +    ++A PGHT
Sbjct: 59  DHVGGVAALQDSQPADVPLPVYGPADEAIGVVAHPLAGGARVTLDAPAATFDVLAVPGHT 118

Query: 116 IGHICYH-----FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPHTPVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + +++R++ + T P+TI+ E+ VNPFLR +  ++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDEAQALRARGVPTLPTTIAHERAVNPFLRADAAAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E        L  FT +R  KN+ +
Sbjct: 239 HATLEAELHESVPDRLTAFTLMREWKNRFR 268


>gi|134295350|ref|YP_001119085.1| hydroxyacylglutathione hydrolase [Burkholderia vietnamiensis G4]
 gi|134138507|gb|ABO54250.1| Hydroxyacylglutathione hydrolase [Burkholderia vietnamiensis G4]
          Length = 268

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 135/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +           T D  +    ++  PGHT
Sbjct: 59  DHVGGVAALRDSQPDDAPLVVYGPAAEAIGVVTRPLAGGARVTLDAPALAFDVLDVPGHT 118

Query: 116 IGHICYHFMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y     H      +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQAAGHGAAIPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPFLR ++ ++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDDAQALRARGMPTLPTTIAHERAVNPFLRADSAAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E        LA FT +R  KN+ +
Sbjct: 239 HATLEAELHETVPDRLAAFTLMREWKNRFR 268


>gi|312883830|ref|ZP_07743549.1| hydroxyacylglutathione hydrolase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368579|gb|EFP96112.1| hydroxyacylglutathione hydrolase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 252

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   +  A +D  D+  +   L +    L  I  THHH D
Sbjct: 1   MLDIK-SIPAFNDNYIWLIENSD-KRCAIVDPGDSAPVLDYLAQHNLVLEAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + +        +E   IP + H +S GD  +  +    ++   GHT+GHI 
Sbjct: 59  HIGGVAELVRQYPGINVVGPKE-EPIPTLTHAVSGGDQIELFNEIFMVLDIGGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +M  SL+KI +  D+T ++  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMHSSLQKIAALPDETEVFCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL+ +P N  LQ+Y  +V  MR+Q + T P+++  EK +NPFLR E  ++ ++++     
Sbjct: 176 ALAVEPENPYLQQYRDEVNRMRAQQIPTLPTSLQREKLINPFLRTEEKNIVRSVSNRTVK 235

Query: 239 ASNLAVFTELRIRKNQS 255
             +LAVFT LR  KN+ 
Sbjct: 236 TDSLAVFTALREWKNEF 252


>gi|237746599|ref|ZP_04577079.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes HOxBLS]
 gi|229377950|gb|EEO28041.1| hydroxyacylglutathione hydrolase [Oxalobacter formigenes HOxBLS]
          Length = 265

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 76/256 (29%), Positives = 123/256 (48%), Gaps = 11/256 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+  +I +++ R    +D  +   +   L+++   L+ I  TH H DH     
Sbjct: 13  PIPAFRDNYIWMI-DNRTR-AVVVDPGEAGPVLSTLKKRSLKLSAILLTHRHEDHIGGVA 70

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI---KIIATPGHTIGHICYHF 123
            L +  +  ++GP      +  + H L +GD             ++  PGHT GHI Y+ 
Sbjct: 71  RLLQEADVPVYGPRY--DPVVSVTHPLQEGDIVTLPDLDNLALSVLDVPGHTRGHIAYYA 128

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             + +L  GD LF  GCGR+FE +  +M  SL K+ +  D   ++ GHEYT +N  FA  
Sbjct: 129 KKEKWLFCGDMLFGAGCGRMFEGTPEQMLASLSKLAALPDDVQVFAGHEYTLSNLKFARE 188

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NMENA 239
            +P N  + +   +  + R++   T PSTI LEK  NPFLR     + K L    +++N 
Sbjct: 189 IEPGNEAIAERARQDLARRNRGRPTLPSTIGLEKATNPFLRANREDVMKRLEELGHLKNR 248

Query: 240 SNLAVFTELRIRKNQS 255
           + +  F  +R  KN  
Sbjct: 249 NPVDCFAAMREWKNSY 264


>gi|195127700|ref|XP_002008306.1| GI13415 [Drosophila mojavensis]
 gi|193919915|gb|EDW18782.1| GI13415 [Drosophila mojavensis]
          Length = 301

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 80/261 (30%), Positives = 125/261 (47%), Gaps = 9/261 (3%)

Query: 3   SLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S+ + I     DN+  LI + K +  A +D  D  ++ K ++E    L  +  THHH DH
Sbjct: 42  SMQVKILPALQDNYMYLIVDSKTKEAAVVDPVDPELVIKTVKESNVKLNKVLTTHHHWDH 101

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
              N  L                +I  ++H +   +TF  G+  ++ ++TP HT GHICY
Sbjct: 102 AGGNERL-VKMWDGKLEVYGGDERIGAMNHKVCQDETFTIGTLKVRCLSTPCHTSGHICY 160

Query: 122 HFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           +    +         GDTLF  GCGR FE +  EM+++   K+ +  D T ++ GHEYT 
Sbjct: 161 YVTATNGNEAGAVFTGDTLFQGGCGRFFEGTPEEMYDALCAKLSALPDDTKVFCGHEYTL 220

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+   +++ +  
Sbjct: 221 QNMSFARHVEPDNKNVQNRIEWAKLRRATKDPTVPSTIGEEKLWNPFMRVHEATVQNHAG 280

Query: 236 MENASNLAVFTELRIRKNQSK 256
           + +A+ +     LR  K+  K
Sbjct: 281 I-SANPIGTMEALRKEKDNFK 300


>gi|224093054|ref|XP_002309787.1| predicted protein [Populus trichocarpa]
 gi|118483171|gb|ABK93490.1| unknown [Populus trichocarpa]
 gi|118485660|gb|ABK94680.1| unknown [Populus trichocarpa]
 gi|222852690|gb|EEE90237.1| predicted protein [Populus trichocarpa]
          Length = 328

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 149/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   +   L  K W LT+I NTHHH D
Sbjct: 73  SSLQIELVPCLKDNYAYLLHDEDTGTVGVVDPSEATPVIDALSRKNWNLTYILNTHHHHD 132

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  LK  +   + G   +  +IPGID  L+DGD + F  H ++++ TPGHT GHI 
Sbjct: 133 HTGGNQELKARYGAKVIGSGVDKDRIPGIDIVLNDGDKWMFAGHEVQVMDTPGHTRGHIS 192

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T+IY GHEYT +N+ F
Sbjct: 193 FYFPGSGAIFTGDTLFSLSCGKLFEGTPEQMLSSLKKIVSLPDDTNIYCGHEYTLSNSKF 252

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NA 239
           ALS +P+N  LQ Y + +  +RS++L T P+ + +EK  NPFLR  +T +R+ LN+   A
Sbjct: 253 ALSIEPNNEALQSYAAHIAHLRSKSLPTIPTKLKVEKACNPFLRTSSTEIRQTLNIPATA 312

Query: 240 SNLAVFTELRIRKNQS 255
           S+      +R  K+  
Sbjct: 313 SDSETLGVIRQAKDNF 328


>gi|153208786|ref|ZP_01947018.1| metallo-beta-lactamase family protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165920929|ref|ZP_02219599.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 334]
 gi|212218149|ref|YP_002304936.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuK_Q154]
 gi|120575748|gb|EAX32372.1| metallo-beta-lactamase family protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165916777|gb|EDR35381.1| metallo-beta-lactamase family protein [Coxiella burnetii RSA 334]
 gi|212012411|gb|ACJ19791.1| hydroxyacylglutathione hydrolase [Coxiella burnetii CbuK_Q154]
          Length = 257

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 127/259 (49%), Gaps = 6/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    +AI   +DN+   I + + +    ID  +   +   L+++   L  I  THHH D
Sbjct: 1   MPHNILAIPALNDNYIWTIVHPQKQAAVIIDPGEAKPVLDFLKQQKLNLAAILVTHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     + +     ++G +E +              +  +      ++A PGHT+ H+ 
Sbjct: 61  HTNGIQGILQKHPAPVYGSVESAIPFCDHPIVDGQTFSIPYAELTFNVLAIPGHTLDHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+   D ++  GDTLF+ GCGRIFE S  + + SL+K+ S    T +Y GHEYT  N  F
Sbjct: 121 YY--ADQWVYTGDTLFAGGCGRIFEGSPDQFYHSLQKLASLDPTTRVYCGHEYTGKNLEF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           A + +P N +L++   +     SQNL T PST+ +E   NPFLR    ++++ +      
Sbjct: 179 AETVEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLRCHQKNIQRRVQEYCGY 238

Query: 237 ENASNLAVFTELRIRKNQS 255
             A  +AVF  LR  K++ 
Sbjct: 239 PLADTVAVFAALRRWKDEF 257


>gi|84500105|ref|ZP_00998371.1| hydroxyacylglutathione hydrolase, putative [Oceanicola batsensis
           HTCC2597]
 gi|84392039|gb|EAQ04307.1| hydroxyacylglutathione hydrolase, putative [Oceanicola batsensis
           HTCC2597]
          Length = 254

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 87/256 (33%), Positives = 128/256 (50%), Gaps = 3/256 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+          IDAP+   +    +++GW    +  THHH D
Sbjct: 1   MPLDIVTVPCRSDNYAYLVKGPDG--VCIIDAPEAAPLIAAAKDRGWTPDVLMITHHHGD 58

Query: 61  HTRANLNLKKFFNCTIFG-PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           HT    +LK  F       P  E  K+P +D  LS+G     G      +  PGHT+GH+
Sbjct: 59  HTAGTDDLKAAFPGLRVMGPKAEEDKLPPLDMALSEGMNGGEGEAYTVPLDVPGHTLGHM 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +HF     +   D+L S GCGR+FE +   M  +L+K+ +   +T IY GHEYT  N  
Sbjct: 119 AFHFPEAGVIFTADSLMSWGCGRVFEGTPEMMHATLQKLAALLPETLIYSGHEYTLANMK 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS +P N +L     KV++ R     T P T++ E K NPFLR +   + K + ME A
Sbjct: 179 FALSIEPDNPDLLARADKVQAQRDAGEATVPVTLAEELKTNPFLRCDTPQVAKAVGMEGA 238

Query: 240 SNLAVFTELRIRKNQS 255
           + + +F E+R RK+  
Sbjct: 239 APVDIFAEVRKRKDNF 254


>gi|239815321|ref|YP_002944231.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus S110]
 gi|239801898|gb|ACS18965.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus S110]
          Length = 259

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 82/260 (31%), Positives = 122/260 (46%), Gaps = 13/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++ +        +D  D   +   L      L  I  THHH DHT   
Sbjct: 4   VPLPAFADNYIWMLQDGSN--AIVVDPGDAQPVFDALARDKLQLAAILVTHHHPDHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             L       +FGP     +IP     LS GDT +       +I  PGHT GHI Y    
Sbjct: 62  AALHAATGAPVFGPAR--ERIPQPFKPLSHGDTAEVLGLRFSVIDVPGHTAGHIAYFLPA 119

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT  N  FA
Sbjct: 120 SAGRAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDALAALPGDTRVCCAHEYTLANLRFA 179

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME---- 237
            + +P N +L +Y +  +S+R+Q   T PS ++ E+++NPFLR    ++ + +       
Sbjct: 180 RAVEPGNADLTQYSAHCESLRAQGRPTLPSQLATERRINPFLRSREATVLRAVREHAELS 239

Query: 238 -NASNLAVFTELRIRKNQSK 256
            +A+   VF  LR  KN  +
Sbjct: 240 ADAAEAEVFAALRQWKNDFR 259


>gi|218441771|ref|YP_002380100.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7424]
 gi|226723986|sp|B7KEB4|GLO2_CYAP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218174499|gb|ACK73232.1| hydroxyacylglutathione hydrolase [Cyanothece sp. PCC 7424]
          Length = 257

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 94/261 (36%), Positives = 142/261 (54%), Gaps = 10/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M      +    DN+  L+H+ +  + A +D  +   +   L++ G  L  IFNTHHH D
Sbjct: 1   MKIFR--LPALSDNYIFLLHDPQRNIAAVVDPAEPEPVLTCLKKLGAELVTIFNTHHHGD 58

Query: 61  HTRANLNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           H  AN  L + F   T++G  E+  +IPG +  L +GD   FG    ++   PGHT  HI
Sbjct: 59  HVGANRALIEHFPNLTVYGGEEDRGRIPGQEVFLKEGDRVQFGDRSGEVFFVPGHTRAHI 118

Query: 120 CYHFMNDHF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y+F          L  GDT+F+ GCGR+FE + A+M  SL K+++  D T I+  HEYT
Sbjct: 119 AYYFPPQGEEETGELFCGDTIFAGGCGRLFEGTPAQMVNSLSKLRALPDNTRIWCAHEYT 178

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            NN  FAL+ +P N++LQ   S VK  RS+   T PS + +EK  NPFLR +  +++  +
Sbjct: 179 LNNLKFALTVEPENIDLQNRFSDVKIARSEGEATVPSLLGIEKLTNPFLRWDTQAIKSAM 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +++  + VF  LR +K+  
Sbjct: 239 GSQDS--VQVFGRLRGKKDNF 257


>gi|319404907|emb|CBI78508.1| hydroxyacylglutathione hydrolase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 253

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 158/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF ILIH+ K   TAAIDAP+   I  ML+++ W L  IF THHH DH  A   LK
Sbjct: 8   CREDNFGILIHDEKSGCTAAIDAPEGKAIYNMLKKRNWTLQFIFVTHHHYDHVEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +N  I GP  ES KI  +DH L   +TF FG+  +  ++TPGHT+G + Y+F     L
Sbjct: 68  QAYNAMIIGPAAESKKITPLDHTLQPDETFCFGTQTLMALSTPGHTLGALSYYFPQAKLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYTE NA FAL+ DP N 
Sbjct: 128 FAGDTLFSLGCGRLFEGTPLKMLTSLKKLRQLPDETILYCGHEYTEKNALFALTIDPQNR 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +   +V S+R+QN  T P+T+  EK+ NPFLR ++  LRKNL ME A++  VF E+R
Sbjct: 188 KLHQRAEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDDPILRKNLAMEKATDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDHF 253


>gi|163793799|ref|ZP_02187773.1| metallo-beta-lactamase family protein [alpha proteobacterium
           BAL199]
 gi|159180910|gb|EDP65427.1| metallo-beta-lactamase family protein [alpha proteobacterium
           BAL199]
          Length = 256

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 97/256 (37%), Positives = 145/256 (56%), Gaps = 1/256 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M +L I  +    DN+  L+H+     TA +D  +   +   L  +GW LT I NTHHH 
Sbjct: 1   MAALEIVLVPALSDNYVYLLHDAGTGATAVVDPGEAPPVEAALAARGWTLTQIVNTHHHH 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT  N  LK  +   + GP  ES++I G+D  + DGDT     H   +  TPGHT GH+
Sbjct: 61  DHTDGNDALKAKYGVPLVGPRAESARIAGMDVMVGDGDTVQVAGHSAIVYETPGHTTGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +H  +   L  GDTLF+LGCGR+FE +  + ++SL  +++    T IY GHEYT++NA 
Sbjct: 121 SFHIPDSQALFCGDTLFALGCGRMFEGTPTQFWKSLSTLRALPSNTKIYCGHEYTQSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA+S D  N +L+   +++  +R+    T PS ++ E   NPFLR ++ ++   + M  A
Sbjct: 181 FAVSVDGGNAKLKARAAEIDRLRAAKQPTVPSILADEFDTNPFLRADDPAMAAAVGMAGA 240

Query: 240 SNLAVFTELRIRKNQS 255
             +AVF E+R RK+  
Sbjct: 241 DPIAVFAEIRKRKDAF 256


>gi|315179367|gb|ADT86281.1| hydroxyacylglutathione hydrolase GloB, hypothetical [Vibrio
           furnissii NCTC 11218]
          Length = 252

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 130/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   +   L +    L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIQNSD-RRCAVVDPGDAAPVLAYLSQHDLTLEAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + +         +   IP + H +  GD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVPELVRQYPNVDVVGPSQ-EPIPTLTHPVDAGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T +Y  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDVLFSAGCGRVFEGTMEQMFTSLSKLVALPEETEVYCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           A++ +P N +LQ Y  +V  +R Q   T PST+  EK +NPFLR +  S+ K++      
Sbjct: 176 AMAVEPDNEQLQIYRDEVIRLRGQGYSTLPSTVRREKWINPFLRTQEPSVMKSVANRTPQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L++FT LR  KN+ 
Sbjct: 236 TDALSIFTALREWKNEF 252


>gi|167562349|ref|ZP_02355265.1| hydroxyacylglutathione hydrolase [Burkholderia oklahomensis EO147]
 gi|167574353|ref|ZP_02367227.1| hydroxyacylglutathione hydrolase [Burkholderia oklahomensis C6786]
          Length = 273

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 86/275 (31%), Positives = 129/275 (46%), Gaps = 21/275 (7%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +       A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSDGS--DAVAVDPGEAAPVRRYLDARGWRLTAILLTHHHG 58

Query: 60  DHTRANLNLKKFFN----CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L           +FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLATSRGGESVAVFGPAHEAIEHVTRRLAGGERVRIGSPALEFDVIDVPGHT 118

Query: 116 IGHICYHFMNDH----------FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
            GHI Y                 L  GDTLFS GCGR+FE + A+M  SL+ + +    T
Sbjct: 119 RGHIAYFQAAGAGPAGPANAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDT 178

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            ++  HEYT +N  FAL+C+P N  L  +  +  + R++N  T P+TI+ E+ VNPFLR 
Sbjct: 179 RVHCAHEYTLSNIKFALACEPDNAALAAWRDEASARRARNEPTLPTTIAHERAVNPFLRA 238

Query: 226 ENTSLRK----NLNMENASNLAVFTELRIRKNQSK 256
           ++ S+R      L+      LA FT +R  KN+ +
Sbjct: 239 DSPSIRATLETQLHEAAPDRLAAFTLMREWKNRFR 273


>gi|319793185|ref|YP_004154825.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus EPS]
 gi|315595648|gb|ADU36714.1| hydroxyacylglutathione hydrolase [Variovorax paradoxus EPS]
          Length = 259

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 120/260 (46%), Gaps = 13/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+        +D  D   +   L      L  I  THHH DHT   
Sbjct: 4   VPLPAFADNYIWMLHDGSS--AIVVDPGDAQPVFDALAHHKLQLAAILVTHHHADHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             L       + GP     +IP         D         ++I  PGHT GHI Y    
Sbjct: 62  AALHAATGAPVHGPAR--ERIPEPFMPYVQADIAQALGLRFEVIDVPGHTAGHIAYFLPA 119

Query: 123 -FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
              ++  L  GDTLFS GCGR+FE + A+M  SL+ + +  D T +   HEYT  N  FA
Sbjct: 120 AEDSEPLLFCGDTLFSGGCGRLFEGTPAQMLASLDALAALPDDTRVCCAHEYTLANLRFA 179

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME---- 237
            + +P N +L  Y ++ +S+R+Q   T PS ++ E+ +NPFLR    ++ + +       
Sbjct: 180 RAVEPGNADLTHYNARCESLRAQGQPTLPSQLATERLINPFLRSREATVLRAVRAHAELS 239

Query: 238 -NASNLAVFTELRIRKNQSK 256
            NA+   VF  LR  KN  +
Sbjct: 240 ANAAEADVFAALRQWKNDFR 259


>gi|255645837|gb|ACU23409.1| unknown [Glycine max]
          Length = 329

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 150/256 (58%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   I   L  K   LT+I NTHHH D
Sbjct: 74  SSLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPIIDALSRKNRNLTYILNTHHHHD 133

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N+ LK  +   + G   +  +IPGID  L+DGD + F  H ++++ TPGHT GHI 
Sbjct: 134 HTGGNVELKARYGAKVIGSGTDKERIPGIDIHLNDGDKWMFAGHEVRVMDTPGHTRGHIS 193

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S SD T+IY GHEYT NN  F
Sbjct: 194 FYFPGSGAIFTGDTLFSLSCGKLFEGTPQQMLSSLKKIMSLSDDTNIYCGHEYTLNNIKF 253

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P N ELQ Y ++V  +RS+ L T P+T+ +EK  NPFLR  + ++R++L +   A
Sbjct: 254 ALSIEPENEELQSYAAQVAYLRSKGLPTIPTTLKVEKACNPFLRTSSAAIRQSLKIAATA 313

Query: 240 SNLAVFTELRIRKNQS 255
           ++      +R  K+  
Sbjct: 314 NDAEALGVIRQAKDNF 329


>gi|116785554|gb|ABK23771.1| unknown [Picea sitchensis]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 72/256 (28%), Positives = 115/256 (44%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LI +      A +D  +   I +     G  +  +  THHH DH   N
Sbjct: 4   VPVPCLEDNYAYLIIDEDTGEAAVVDPVEPQNILQAAEVHGANIKFVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             LKK           +              +     +  IK + TP HT GHI Y    
Sbjct: 64  EELKKLVPGIEVYGGAKDHVKGCTVALEHGDELSLGRTVTIKALHTPCHTKGHISYFLTS 123

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
              +D  +  GDTLF  GCG+ FE S  +M++S  + + S    T ++ GHEYT  N  F
Sbjct: 124 TSGDDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLCKILASLPRSTQVFCGHEYTVKNLRF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A++ +P N  +++  +  +  R +N  T PSTI  E + NPF+R++   L++ +     S
Sbjct: 184 AMTVEPENERIKQKLNWAEQQRRENKPTVPSTIQDELESNPFMRVDRLELKELVGHN--S 241

Query: 241 NLAVFTELRIRKNQSK 256
            + V  E+R  K+  +
Sbjct: 242 PVHVLGEIRQMKDNWR 257


>gi|78065900|ref|YP_368669.1| hydroxyacylglutathione hydrolase [Burkholderia sp. 383]
 gi|77966645|gb|ABB08025.1| Hydroxyacylglutathione hydrolase [Burkholderia sp. 383]
          Length = 268

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 136/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVAALRDSQPDDAPLTVYGPAAEAIGVVTRPLSGGDRVTLDAPAATFDVLDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            +  GDTLFS GCGR+FE + A+M  SL+ + +    TH++  
Sbjct: 119 RGHIAYFQAAGQGNAAPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTHVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ ++
Sbjct: 179 HEYTLSNIRFALACEPGNTALATWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSDAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
           R  L  E        L  FT +R  KN+ +
Sbjct: 239 RATLEAELHETVPDRLTAFTLMREWKNRFR 268


>gi|255559751|ref|XP_002520895.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
 gi|223540026|gb|EEF41604.1| hydroxyacylglutathione hydrolase, putative [Ricinus communis]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 72/254 (28%), Positives = 111/254 (43%), Gaps = 7/254 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D  D   I +     G  L  +  THHH DH   N+ 
Sbjct: 6   VPCLEDNYAYLIIDEATKEAAVVDPVDPDKILQAANHHGAHLKLLLTTHHHWDHAGGNVK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           +K+ F           +         +           I  + TP HT GHI Y+     
Sbjct: 66  MKELFPGIQICGGSLDNVKGCTHQLDNGDKLTLGSHVNILSLHTPCHTKGHISYYVTGKE 125

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             D  +  GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT  N  FA 
Sbjct: 126 GEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTKVYCGHEYTLKNLQFAQ 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P N+++Q+     +  R   L T PSTI  E + NPF+R +   L+  +  E  S +
Sbjct: 186 TVEPDNVKIQQKLQWAQKQRQAGLPTIPSTIEEEWETNPFMRADLPELKARVGCE--SPV 243

Query: 243 AVFTELRIRKNQSK 256
               ++R  K+  +
Sbjct: 244 ETLQKIRQLKDNWR 257


>gi|158338875|ref|YP_001520052.1| hydroxyacylglutathione hydrolase [Acaryochloris marina MBIC11017]
 gi|189041215|sp|B0BZI8|GLO2_ACAM1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|158309116|gb|ABW30733.1| hydroxyacylglutathione hydrolase, putative [Acaryochloris marina
           MBIC11017]
          Length = 257

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 138/259 (53%), Gaps = 9/259 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + I  +  + DN+  ++H+    + A +D  D   + K L E G  L  IFNTHHH DH 
Sbjct: 1   MQIHRLPAFSDNYIFVLHDPGQNIAAVVDPADPQPVLKKLAELGAELVAIFNTHHHSDHV 60

Query: 63  RANLNL-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             N  L + F N  ++G  ++  +IPG  H L +GD   F     ++   PGHT  HI Y
Sbjct: 61  GGNRTLLQAFPNTVVYGGEQDRGRIPGQQHFLKEGDQVSFAHRRAEVYFVPGHTRAHIAY 120

Query: 122 HFMN-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           +F          L  GDTLF+ GCGR+FE + A+M +SL K+++  + T ++  HEYT  
Sbjct: 121 YFPPTTGEEWGELFCGDTLFAGGCGRLFEGTPAQMVDSLSKLRNLPETTRVWCAHEYTLK 180

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FAL+ D  N  L+    +V++ R+ +  T PS I LEK+ NPFLR +   L   ++ 
Sbjct: 181 NLQFALTVDSDNSHLKNRFKQVQNARNLSQPTVPSDIGLEKQTNPFLRWDQPHLI--IHT 238

Query: 237 ENASNLAVFTELRIRKNQS 255
           ++ + +  F  LR  K+Q 
Sbjct: 239 KSNTPVQCFARLRGMKDQF 257


>gi|160395581|sp|Q6LN63|GLO2_PHOPR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
          Length = 252

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 98/257 (38%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH D
Sbjct: 1   MLTVQ-SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ +             IPGI   + DGD  +       ++  PGHT+GH+ 
Sbjct: 59  HIGGISELKRHYPNLNVVGPAS-EPIPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  F
Sbjct: 118 YVG--DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQ+Y   V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  +
Sbjct: 176 ALVAEQDNPHLQRYREDVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K+  
Sbjct: 236 DSDLETFAALRRWKDNF 252


>gi|251788638|ref|YP_003003359.1| hydroxyacylglutathione hydrolase [Dickeya zeae Ech1591]
 gi|247537259|gb|ACT05880.1| hydroxyacylglutathione hydrolase [Dickeya zeae Ech1591]
          Length = 251

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 125/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  ++DN+  L+ N K +    +D  D + + + L + G F   I  THHH DHT   
Sbjct: 4   ISVPAFNDNYIWLLANDK-KQCVIVDPGDAHPVLQALDKHGLFPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +         E+ +       +  GDT         I   PGHT GHI Y+   
Sbjct: 63  RQLADHYPGIQIYGPLETKRCGATHT-VQAGDTITAAGSEFSIFFVPGHTAGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +MFESL K+    DKT I   HEYT +N  FA    
Sbjct: 120 SPYLFCGDTLFSAGCGRIFEGTAQQMFESLSKLADLPDKTQICCAHEYTLSNLEFAHHVW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NLA 243
           P + ++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L++   +  +  
Sbjct: 180 PEDADIHDYLLKIRQLREKGESSLPSTLGRERRINIFLRCHDFDLKRKLSINTGTQGDWQ 239

Query: 244 VFTELRIRKNQS 255
           +F  LR  K+  
Sbjct: 240 IFVHLRAMKDHF 251


>gi|54310045|ref|YP_131065.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum SS9]
 gi|46914484|emb|CAG21263.1| putative hydroxyacylglutathione hydrolase GloB [Photobacterium
           profundum SS9]
          Length = 264

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 98/257 (38%), Positives = 140/257 (54%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  +I  ++DN+  LIHN  +     +D  D   + K+L E+   L  I  THHH D
Sbjct: 13  MLTVQ-SIPAFNDNYIWLIHN-SHNHCVVVDPGDATPVLKVLEEQSLTLDAILITHHHHD 70

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+ +             IPGI   + DGD  +       ++  PGHT+GH+ 
Sbjct: 71  HIGGISELKRHYPNLNVVGPAS-EPIPGISQSVEDGDQVELFGERFMVLGVPGHTLGHVA 129

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GDTLFS+GCGR+FE + A+MF+SL+K+ +  D+T IY  HEYT +N  F
Sbjct: 130 YVG--DGKLFCGDTLFSVGCGRLFEGTPAQMFQSLKKLAALPDETEIYCAHEYTSSNLAF 187

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--N 238
           AL  +  N  LQ+Y   V  MR+Q + T PST+  EK VNPFLR E  S++K++  +  +
Sbjct: 188 ALVAEQDNPHLQRYREDVSRMRAQGISTIPSTLRQEKLVNPFLRCEQPSIKKSVADKAFD 247

Query: 239 ASNLAVFTELRIRKNQS 255
            S+L  F  LR  K+  
Sbjct: 248 DSDLETFAALRRWKDNF 264


>gi|170697942|ref|ZP_02889025.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria IOP40-10]
 gi|170137108|gb|EDT05353.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria IOP40-10]
          Length = 268

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 85/270 (31%), Positives = 136/270 (50%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVAALRDSQPDDAPLVVYGPAAEAIGVVTRPLAGGDRVTLDAPALAFDVLDVPGHT 118

Query: 116 IGHICYHFMNDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQRAGQGAATPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R +++++
Sbjct: 179 HEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSSAI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
              L  E        LA FT +R  KN+ +
Sbjct: 239 HATLEAELHETVPDRLAAFTLMREWKNRFR 268


>gi|160872607|ref|ZP_02062739.1| hydroxyacylglutathione hydrolase [Rickettsiella grylli]
 gi|159121406|gb|EDP46744.1| hydroxyacylglutathione hydrolase [Rickettsiella grylli]
          Length = 257

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 88/261 (33%), Positives = 135/261 (51%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   + I  + DN+   + N + +    +D  +   +   L++    L  +  THHH D
Sbjct: 1   MTIQLLPILAFKDNYIWCLINEETKHCLIVDPGEAKPVLAQLKQLNLTLDALLITHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKII-ATPGHTIGHI 119
           HT    ++   +   +FGP +   KI G+ H +++ D  +    P   I A PGHT+GHI
Sbjct: 61  HTNGIRSILNHYPVPVFGPSK--EKIVGVTHPVNETDKIELTHWPSFEILAIPGHTLGHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+   +H L  GDTLF+ GCGR+FE +  +M  SLEK+    D+T IY GHEYT  N  
Sbjct: 119 AYYG--NHLLFCGDTLFTAGCGRLFEGTPDQMLNSLEKLAQLPDETQIYCGHEYTLANLN 176

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLN 235
           FA + +P N  ++K   K + +R +NL   PS ++ E+  NPFLR  N  ++    K   
Sbjct: 177 FAQTIEPDNTHIKKRLEKTRELRQKNLPCVPSLLAEERLSNPFLRCNNPKIKKCIEKRTG 236

Query: 236 MENASNLAVFTELRIRKNQSK 256
            +  + + +F  LR  KN  K
Sbjct: 237 KKLITPVEIFAYLRQWKNNFK 257


>gi|53725584|ref|YP_102528.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 23344]
 gi|67639725|ref|ZP_00438562.1| hydroxyacylglutathione hydrolase [Burkholderia mallei GB8 horse 4]
 gi|121600990|ref|YP_992610.1| hydroxyacylglutathione hydrolase [Burkholderia mallei SAVP1]
 gi|124384900|ref|YP_001026589.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10229]
 gi|126440113|ref|YP_001058511.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           668]
 gi|126448564|ref|YP_001080127.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10247]
 gi|167002804|ref|ZP_02268594.1| hydroxyacylglutathione hydrolase [Burkholderia mallei PRL-20]
 gi|167738049|ref|ZP_02410823.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           14]
 gi|217423726|ref|ZP_03455227.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 576]
 gi|254178061|ref|ZP_04884716.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 10399]
 gi|254180215|ref|ZP_04886814.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|254199439|ref|ZP_04905805.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|254205752|ref|ZP_04912104.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|254358848|ref|ZP_04975121.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|52429007|gb|AAU49600.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 23344]
 gi|121229800|gb|ABM52318.1| hydroxyacylglutathione hydrolase [Burkholderia mallei SAVP1]
 gi|124292920|gb|ABN02189.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10229]
 gi|126219606|gb|ABN83112.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 668]
 gi|126241434|gb|ABO04527.1| hydroxyacylglutathione hydrolase [Burkholderia mallei NCTC 10247]
 gi|147749035|gb|EDK56109.1| metallo-beta-lactamase family protein [Burkholderia mallei FMH]
 gi|147753195|gb|EDK60260.1| metallo-beta-lactamase family protein [Burkholderia mallei JHU]
 gi|148027975|gb|EDK85996.1| metallo-beta-lactamase family protein [Burkholderia mallei
           2002721280]
 gi|160699100|gb|EDP89070.1| hydroxyacylglutathione hydrolase [Burkholderia mallei ATCC 10399]
 gi|184210755|gb|EDU07798.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1655]
 gi|217393584|gb|EEC33605.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 576]
 gi|238520323|gb|EEP83784.1| hydroxyacylglutathione hydrolase [Burkholderia mallei GB8 horse 4]
 gi|243061563|gb|EES43749.1| hydroxyacylglutathione hydrolase [Burkholderia mallei PRL-20]
          Length = 268

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 85/270 (31%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHR 58

Query: 60  DHTRANLN----LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH           ++     +FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLAGAREGEPIAVFGPAHEAIEHITRRVAGGERVRIGAPALEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  +  + R++   T P+TI+ E  VNPFLR ++ S+
Sbjct: 179 HEYTLSNIQFALACEPGNAALAAWRDEALARRARGEPTLPTTIAHECAVNPFLRADSASI 238

Query: 231 R----KNLNMENASNLAVFTELRIRKNQSK 256
           R      L+      LA FT +R  KN+ +
Sbjct: 239 RATLEARLHEAAPDRLAAFTLMREWKNRFR 268


>gi|110635409|ref|YP_675617.1| beta-lactamase-like [Mesorhizobium sp. BNC1]
 gi|123057520|sp|Q11DS3|GLO2_MESSB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110286393|gb|ABG64452.1| beta-lactamase-like protein [Chelativorans sp. BNC1]
          Length = 255

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 109/246 (44%), Positives = 153/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF IL  + +  +TA +DAP+   I + ++  GW  + +  THHH DH  ANL LK
Sbjct: 10  CRSDNFGILARDSETGITALVDAPEEQAILEAIKRTGWTPSLLLITHHHADHVEANLALK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  TI GP +E+SKIPGID  +++GD    G+   ++I TPGHT GHI ++F      
Sbjct: 70  ERFGLTIIGPAKEASKIPGIDRQVNEGDVVRVGNQEARVIETPGHTAGHITFYFAKAGIA 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLF+LGCGR+FE     M+ESL+K+     +T IY GHEYTE+NA FALS DP N 
Sbjct: 130 FTADTLFALGCGRLFECKPPVMYESLKKLVELPLETVIYCGHEYTESNARFALSVDPTNS 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   K++++R +   T P+T+  E   NPFLR  +  LR NL M+NA+++ VF E+R
Sbjct: 190 ALKERAKKIEALRREGRPTLPTTLGEEMATNPFLRCHDPVLRNNLGMKNAADVEVFAEIR 249

Query: 250 IRKNQS 255
            RK+  
Sbjct: 250 KRKDVF 255


>gi|91088179|ref|XP_972438.1| PREDICTED: similar to CG4365 CG4365-PA [Tribolium castaneum]
 gi|270012133|gb|EFA08581.1| hypothetical protein TcasGA2_TC006236 [Tribolium castaneum]
          Length = 302

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 126/255 (49%), Gaps = 7/255 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LI + K +  A +D      + + + ++G  LT +  THHH DH   N
Sbjct: 50  VILPALSDNYMYLIVDEKTKQAAIVDPVAPDTVLEAVEKEGVNLTKVLTTHHHWDHAGGN 109

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             L K  +           +I  + + +  GD F  G   ++ ++TP HT GHICY+   
Sbjct: 110 EQLVKK-SKNALQVFGGDDRIGALTNRVKHGDKFSIGDINVECLSTPCHTSGHICYYVNA 168

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCGR FE +  +M  + ++ + +  D T ++ GHEYTE N  FA
Sbjct: 169 AGEPPAVFTGDTLFVAGCGRFFEGTAEQMHTALIDILGNLPDNTQVFCGHEYTEQNLKFA 228

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N ++ +      + R ++  T PSTI+ EK+ NPF+R+   S++K+    N+  
Sbjct: 229 KHVEPDNPDILERIEWAGAKRGRHEPTVPSTIANEKQTNPFMRVGLPSVQKHAKCNNS-- 286

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 287 IETMRTIRKEKDSFK 301


>gi|332716404|ref|YP_004443870.1| putative glyoxalase II [Agrobacterium sp. H13-3]
 gi|325063089|gb|ADY66779.1| putative glyoxalase II [Agrobacterium sp. H13-3]
          Length = 256

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 119/256 (46%), Positives = 164/256 (64%), Gaps = 1/256 (0%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I +     DNF +L+H+ +   TAAIDAP+   I + L   GW LTHIF THHH 
Sbjct: 1   MKPLEIDVFLCRSDNFGVLLHDPESGATAAIDAPEEGPILQALHGHGWKLTHIFTTHHHQ 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK  F C I GP +E+  IPG+D   +DGD F+F    +++IATPGHT GHI
Sbjct: 61  DHVEANLALKDKFQCEIHGPHDEAIAIPGLDRSQADGDEFEFAGRRVQVIATPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CY+  +D  L   DTLF++GCGR+FE +  +M+ S +K+ +  D T +YFGHEYT +NA 
Sbjct: 121 CYYLPDDGLLFAADTLFAMGCGRLFERTATDMWHSFQKLMALPDDTKVYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L +    V+  R  N +T P+TI LEK+ NP++R+ + S+R +L +E A
Sbjct: 181 FALTVDPDNAALIERAESVEKARQANEFTIPTTIGLEKQTNPYMRVADASIRSHLGLEGA 240

Query: 240 SNLAVFTELRIRKNQS 255
           ++  VF E+R RK+  
Sbjct: 241 TDAEVFAEIRTRKDNF 256


>gi|119510457|ref|ZP_01629590.1| Beta-lactamase-like protein [Nodularia spumigena CCY9414]
 gi|119464879|gb|EAW45783.1| Beta-lactamase-like protein [Nodularia spumigena CCY9414]
          Length = 257

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 97/256 (37%), Positives = 137/256 (53%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+H+ +  + A +D  +   + K L E    L  IFNTHHH DH   N
Sbjct: 4   IRLEALSDNYIFLLHDEEQNIAAVVDPAEAEPVLKKLAELQAELVAIFNTHHHNDHVGGN 63

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              ++ F N T++G  E+  +IPG    L  GD   FG    ++   PGHT  HI Y+F 
Sbjct: 64  KKLIQDFPNLTVYGGAEDRGRIPGQQVFLQQGDRIQFGDRTAEVFFIPGHTRAHIAYYFF 123

Query: 125 -----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE +  +M ESL K++S  D T ++  HEYT  N  
Sbjct: 124 PVTSDQTGELFCGDTLFAGGCGRLFEGTPTQMVESLGKLRSLPDHTRVWCAHEYTLKNLQ 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N ELQ+   +VK+ RS+   T PS + +EK  NPFLR E  SL+  L  +++
Sbjct: 184 FALTVDSENTELQRRYEEVKNYRSRQEATVPSFLGVEKLTNPFLRWEQPSLQ--LVTKSS 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F  LR  K++ 
Sbjct: 242 DPIQTFARLRGMKDRF 257


>gi|311694696|gb|ADP97569.1| hydroxyacylglutathione hydrolase [marine bacterium HP15]
          Length = 264

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 74/266 (27%), Positives = 119/266 (44%), Gaps = 13/266 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +++ AI  + DN+   + +        +D      +   L E G  L  I  THHH D
Sbjct: 1   MLTIS-AIPAFSDNYIWCLSDTASDKALIVDPGQAQPVLDHLAENGLTLDTILVTHHHPD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     +L   F           S   G  + +  GD   +     +++  PGHT+ HI 
Sbjct: 60  HVGGVKDLISRFPDCRVTGP-ADSPYKGSTNLVHPGDEVIWEDITFQVLGVPGHTLDHIA 118

Query: 121 YHFMNDHFL----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           Y    +         GDTLF  GCGR+FE S  +M +SL+ +++   KT +Y  HEYT  
Sbjct: 119 YFTDVEVNGRPVLFCGDTLFVCGCGRLFEGSPEQMRQSLQTLRALPGKTAVYCAHEYTLA 178

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-- 234
           N  FA S  P +  L+ +  + ++ R     T PS +  EK++NPFLR ++ ++  +   
Sbjct: 179 NLRFARSWLPEDEGLRTFEQECQAARDAGKPTVPSVLENEKRLNPFLRWDDPAVVDSARA 238

Query: 235 -----NMENASNLAVFTELRIRKNQS 255
                 +   S+ A+F  +R  K+  
Sbjct: 239 YCSSRGLPADSDNAIFAAIRHGKDNF 264


>gi|17228076|ref|NP_484624.1| hypothetical protein all0580 [Nostoc sp. PCC 7120]
 gi|81773021|sp|Q8YZ99|GLO2_ANASP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|17129925|dbj|BAB72538.1| all0580 [Nostoc sp. PCC 7120]
          Length = 257

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 95/256 (37%), Positives = 135/256 (52%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  L+H+    + A +D  +   + K L +    L  IFNTHHH DH   N
Sbjct: 4   IRLAALSDNYIFLLHDSHKNIAAVVDPAEAEPVLKQLAQLKAELVAIFNTHHHNDHVGGN 63

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              ++KF    ++G  ++  +IPG    L  GD   F     ++I  PGHT  HI Y+F 
Sbjct: 64  QKLIQKFPQVKVYGGAKDQGRIPGQQVFLQPGDRVQFADRVAEVIFVPGHTRAHIAYYFP 123

Query: 125 NDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                       GDTLF+ GCGR+FE + A+M ESL K++S  + T ++  HEYT  N  
Sbjct: 124 PQTDDTPGELFCGDTLFAGGCGRLFEGTPAQMVESLTKLRSLPENTRVWCAHEYTLKNLQ 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FALS D  N ELQK   +VK+ RSQ + T PS + +EK  NPFLR E  SL+  +N    
Sbjct: 184 FALSVDSKNTELQKRLDEVKTKRSQGIATVPSLLGVEKLTNPFLRWEQPSLQLAVNSN-- 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F  +R  K++ 
Sbjct: 242 DPVQTFARIRGLKDKF 257


>gi|264677770|ref|YP_003277676.1| beta-lactamase [Comamonas testosteroni CNB-2]
 gi|262208282|gb|ACY32380.1| beta-lactamase-like protein [Comamonas testosteroni CNB-2]
          Length = 260

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 77/264 (29%), Positives = 119/264 (45%), Gaps = 13/264 (4%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  +N+  I  + DN+  ++H+ +      +D      +   L ++G  L  I  THHH 
Sbjct: 1   MQLMNLLPIPAFSDNYIWMLHDAE--HAVVVDPGQAEPVLATLAQRGLKLQGILVTHHHA 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      ++      ++GP      +P     +  GD  +    P ++I  PGHT GHI
Sbjct: 59  DHVGGVDAIRAATGAPVWGPAY--ETLPEPVTRVRGGDHVELLGGPWQVIDVPGHTSGHI 116

Query: 120 CYHF---MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            +      +   L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT +
Sbjct: 117 AFFSTLAQDQPLLFCGDTLFSGGCGRLFEGTAAQMQASLDALAALPGNTLVCCAHEYTIS 176

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P+N EL +Y    + +R     T PST+  E  VNPF+R     +      
Sbjct: 177 NLRFAQAVEPNNPELAQYLEYCQQLRKNGQPTLPSTLQTELAVNPFMRSRAADVIAAAMH 236

Query: 237 ENA-----SNLAVFTELRIRKNQS 255
            +         +V   LR  KN  
Sbjct: 237 HDPQTRPEEPASVLATLRQWKNVF 260


>gi|156554956|ref|XP_001602195.1| PREDICTED: similar to MGC131075 protein [Nasonia vitripennis]
          Length = 302

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 77/254 (30%), Positives = 115/254 (45%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DN+  LI +   +  A +D      +   ++E    LT I  THHH DH   N 
Sbjct: 52  ILPALKDNYMYLIIDEDTQEAAIVDPVSPDQVLAAVKENNCKLTKILTTHHHWDHAGGNK 111

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L    +           +I  +   +  G   + G+  I+ + TP HT GHICY+   D
Sbjct: 112 CLS--CSVPDVQVYGGDDRIDALTCKVGHGSVINLGNLKIECLHTPCHTRGHICYYVTKD 169

Query: 127 H---FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT-HIYFGHEYTENNAYFAL 182
                +  GDTLFS GCGR FE +  +M ++L +I +       +Y GHEYT NN  +  
Sbjct: 170 CAEPAVFTGDTLFSGGCGRFFEGTAEQMNKALNEILAKLPDQTKVYCGHEYTINNLKYGR 229

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
             +P+N  L +        R  NL T PSTI  EK  NPF+R+   +++ +   +    +
Sbjct: 230 QVEPNNQALVEKLEWACCRRKNNLPTVPSTIGEEKLFNPFMRVCEPTVKAHT--QKCDPI 287

Query: 243 AVFTELRIRKNQSK 256
            V   LR  K+  K
Sbjct: 288 DVMASLRSEKDNFK 301


>gi|168033818|ref|XP_001769411.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679331|gb|EDQ65780.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 260

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 76/257 (29%), Positives = 114/257 (44%), Gaps = 8/257 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+ + +    A +D      + +  +  G  +  +  THHH DH   N
Sbjct: 4   VPVPCLEDNYAYLVFDEETGDAAVVDPVWPDQVLQAAQINGAKVKMVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +KK           +              +     +  +K + TP HT GHI Y   +
Sbjct: 64  NGMKKLLKDVPIYGGVKDKVEGCSHPVQHGDEFSISPTVRVKCLETPCHTKGHISYFITS 123

Query: 126 DHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAY 179
                      GDTLF  GCGR FE +  +M++S  + + S   +T +Y GHEYT+ N  
Sbjct: 124 TLPNDKSAVFTGDTLFIGGCGRFFEGTPDQMYQSLCKTLASLPLETQVYCGHEYTQKNLE 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ +P N  L +    V   R Q L T PSTI  E + NPF+R++  SL+     E  
Sbjct: 184 FALTLEPKNEALLRKMEWVLRQRKQKLATVPSTIGDELEFNPFMRVDQKSLQLATGRE-- 241

Query: 240 SNLAVFTELRIRKNQSK 256
           S L V  E+R  K+  K
Sbjct: 242 SPLEVMAEVRRMKDNYK 258


>gi|83720134|ref|YP_443300.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
 gi|167620416|ref|ZP_02389047.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis Bt4]
 gi|83653959|gb|ABC38022.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
          Length = 268

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRHAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHG 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L            FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLATAREGEPLAVFGPAHEAIEHLTHRVTGGERVRIGSPAFEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+
Sbjct: 179 HEYTLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSI 238

Query: 231 RKNLNME----NASNLAVFTELRIRKNQSK 256
           R  L  +        LA FT +R  KN+ +
Sbjct: 239 RATLEAQLHEGAPDRLAAFTLMREWKNRFR 268


>gi|260772246|ref|ZP_05881162.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260611385|gb|EEX36588.1| hydroxyacylglutathione hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 252

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 94/257 (36%), Positives = 133/257 (51%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   +   LR++   L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIENSD-RCCAVVDPGDAQPVLAYLRQQELTLEAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + +         +   IP + H + DGD  +       ++  PGHT+GHI 
Sbjct: 59  HIGGVAELVRQYPHVDVVGPAQ-EPIPTLTHPVEDGDQIELFDERFMVLGLPGHTLGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGR+FE +  +MF SL K+ +  ++T IY  HEYT +N  F
Sbjct: 118 YVG--DSKLFCGDVLFSAGCGRVFEGTMEQMFSSLNKLLTLPEETEIYCAHEYTASNVAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           A++ +P N +LQ Y   V  MR+Q   T P+T+  EK VNPFLR    S+ K++    E 
Sbjct: 176 AMAVEPDNEQLQIYRDTVIRMRAQGQATLPTTLQREKWVNPFLRTGVPSVIKSVANRTEQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              LA+F+ LR  KN+ 
Sbjct: 236 HDPLAIFSALREWKNEF 252


>gi|222149971|ref|YP_002550928.1| glyoxalase II [Agrobacterium vitis S4]
 gi|221736953|gb|ACM37916.1| glyoxalase II [Agrobacterium vitis S4]
          Length = 256

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 124/256 (48%), Positives = 169/256 (66%), Gaps = 1/256 (0%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S +I I     DN+ +L+H  +  LTA+IDAP+   I     ++GW ++HIF THHH 
Sbjct: 1   MKSPDIEIFPCRTDNYGVLVHCPETGLTASIDAPEEGPIVAAAEKRGWQISHIFTTHHHN 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK+ + C I GP+ E+  IPG+D    DG+ F FG H +++I TPGHT GH+
Sbjct: 61  DHVEANLALKQRYGCEIIGPVNEAVAIPGLDRSAYDGEEFLFGPHRVQVIETPGHTAGHV 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CYHF +   L   DTLF+LGCGR+FE   A+M+ SL+K+    D+T IYFGHEYT  NA 
Sbjct: 121 CYHFPDAKLLFAADTLFALGCGRLFERPAADMWHSLQKLAVLPDETAIYFGHEYTLANAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  LQ     +++MR+Q  +T P+T+SLEK+ NPFLR+ +  +R+NL ME+ 
Sbjct: 181 FALTIDPDNERLQARARDIEAMRAQGQFTIPTTMSLEKETNPFLRVADPKIRRNLVMESK 240

Query: 240 SNLAVFTELRIRKNQS 255
           SN  VF E+R RK+  
Sbjct: 241 SNEEVFAEIRKRKDNF 256


>gi|330959399|gb|EGH59659.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 259

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 84/260 (32%), Positives = 134/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQRCAVVDPGDAQPVLDWLAQHPEYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 ++             +  IP  D  L+D D  +       + A PGHT+GHI +
Sbjct: 62  VGGV--VQLKQVTQARVHGPATENIPARDVALADHDRLNVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL+++  F D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLQRLAGFPDSTSIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V  +R++N  + PST+ LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNRDIAERLAEVTRLRAENRISLPSTLGLEKRTNPFLRTHETSVKEKADERNG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 AQNTSQSAVFACLRAWKDKF 259


>gi|224128015|ref|XP_002329233.1| predicted protein [Populus trichocarpa]
 gi|222871014|gb|EEF08145.1| predicted protein [Populus trichocarpa]
          Length = 258

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 72/261 (27%), Positives = 115/261 (44%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L++      DN+  LI +   +  A +D  +   +     E G  L  +  THHH D
Sbjct: 1   MKILHV--PCLEDNYSYLIIDESTKEAAVVDPVEPEKLVNAANEHGLHLKLVLTTHHHWD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K+             +     +   +           I  + TP HT GHI 
Sbjct: 59  HAGGNEKIKEMVPGIKVYGGSLDNVKGCTNKVENGDKVSLGADVNILALHTPCHTKGHIS 118

Query: 121 YHFM----NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           Y+       D  +  GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT 
Sbjct: 119 YYVTGKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTV 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FAL+ +P ++++Q+  S  +  R   L T PSTI  E + NPF+R E   ++  + 
Sbjct: 179 KNLQFALTVEPDSVKIQEKLSWAQKQRRAGLPTIPSTIEEEMETNPFMRAELPDVQAKVG 238

Query: 236 MENASNLAVFTELRIRKNQSK 256
               S +    ++R+ K+  +
Sbjct: 239 CH--SPVEALRKIRLMKDNWR 257


>gi|159045231|ref|YP_001534025.1| putative hydroxyacylglutathione hydrolase [Dinoroseobacter shibae
           DFL 12]
 gi|157912991|gb|ABV94424.1| putative hydroxyacylglutathione hydrolase [Dinoroseobacter shibae
           DFL 12]
          Length = 256

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 149/241 (61%)

Query: 14  NFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFN 73
           N+ +L+H+     TA++DA D   +   L++ GW L+ I+ THHH DHT     +K    
Sbjct: 15  NYGVLLHDPSSGATASVDAGDAAALRTALKKTGWTLSEIWITHHHADHTDGVAEIKAETG 74

Query: 74  CTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGD 133
           CT+ GP  +S+ I G+D    DGD FDF  H +++I TPGHTI  I ++   +  +  GD
Sbjct: 75  CTVIGPKPQSAPIAGVDTRYGDGDRFDFSGHEVRVIHTPGHTIDMINFYLPAEGVVFTGD 134

Query: 134 TLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQK 193
           TLF +GCGR+FE     M  SL+K+ +    T IY  HEYTE NA FAL+ DP N +L+ 
Sbjct: 135 TLFVMGCGRLFEGDGPMMHASLQKLAALPADTVIYCSHEYTEANADFALTVDPENPDLKD 194

Query: 194 YCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELRIRKN 253
             ++VK++R+Q+  T P+T++ E   NPFLR  +T +R +L +E AS+  VFTE+R RK+
Sbjct: 195 KAARVKALRAQDKPTVPTTLAEELATNPFLRAHDTRIRAHLGLETASDAEVFTEIRRRKD 254

Query: 254 Q 254
            
Sbjct: 255 N 255


>gi|312115065|ref|YP_004012661.1| hydroxyacylglutathione hydrolase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220194|gb|ADP71562.1| hydroxyacylglutathione hydrolase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 267

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 106/267 (39%), Positives = 160/267 (59%), Gaps = 12/267 (4%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+ L + +     DNF +LIH+    +TA+IDAPD   + + L   GW LTHI  THHH 
Sbjct: 1   MSHLEVRLFPCLSDNFGVLIHDPVTGVTASIDAPDGEAVRRELESAGWTLTHILVTHHHW 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH +    LK+  NCTI+GP  E++++P +D  + + D   FG   +++I TPGHT GH+
Sbjct: 61  DHIQGLQALKRDSNCTIYGPAREAAELPVVDVEVHEDDRIPFGPFEVEVIETPGHTPGHV 120

Query: 120 CYHFMNDHFL----------CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYF 169
            Y   +               VGDTLFS+GCGR+ +  Y++M+ SLEK+    ++T +Y 
Sbjct: 121 AYFIPDAVQAEITGQKSGLAFVGDTLFSVGCGRVNDGRYSDMWHSLEKLMRLPERTLLYV 180

Query: 170 GHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           GHEYT++N  FAL+ +P N+ L K   +V  +R+    T P T++ E + NPFLR  +  
Sbjct: 181 GHEYTQSNIKFALAVEPENIALHKRKEEVDRLRADGKPTLPVTLAKELETNPFLRPFSPE 240

Query: 230 LRKNLNM-ENASNLAVFTELRIRKNQS 255
           +RK+L++  + S+ AVF ELR RK++ 
Sbjct: 241 IRKSLDIGPDVSDEAVFEELRRRKDRF 267


>gi|218710295|ref|YP_002417916.1| hydroxyacylglutathione hydrolase [Vibrio splendidus LGP32]
 gi|254798852|sp|B7VIP5|GLO2_VIBSL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218323314|emb|CAV19491.1| hydroxyacylglutathione hydrolase [Vibrio splendidus LGP32]
          Length = 252

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIQNSD-RRCAVVDPGDAAPVLEYLAHHELTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        +    IP + H + DGD  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPGVDVVGPKN-EPIPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  F
Sbjct: 118 YVG--DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MEN 238
           AL+ +P N  LQ+Y  +V  +R+QN  T P+ +  EK +NPFLR    S+ K+++   E 
Sbjct: 176 ALAVEPDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFINPFLRYTEPSVVKSVSNRTEQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L+VFT LR  KN+ 
Sbjct: 236 TDPLSVFTALRAWKNEF 252


>gi|167582319|ref|ZP_02375193.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis TXDOH]
          Length = 268

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRHAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHG 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L            FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLATAREGEPLAVFGPAHEAIEHLTHRVTGGERVRIGSPALEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+
Sbjct: 179 HEYTLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSI 238

Query: 231 R----KNLNMENASNLAVFTELRIRKNQSK 256
           R      L+      LA FT +R  KN+ +
Sbjct: 239 RATLEAQLHEAAPDRLAAFTLMREWKNRFR 268


>gi|262276483|ref|ZP_06054292.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
 gi|262220291|gb|EEY71607.1| hydroxyacylglutathione hydrolase [Grimontia hollisae CIP 101886]
          Length = 252

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 85/257 (33%), Positives = 131/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+  +I  ++DN+  L+ N        +D  D   +   L +    L  +  THHH D
Sbjct: 1   MLSVT-SIPAFNDNYIWLLKNDD-NHCVVVDPGDAAPVLSTLNQMKLTLDGVLVTHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+K F        +   + P + H L DGD F   +     I  PGHT+ HI 
Sbjct: 59  HIGGIQQLQKAFPDLTIYGPDS-DRFPMVTHPLKDGDRFTLFNTLFTTIQVPGHTLDHIA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+   +  L  GDTLFS GCGR+FE +  +M +SL ++ S  D T ++  HEYT +N  F
Sbjct: 118 YYA--EGMLFSGDTLFSGGCGRLFEGTPTQMHQSLTRLASLPDDTQVFCAHEYTLSNLEF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMEN 238
           A + +P+N+ L  Y    K +R++N  T PS+I LEK++NPFLR    S++  +     +
Sbjct: 176 AHAVEPNNIALNDYIIDAKKVRAKNQPTLPSSIGLEKRINPFLRSHIDSVKDAVVQRASD 235

Query: 239 ASNLAVFTELRIRKNQS 255
            +++  F  LR  K++ 
Sbjct: 236 LTDIETFAALRRWKDEF 252


>gi|163854935|ref|YP_001629233.1| hydroxyacylglutathione hydrolase [Bordetella petrii DSM 12804]
 gi|163258663|emb|CAP40962.1| probable hydroxyacylglutathione hydrolase [Bordetella petrii]
          Length = 429

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 81/257 (31%), Positives = 125/257 (48%), Gaps = 9/257 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+   I        A +D  +   + ++L  +G  L  I  THHH DH    L
Sbjct: 175 PLPAFSDNYIWAIVRD--GQVAVVDPGEAGPVLELLARRGLQLRAILLTHHHGDHVGGVL 232

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-- 124
            L +    T++GP +E      +     D  T       + ++  PGHT GHI Y+    
Sbjct: 233 ELLRHAPATVYGPAQERLPHCDVRLSEGDRVTLPELDLDLSVLDVPGHTAGHIAYYGRAA 292

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                L  GDTLF+ GCGR+FE + A+M  SLEK  +    T +   HEYT  N  +A++
Sbjct: 293 GRQPLLFCGDTLFAGGCGRLFEGTPAQMHASLEKFAALPADTQVCCAHEYTLANLRWAMA 352

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA---- 239
            +P N  LQ++  + + +R Q   T PST+ LE+  NPFLR +  ++ +   +++     
Sbjct: 353 VEPANRTLQQWYQRAQQLREQGRPTLPSTLRLEQDTNPFLRTQQANVAQAAAVQSGRVLD 412

Query: 240 SNLAVFTELRIRKNQSK 256
           + +AVF  LR  KN  K
Sbjct: 413 TPVAVFAALREWKNDFK 429


>gi|257139536|ref|ZP_05587798.1| hydroxyacylglutathione hydrolase [Burkholderia thailandensis E264]
          Length = 268

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 130/270 (48%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRHAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHG 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L            FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLATAREGEPLAVFGPAHEAIEHLTHRVTGGERVRIGSPAFEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  +  + R+++  T P+TI+ E+ VNPFLR ++ S+
Sbjct: 179 HEYTLSNIRFALACEPDNAALAAWRDEALARRARHEPTLPTTIAHERAVNPFLRADSPSI 238

Query: 231 R----KNLNMENASNLAVFTELRIRKNQSK 256
           R     +L+      LA FT +R  KN+ +
Sbjct: 239 RATLEAHLHEGAPDRLAAFTLMREWKNRFR 268


>gi|198438251|ref|XP_002130731.1| PREDICTED: similar to MGC131075 protein [Ciona intestinalis]
          Length = 284

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 121/252 (48%), Gaps = 5/252 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + K    A +D  +   + K + ++G  LT I  THHH DH   N  
Sbjct: 32  LPALEDNYMYLLVDEKTNEAAIVDPVEPDKVLKAVEKEGVKLTTILTTHHHWDHAGGNKE 91

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L      +         +I GI     +G  F+ GS  I+ + TP HT GHICY   N +
Sbjct: 92  LISKVGASNLKVYGGDDRIDGITTKAVEGLEFNVGSLEIRCLFTPCHTTGHICYFVKNPN 151

Query: 128 FL--CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
                 GDTLF  GCGR FE +  +M+ S ++K+      T +Y GHEYT ++  FA   
Sbjct: 152 TPAVFTGDTLFVSGCGRFFEGTAEQMYSSLVKKLSILPPATQVYCGHEYTVSSLKFAQFV 211

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
            P+N  + +  +     R  N  T PSTI+ E   NPF+R+EN  L+K    + ++ +  
Sbjct: 212 QPNNQHVLEKLNWSIKQRENNQPTIPSTIAEEMLYNPFMRVENEELQKR--CKTSTPVET 269

Query: 245 FTELRIRKNQSK 256
              LR  K+  K
Sbjct: 270 MKFLRNEKDHFK 281


>gi|319407867|emb|CBI81520.1| hydroxyacylglutathione hydrolase [Bartonella sp. 1-1C]
          Length = 253

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 118/246 (47%), Positives = 158/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF ILIH+ K   TAAIDAP+   I  ML+++ W L  IF THHH DH  A   LK
Sbjct: 8   CREDNFGILIHDEKSGCTAAIDAPEGKAIHNMLKKRNWTLQFIFVTHHHYDHVEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +N  I GP  ES KI  +DH L   +TF FG+  +  ++TPGHT+G + Y+F     L
Sbjct: 68  QAYNAMIIGPAAESKKITPLDHTLQPDETFCFGTQTLMALSTPGHTLGGLSYYFPQAKLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYTE NA FAL+ DP N 
Sbjct: 128 FAGDTLFSLGCGRLFEGTPLKMLTSLKKLRQLPDETILYCGHEYTEKNALFALTIDPQNR 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +   +V S+R+QN  T P+T+  EK+ NPFLR ++  LRKN+ ME A++  VF E+R
Sbjct: 188 KLHQRAEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDDPILRKNIAMEKATDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDHF 253


>gi|167902188|ref|ZP_02489393.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei NCTC
           13177]
          Length = 270

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 87/272 (31%), Positives = 128/272 (47%), Gaps = 18/272 (6%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHR 58

Query: 60  DHTRANLN--LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH----PIKIIATPG 113
           DH                I         I  I   ++ G+    G+        +I  PG
Sbjct: 59  DHVGGVAELLAGAREGEPIAVFGPAHEAIEHITRRVAGGERVRIGAPAPALEFDVIDVPG 118

Query: 114 HTIGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIY 168
           HT GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++
Sbjct: 119 HTRGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVH 178

Query: 169 FGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT 228
             HEYT +N  FAL+C+P N  L  +  +V + R++   T P+TI+ E  VNPFLR ++ 
Sbjct: 179 CAHEYTLSNIQFALACEPGNAALAAWRDEVLARRARGEPTLPTTIAHECAVNPFLRADSA 238

Query: 229 SLR----KNLNMENASNLAVFTELRIRKNQSK 256
           S+R      L+      LA FT +R  KN+ +
Sbjct: 239 SIRATLEARLHEAAPDRLAAFTLMREWKNRFR 270


>gi|160395577|sp|Q21YF8|GLO2_RHOFD RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
          Length = 255

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 85/256 (33%), Positives = 126/256 (49%), Gaps = 10/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  ++H+   R    +D  D   + + L++ G  L  I  THHH DHT   
Sbjct: 4   IPLPAFTDNYIWMVHDE--RHALVVDPGDAQPVLEALQQLGLQLETILVTHHHPDHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             L+      +FGP      +P     L+            ++I  PGHT  HI Y    
Sbjct: 62  AALRAATGAQVFGPAR--EPMPEPLIRLTGDQQLQALGLNFQVIDVPGHTACHIAYFCAD 119

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE S A+M  SL+ + +  D T +   HEYT +N  FA 
Sbjct: 120 VDGAPLLFCGDTLFSAGCGRLFEGSPAQMLASLDTLAALPDATRVCCAHEYTLSNLKFAC 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P N  L  Y  K +++RSQ   T PS+I LE+++NPFLR    ++ + +   +A   
Sbjct: 180 AVEPVNQALTDYTVKAEALRSQQQPTLPSSILLERQINPFLRTRQATVTQAVQAFDASAR 239

Query: 240 SNLAVFTELRIRKNQS 255
             +++F  LR  KNQ 
Sbjct: 240 DEVSIFAALRQWKNQF 255


>gi|61098280|ref|NP_001012807.1| hydroxyacylglutathione hydrolase, mitochondrial [Gallus gallus]
 gi|75571199|sp|Q5ZI23|GLO2_CHICK RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|53136582|emb|CAG32620.1| hypothetical protein RCJMB04_31d24 [Gallus gallus]
          Length = 310

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 120/255 (47%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +   +++ G  LT +  THHH DH   N  
Sbjct: 56  LPALTDNYMYLLIDEETKEAAIVDPVQPQKVLDAVKKHGVKLTSVLTTHHHWDHAGGNEK 115

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K             S++  +   +S   +   GS  +K + TP HT GHICY+    +
Sbjct: 116 LVKLETGLRVY--GGDSRVGALTQKVSHLTSLKVGSLNVKCLCTPCHTSGHICYYVTKPN 173

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+ + +E + S   +T +Y GHEYT NN  FA
Sbjct: 174 SSEPPAVFTGDTLFVAGCGKFFEGTPEEMYRALIEILGSLDPETRVYCGHEYTINNLKFA 233

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N+ +Q+  +  K+       T PSTI+ E   NPF+R+   +++++        
Sbjct: 234 RHVEPNNVSIQEKLAWAKAKYDSGEPTIPSTIAEEFTYNPFMRVREKTVQEHAG--ETDP 291

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  +
Sbjct: 292 IRTMGAIRKEKDNFR 306


>gi|297833868|ref|XP_002884816.1| glyoxalase 2-2 [Arabidopsis lyrata subsp. lyrata]
 gi|297330656|gb|EFH61075.1| glyoxalase 2-2 [Arabidopsis lyrata subsp. lyrata]
          Length = 258

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 114/254 (44%), Gaps = 7/254 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +      A +D  D   +     +    +  +  THHH DH   N  
Sbjct: 6   VPCLQDNYSYLIIDESTGDAAVVDPVDPEKVIASAEQHQAKIKFVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           +K+                   D   +           I  + TP HT GHI Y+     
Sbjct: 66  IKQLVPEIKVYGGSLDKVKGCTDAVDNGDKLTLGQDVNILALHTPCHTKGHISYYVTGKE 125

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             +  +  GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT  N  FAL
Sbjct: 126 GENPAVFTGDTLFVAGCGKFFEGTAEQMYKSLCVTLASLPKPTQVYCGHEYTVKNLEFAL 185

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P+N ++Q+  +  +  R  +L T PST+  E + NPF+R++   +++ L  +  S +
Sbjct: 186 TVEPNNEKIQQKLAWARQQRQADLQTIPSTLEEELETNPFMRVDKPEIQEKLGCK--SPI 243

Query: 243 AVFTELRIRKNQSK 256
               E+R +K+Q +
Sbjct: 244 DTLREVRNKKDQWR 257


>gi|2570340|gb|AAC49866.1| glyoxalase II mitochondrial isozyme [Arabidopsis thaliana]
          Length = 331

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   + + L  K W LT+I NTHHH D
Sbjct: 76  SSLKIELVPCSKDNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDD 135

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI 
Sbjct: 136 HIGGNAELKERYGAKVIGSAVDKHRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHIS 195

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  F
Sbjct: 196 FYFPGSATIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKF 255

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-A 239
           ALS +P N  LQ Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ + A
Sbjct: 256 ALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSA 315

Query: 240 SNLAVFTELRIRKNQS 255
           +       ++  +++ 
Sbjct: 316 TEAEALRRIQRARDRF 331


>gi|119476000|ref|ZP_01616352.1| Metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
 gi|119450627|gb|EAW31861.1| Metallo-beta-lactamase superfamily protein [marine gamma
           proteobacterium HTCC2143]
          Length = 260

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 78/263 (29%), Positives = 119/263 (45%), Gaps = 11/263 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +   I  ++DN+   I++      A +D  +   + + L  +   L  I  THHH D
Sbjct: 1   MIHIE-PIPAFNDNYIWCIYDDDSGKAAVVDPGEAGPVEEALLAQQLQLETILITHHHFD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L K  +  ++GP     +I  I H L +  +         I+  PGHT+ HI 
Sbjct: 60  HTGGIEALTKHRDIPVYGPKNH--QIASITHRLDEQSSMSLFGLDFTILEVPGHTLDHIA 117

Query: 121 YHFMN----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            +  +       L  GDTLF+ GCGRIFE +   M  SL+K+ +    T IY  HEYT  
Sbjct: 118 LYCEDTGTGQPVLFCGDTLFAGGCGRIFEGNPTMMLNSLQKLAALPPTTEIYCAHEYTLG 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-- 234
           N  FA + +P+N  L       K  R  ++ T PS ++ E   NPFLR    ++  ++  
Sbjct: 178 NLAFANAVEPNNTALNTRIRADKQRREDDIPTVPSLLATELATNPFLRCTEDTVIDSVKA 237

Query: 235 --NMENASNLAVFTELRIRKNQS 255
                  S + +FT +R  K+  
Sbjct: 238 QGGSNGDSEVDIFTAVRRWKDNF 260


>gi|42571211|ref|NP_973679.1| GLX2-1 (GLYOXALASE 2-1); hydroxyacylglutathione hydrolase
           [Arabidopsis thaliana]
 gi|330255173|gb|AEC10267.1| Hydroxyacylglutathione hydrolase 1 [Arabidopsis thaliana]
          Length = 313

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   + + L  K W LT+I NTHHH D
Sbjct: 58  SSLKIELVPCSKDNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDD 117

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI 
Sbjct: 118 HIGGNAELKERYGAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHIS 177

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  F
Sbjct: 178 FYFPGSATIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKF 237

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-A 239
           ALS +P N  LQ Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ + A
Sbjct: 238 ALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSA 297

Query: 240 SNLAVFTELRIRKNQS 255
           +       ++  +++ 
Sbjct: 298 TEAEALRRIQRARDRF 313


>gi|18406237|ref|NP_565999.1| GLX2-1 (GLYOXALASE 2-1); hydroxyacylglutathione hydrolase
           [Arabidopsis thaliana]
 gi|21264419|sp|O24495|GLO2M_ARATH RecName: Full=Hydroxyacylglutathione hydrolase 1, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|2570338|gb|AAC49865.1| glyoxalase II isozyme [Arabidopsis thaliana]
 gi|17380664|gb|AAL36162.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|20196860|gb|AAB64315.2| putative glyoxalase II [Arabidopsis thaliana]
 gi|20259003|gb|AAM14217.1| putative glyoxalase II [Arabidopsis thaliana]
 gi|330255174|gb|AEC10268.1| Hydroxyacylglutathione hydrolase 1 [Arabidopsis thaliana]
          Length = 331

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 143/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   + + L  K W LT+I NTHHH D
Sbjct: 76  SSLKIELVPCSKDNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDD 135

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H ++I+ TPGHT GHI 
Sbjct: 136 HIGGNAELKERYGAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRILDTPGHTQGHIS 195

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  F
Sbjct: 196 FYFPGSATIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKF 255

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-A 239
           ALS +P N  LQ Y ++V  +RSQ L + P+T+ +EK  NPFLRI +  +RK+L++ + A
Sbjct: 256 ALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVEKACNPFLRISSKDIRKSLSIPDSA 315

Query: 240 SNLAVFTELRIRKNQS 255
           +       ++  +++ 
Sbjct: 316 TEAEALRRIQRARDRF 331


>gi|81300212|ref|YP_400420.1| hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 7942]
 gi|123556842|sp|Q31ND6|GLO2_SYNE7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160395580|sp|Q5N5S6|GLO2_SYNP6 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81169093|gb|ABB57433.1| Hydroxyacylglutathione hydrolase [Synechococcus elongatus PCC 7942]
          Length = 258

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 89/255 (34%), Positives = 128/255 (50%), Gaps = 9/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + R  A +D  +   +   L+ +G  LT I NTHHH DH   N  
Sbjct: 6   LPALQDNYIFLLVDVEQRQAAVVDPAEAEPVLAALQAEGLTLTAILNTHHHGDHVGGNRR 65

Query: 68  LKKFFNCTIFG-PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF--- 123
           L + F          +  +IPG    L  GD         +++  PGHT GHI Y+F   
Sbjct: 66  LLRQFPEAAVSASAVDRDRIPGQTVLLEAGDRLQICGQTAEVLFVPGHTRGHIAYYFPEV 125

Query: 124 ---MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                   L  GDTLF+ GCGR+FE + A+M +SL++++S  D T IY  HEYT NN  F
Sbjct: 126 AEGNPRGALFCGDTLFAGGCGRLFEGTPAQMLDSLQQLRSLPDDTAIYCAHEYTLNNLRF 185

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N +LQ+    V   R Q   T PS + +EK  NPFLR +  +L+  +   +  
Sbjct: 186 ALTVEPDNFDLQQRYQAVAIARQQGQATIPSRLDIEKATNPFLRWDQAALQAAV--SSQD 243

Query: 241 NLAVFTELRIRKNQS 255
            +     LR RK+Q 
Sbjct: 244 PVQTLARLRSRKDQF 258


>gi|88703291|ref|ZP_01101007.1| hydroxyacylglutathione hydrolase [Congregibacter litoralis KT71]
 gi|88702005|gb|EAQ99108.1| hydroxyacylglutathione hydrolase [Congregibacter litoralis KT71]
          Length = 256

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 95/260 (36%), Positives = 124/260 (47%), Gaps = 9/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+ I +  + DN+  L+ N        +D  D   +   LRE+   L  I  THHH D
Sbjct: 1   MPSI-IGLPAFSDNYIWLLPNGD-GSALVVDPGDAAPVEAALREQELSLAGILITHHHFD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      LK+   C ++GP      I GID  L  GD    GS+   +I  PGHT+ HI 
Sbjct: 59  HVGGLKALKEKHGCIVYGPAN--PAIEGIDRELVSGDHLSVGSYEFDVIGVPGHTLDHIA 116

Query: 121 YHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           Y       L   GDTLF+ GCGRIFE + A M ESL ++ +    T +Y  HEYT  N  
Sbjct: 117 YFQEGATPLLFCGDTLFAGGCGRIFEGTPAMMHESLSRLAALPANTAVYCAHEYTLANLS 176

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLN 235
           FA + DP N  L+   ++ + +R     T PSTISLE   NPFLR     L         
Sbjct: 177 FARAADPGNEALKAREARARDLRDAGTPTVPSTISLEIATNPFLRSAAPELAVGLEAAGR 236

Query: 236 MENASNLAVFTELRIRKNQS 255
              A+ +  F ELR  K+Q 
Sbjct: 237 ESGATPVERFAELRAWKDQF 256


>gi|254472367|ref|ZP_05085767.1| hydroxyacylglutathione hydrolase [Pseudovibrio sp. JE062]
 gi|211958650|gb|EEA93850.1| hydroxyacylglutathione hydrolase [Pseudovibrio sp. JE062]
          Length = 257

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 95/247 (38%), Positives = 134/247 (54%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +L+H+     T AID P+     ++L E GW LT I  THHH DH      L 
Sbjct: 11  CLKDNFGVLVHHPDSGCTVAIDVPEAAPYLQVLEETGWNLTDILITHHHWDHVGGLAELV 70

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +     + GP      I  +   + DGD    G   +K I TPGHT+ HI + F      
Sbjct: 71  EKTGAKVTGPERSRQHITTMTRFVEDGDDILIGPIAVKAIGTPGHTLDHISWWFQEAGIA 130

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             GDTLF+LGCGR+FE     M+ SL  +  +   +T IY GHEYT +NA FAL+ DP+N
Sbjct: 131 HTGDTLFALGCGRVFEGDAEMMWASLSHLANTLPPETTIYCGHEYTLSNAKFALTIDPNN 190

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             LQ+   +++++R     T P++++ E   NPFLR+ +  ++KNLNM NA    +F E+
Sbjct: 191 QALQERTKRIEALREVGRPTLPTSMAAELSTNPFLRVRDPEVQKNLNMVNAEPADIFAEI 250

Query: 249 RIRKNQS 255
           R RK+  
Sbjct: 251 RRRKDNF 257


>gi|256823147|ref|YP_003147110.1| hydroxyacylglutathione hydrolase [Kangiella koreensis DSM 16069]
 gi|256796686|gb|ACV27342.1| hydroxyacylglutathione hydrolase [Kangiella koreensis DSM 16069]
          Length = 265

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/262 (28%), Positives = 118/262 (45%), Gaps = 12/262 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  +I++      A +D  D+  + + L E    L  I  TH+H DH    
Sbjct: 4   IPLKAFSDNYIWVIYSPDGSKVAVVDPGDSRPVIEFLEENELSLDSILVTHYHNDHIGGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK  ++C ++    +       +    D  +    S+   I+  PGHT+GHI Y   +
Sbjct: 64  QELKNRYHCHVYASRHDQLSFTDTELDEDDTVSLFDDSYQFSILHLPGHTMGHIGYFCQH 123

Query: 126 --------DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
                      +  GDTLF  GCGR+FE +      SL+K+      T +Y  HEYT  N
Sbjct: 124 LSGHDLQGQSLVFCGDTLFRAGCGRMFEGTPDIFHHSLQKLAQLPPSTLVYCTHEYTMAN 183

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +P N +L +     + +R Q+L T PSTI  E + NPFLR   +++ K     
Sbjct: 184 IAFAKTVEPDNADLLELEQNCQKLREQDLETLPSTIDSELRTNPFLRCTESTVIKTAERA 243

Query: 235 -NMENASNLAVFTELRIRKNQS 255
            +   +  +  F  +R  K+  
Sbjct: 244 EHKSLSDPVETFATIRQLKDNF 265


>gi|83859176|ref|ZP_00952697.1| metallo-beta-lactamase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852623|gb|EAP90476.1| metallo-beta-lactamase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 255

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 137/247 (55%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  LI   +   TA ID P+  +I +  +   W +  I+NTHHH DH   N  +
Sbjct: 9   PCLQDNYGFLIRCSETGATACIDTPEADVILEESQTLDWPIRAIWNTHHHWDHAGGNEAI 68

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           ++     I  P  E++ I  +D  ++ GD    G+   +++   GHT+GH+ Y F     
Sbjct: 69  RQATGARIVAPRAEAATIGHVDQPVAAGDAVALGNLTARVMDVGGHTLGHVAYWFEEAGV 128

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD+LF+LGCGR+FE +  +M   L +++    +T IY  HEYT+ NA FALS DP N
Sbjct: 129 AFVGDSLFALGCGRMFEGTPQQMQAGLARLRGLPPETVIYCAHEYTQANARFALSVDPEN 188

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             LQ Y  +V  +R+++  T P+ ++ E + NPFLR ++  LR  L ++ AS+  VF EL
Sbjct: 189 AALQSYARRVDELRAEDKPTIPTVLAAECESNPFLRWDDEGLRARLGLQAASDAEVFAEL 248

Query: 249 RIRKNQS 255
           R RK+  
Sbjct: 249 RRRKDSF 255


>gi|24667711|ref|NP_730569.1| CG4365, isoform B [Drosophila melanogaster]
 gi|10726919|gb|AAG22178.1| CG4365, isoform B [Drosophila melanogaster]
          Length = 271

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K ++E+   L+ +  THHH 
Sbjct: 10  LEGMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTHHHW 69

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++  +   DTF  G   +K ++TP HT GHI
Sbjct: 70  DHAGGNEKL-LKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHI 128

Query: 120 CYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+E+L    S     T ++ GHEY
Sbjct: 129 CYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYEALCTKLSALPDATKVFCGHEY 188

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 189 TLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKH 248

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   +    +LR  K+  K
Sbjct: 249 AGGA-TDPVVTMGKLRKEKDTFK 270


>gi|95928634|ref|ZP_01311381.1| Hydroxyacylglutathione hydrolase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135424|gb|EAT17076.1| Hydroxyacylglutathione hydrolase [Desulfuromonas acetoxidans DSM
           684]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/255 (36%), Positives = 136/255 (53%), Gaps = 6/255 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + +  + DN+  +I +     T AID  +   +   L + G  L+ I NTH H D
Sbjct: 1   MVEITL-LQAHDDNYAYMISDGDT--TIAIDPGEAEPVLDYLEKHGRSLSLILNTHMHQD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   NL LK+   C I        +I G+D  L +         P++++ TPGHT G  C
Sbjct: 58  HCGGNLTLKRLTGCHI---AGGDERIVGVDRLLQEDSVLPGLPWPLQVMHTPGHTRGDCC 114

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+      L  GDTLFS GCGR+FE +  +++ SL+KI +  + T +Y GHEYTE N  F
Sbjct: 115 YYLPQCEALFCGDTLFSGGCGRVFEGTMEQLYHSLQKITALPETTRLYCGHEYTEENYRF 174

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A S +P +  +    S+V  +R+    T P T++ E   NPFLR E   L++ L ME AS
Sbjct: 175 AASIEPSSATVHDKLSRVHYLRNHGKPTLPVTLAEELLCNPFLRCEEKELQRALKMEQAS 234

Query: 241 NLAVFTELRIRKNQS 255
            + VFT+LR RKN+ 
Sbjct: 235 AVEVFTDLRQRKNRF 249


>gi|86146866|ref|ZP_01065185.1| Hydroxyacylglutathione hydrolase GloB [Vibrio sp. MED222]
 gi|85835318|gb|EAQ53457.1| Hydroxyacylglutathione hydrolase GloB [Vibrio sp. MED222]
          Length = 252

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/257 (36%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIQNSD-RRCAVVDPGDAAPVLEYLAHHELTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        +    IP + H + DGD  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPGVDVVGPKN-EPIPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  F
Sbjct: 118 YVG--DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MEN 238
           AL+ +P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E 
Sbjct: 176 ALAVEPDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L+VFT LR  KN+ 
Sbjct: 236 TDPLSVFTALRAWKNEF 252


>gi|148979850|ref|ZP_01815728.1| putative hydroxyacylglutathione hydrolase GloB [Vibrionales
           bacterium SWAT-3]
 gi|145961542|gb|EDK26843.1| putative hydroxyacylglutathione hydrolase GloB [Vibrionales
           bacterium SWAT-3]
          Length = 252

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/257 (36%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIENSD-RRCAVVDPGDAAPVLEYLAHHELTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F        +    IP + H + DGD  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPGVDVVGPKN-EPIPTLTHPVDDGDQLELFGEAFLVLGLSGHTAGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  F
Sbjct: 118 YVG--DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MEN 238
           AL+ +P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E 
Sbjct: 176 ALAVEPDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L+VFT LR  KN+ 
Sbjct: 236 TDPLSVFTALRAWKNEF 252


>gi|84389769|ref|ZP_00991321.1| Hydroxyacylglutathione hydrolase GloB [Vibrio splendidus 12B01]
 gi|84376870|gb|EAP93744.1| Hydroxyacylglutathione hydrolase GloB [Vibrio splendidus 12B01]
          Length = 252

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/257 (36%), Positives = 128/257 (49%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  +I  ++DN+  LI N   R  A +D  D   + + L      L  I  THHH D
Sbjct: 1   MLHIK-SIPAFNDNYIWLIQNSD-RRCAVVDPGDAAPVLEYLAHHELTLDAILITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L + F             IP + H + DGD  +       ++   GHT GHI 
Sbjct: 59  HIGGVPELVRQFPSIDVVGPRN-EPIPTLTHPVDDGDQLELFGEVFLVLGLSGHTAGHIG 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    D  L  GD LFS GCGRI E +  +MF++L KI +   +T +Y  HEYT  N  F
Sbjct: 118 YVG--DAKLFCGDVLFSAGCGRIMEGTPQQMFDALNKITALPQETEVYCAHEYTAANIAF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MEN 238
           AL+ +P N  LQ+Y  +V  +R+QN  T P+ +  EK VNPFLR    S+ K+++   E 
Sbjct: 176 ALAVEPDNQHLQQYRDQVNRLRAQNKSTIPTNLRQEKFVNPFLRYTEPSVVKSVSNRTEQ 235

Query: 239 ASNLAVFTELRIRKNQS 255
              L+VFT LR  KN+ 
Sbjct: 236 TDPLSVFTALRAWKNEF 252


>gi|146310409|ref|YP_001175483.1| hydroxyacylglutathione hydrolase [Enterobacter sp. 638]
 gi|166990456|sp|A4W6V2|GLO2_ENT38 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145317285|gb|ABP59432.1| Hydroxyacylglutathione hydrolase [Enterobacter sp. 638]
          Length = 251

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 125/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ + K R    +D  +   + K + E GW    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVLADDKDR-CVIVDPGEAAPVLKAIEENGWQPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   F        +E+ +  G    + +G           + ATPGHT GHIC++   
Sbjct: 63  PALCAKFPHLEVYGPQET-QNKGTTCVVDEGQNVLILEWEFSVFATPGHTSGHICFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGR+FE +  +M++S +KI +  ++T I   HEYT  N  FA S  
Sbjct: 120 SPYLFCGDTMFSGGCGRLFEGTPEQMYQSFQKINALPEETIICCAHEYTLANMKFAASIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           P +  +Q Y  KVK +R++NL T P  +  E+++N FLR ++  L   +N E        
Sbjct: 180 PEDRAIQDYYHKVKELRAKNLSTLPVILKNEREINLFLRTDDIDLINKINQETKLQQPEQ 239

Query: 244 VFTELRIRKNQS 255
            F  LR +K+  
Sbjct: 240 RFAWLRSKKDNF 251


>gi|194749789|ref|XP_001957319.1| GF10361 [Drosophila ananassae]
 gi|190624601|gb|EDV40125.1| GF10361 [Drosophila ananassae]
          Length = 305

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 125/263 (47%), Gaps = 9/263 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           +  + I I     DN+  LI + K R  A +D  +  ++ K + E+   L  +  THHH 
Sbjct: 44  LEGMEIKILPALQDNYMYLIVDSKTREAAIVDPVEPELVIKTVEEEKVTLNKVLTTHHHW 103

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  L                +I  ++H +   D+   G+  ++ ++TP HT GHI
Sbjct: 104 DHAGGNEKL-VKLWPKELEVYGGDDRIGALNHKVQQDDSLTIGNLKVRCLSTPCHTTGHI 162

Query: 120 CYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEY 173
           CYH        +  +  GDTLF  GCGR FE +  EM+++   K+ +  D T ++ GHEY
Sbjct: 163 CYHVTAADGTGEGAVFTGDTLFQGGCGRFFEGTPEEMYDALCTKLSALPDNTKVFCGHEY 222

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T  N  FA   +P N  +Q+     K  R+    T PSTI  EK  NPF+R+   +++K+
Sbjct: 223 TLQNMSFARHVEPDNEIIQQRIEWAKHRRASQDPTVPSTIGEEKTWNPFMRVHEATVQKH 282

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
                   ++V   LR  K+  K
Sbjct: 283 AGGA-TDPISVMGSLRKEKDTFK 304


>gi|149377449|ref|ZP_01895192.1| putative hydroxyacylglutathione hydrolase GloB [Marinobacter
           algicola DG893]
 gi|149358290|gb|EDM46769.1| putative hydroxyacylglutathione hydrolase GloB [Marinobacter
           algicola DG893]
          Length = 264

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 76/266 (28%), Positives = 116/266 (43%), Gaps = 13/266 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++N AI  ++DN+   + N + R    +D      + + L + G  L  I  THHH D
Sbjct: 1   MLTIN-AIPAFNDNYIWCLSNSEDRKALIVDPGQAEPVIEFLADNGLELDTILVTHHHPD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L K             S   G    +  GD   +      ++  PGHT+ HI 
Sbjct: 60  HVGGVSKLAKTVPDCRIIGPAN-SPFKGATSEVHPGDEVVWQHLTFDVLGVPGHTLDHIA 118

Query: 121 YHFMNDHFL----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           Y+             GDTLF  GCGR+FE S  +M +SLE ++   D T +Y  HEYT  
Sbjct: 119 YYTDVHVNGRPVLFCGDTLFVCGCGRLFEGSPEQMKQSLESLRGLPDDTAVYCAHEYTLA 178

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN--- 233
           N  FA    P +  L+++ +  +  R   + T PS +  EK++NPFLR ++ ++      
Sbjct: 179 NLKFARHWLPDDEPLREFEAHCQKRRDDGMPTVPSILGEEKQLNPFLRWDDEAVVAAARQ 238

Query: 234 ----LNMENASNLAVFTELRIRKNQS 255
                 +   S+  VF   R  K+  
Sbjct: 239 YAQKAGLAVKSDNDVFAATRHGKDTF 264


>gi|222111167|ref|YP_002553431.1| hydroxyacylglutathione hydrolase [Acidovorax ebreus TPSY]
 gi|221730611|gb|ACM33431.1| hydroxyacylglutathione hydrolase [Acidovorax ebreus TPSY]
          Length = 259

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/264 (31%), Positives = 132/264 (50%), Gaps = 13/264 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L + +  + DN+  ++++ +      +D  D   + + LR  G  L  I  THHH D
Sbjct: 1   MKNL-LPLPAFADNYIWMLYDAQ--RAVVVDPGDAEPVLQALRSMGLPLEAILVTHHHGD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++    T++GP      +P     LS GDT         ++  PGHT GHI 
Sbjct: 58  HVGGVNALREATGATVYGPAT--EPMPEPLIRLSGGDTLQVLGLTFSVLDVPGHTAGHIA 115

Query: 121 YHFMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           Y+  +   +  L  GDTLFS GCGR+FE +  +M  SL+ + +    T +   HEYT +N
Sbjct: 116 YYCADMEGEPLLLCGDTLFSGGCGRLFEGTPTQMQASLDTLAALPGNTRVCCAHEYTLSN 175

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA + +PHN  L +Y ++ +S R  +  T PS I++E+ +NPFLR    ++ +  +  
Sbjct: 176 LKFARAVEPHNAALLQYITECESRRRADQPTLPSRIAIERDINPFLRTRVATVAQAAHGF 235

Query: 238 NA-----SNLAVFTELRIRKNQSK 256
           +A        AV   LR  KN+ +
Sbjct: 236 DALIDPREPAAVLAALRQWKNEFR 259


>gi|297828043|ref|XP_002881904.1| glyoxalase 2-1 [Arabidopsis lyrata subsp. lyrata]
 gi|297327743|gb|EFH58163.1| glyoxalase 2-1 [Arabidopsis lyrata subsp. lyrata]
          Length = 331

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 92/256 (35%), Positives = 142/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   + + L  K W LT+I NTHHH D
Sbjct: 76  SSLKIELVPCSKDNYAYLLHDEDTGTVGVVDPSEAAPVIEALSRKNWNLTYILNTHHHDD 135

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H ++++ TPGHT GHI 
Sbjct: 136 HIGGNAELKERYGAKVIGSAVDKDRIPGIDILLKDSDKWMFAGHEVRVLDTPGHTQGHIS 195

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI S  D T+IY G E T  N  F
Sbjct: 196 FYFPGSATIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVSLPDDTNIYCGRENTAGNLKF 255

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-A 239
           ALS +P N  LQ Y ++V  +RSQ L + P+T+ +EK  NPFLR  +  +RK+L++ + A
Sbjct: 256 ALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVEKACNPFLRTWSKDIRKSLSIPDSA 315

Query: 240 SNLAVFTELRIRKNQS 255
           +       ++  +++ 
Sbjct: 316 TEAEALRRIQRARDRF 331


>gi|115452831|ref|NP_001050016.1| Os03g0332400 [Oryza sativa Japonica Group]
 gi|108707977|gb|ABF95772.1| Hydroxyacylglutathione hydrolase, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113548487|dbj|BAF11930.1| Os03g0332400 [Oryza sativa Japonica Group]
 gi|215736998|dbj|BAG95927.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218192761|gb|EEC75188.1| hypothetical protein OsI_11422 [Oryza sativa Indica Group]
 gi|222624869|gb|EEE59001.1| hypothetical protein OsJ_10718 [Oryza sativa Japonica Group]
          Length = 258

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 110/256 (42%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  LI +   +  AA+D  +   +     E G  +  +  THHH DH   N
Sbjct: 4   IPVACLEDNYAYLIVDESTKSAAAVDPVEPEKVLAAAAEVGVRIDCVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             + +             +     D   +           I  + TP HT GHI Y+   
Sbjct: 64  EKMAQSVPGIKVYGGSLDNVKGCTDQVENGTKLSLGKDIEILCLHTPCHTKGHISYYVTS 123

Query: 123 -FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
               D  +  GDTLF  GCGR FE +  +M++S    + S    T +Y GHEYT  N  F
Sbjct: 124 KEEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKPTQVYCGHEYTVKNLKF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L+ +P N ++++     +  R  N  T PSTI  E + N F+R++   ++     +  S
Sbjct: 184 ILTVEPDNEKVKQKLEWAQKQREANQPTIPSTIGEEFETNTFMRVDLPEIQAKFGAK--S 241

Query: 241 NLAVFTELRIRKNQSK 256
            +    E+R  K+  K
Sbjct: 242 PVEALREVRKTKDNWK 257


>gi|186683109|ref|YP_001866305.1| beta-lactamase domain-containing protein [Nostoc punctiforme PCC
           73102]
 gi|226724003|sp|B2IVH7|GLO2_NOSP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|186465561|gb|ACC81362.1| beta-lactamase domain protein [Nostoc punctiforme PCC 73102]
          Length = 257

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 136/256 (53%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+++ K  + A +D  +   + K L E    L  IFNTHHH DH   N
Sbjct: 4   IRLEALSDNYIFLLYDDKRNIAAVVDPAEAQPVLKKLAELKADLVAIFNTHHHNDHVGGN 63

Query: 66  LNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + F    ++G  E+  +IPG    L  GD  +F     ++I  PGHT  HI Y+F 
Sbjct: 64  KQLIEKFPQLIVYGGAEDRGRIPGQKVFLQQGDRVEFADRIAEVIFVPGHTRAHIAYYFP 123

Query: 125 NDH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLFS GCGR+FE +  +M +SL K++S  D T I+  HEYT  N  
Sbjct: 124 PQEASETGDLFCGDTLFSGGCGRLFEGTPTQMVDSLSKLRSLPDNTRIWCAHEYTLKNLQ 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N +LQ+  ++VK+ RS+   T PS + +EK  NPFLR +  SL+  +  +++
Sbjct: 184 FALTVDGDNADLQRRFNEVKAYRSRGEATIPSLLGVEKHTNPFLRWDQASLQSTV--KSS 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F  +R  KN  
Sbjct: 242 DGVQTFARIREMKNNF 257


>gi|299531591|ref|ZP_07044996.1| beta-lactamase-like protein [Comamonas testosteroni S44]
 gi|298720307|gb|EFI61259.1| beta-lactamase-like protein [Comamonas testosteroni S44]
          Length = 257

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/258 (29%), Positives = 116/258 (44%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  ++H+ +      +D      +   L ++G  L  I  THHH DH    
Sbjct: 4   LPIPAFSDNYIWMLHDAE--HAVVVDPGQAEPVLATLAQRGLKLQGILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             ++      ++GP      +P     +  GD  +    P ++I  PGHT GHI +    
Sbjct: 62  DAIRAATGAPVWGPAY--EPLPEPVTRVQGGDHVELLGGPWQVIDVPGHTSGHIAFFSTL 119

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             +   L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 120 AQDQPLLFCGDTLFSGGCGRLFEGTAAQMQASLDALAALPGNTLVCCAHEYTISNLRFAQ 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P+N EL +Y    + +R     T PST+  E  VNPF+R     +       +    
Sbjct: 180 AVEPNNPELAQYLEYCQQLRKNGQPTLPSTLQTELAVNPFMRSRAADVIAAAMHHDPQTR 239

Query: 240 --SNLAVFTELRIRKNQS 255
                +V   LR  KN  
Sbjct: 240 PEEPASVLATLRQWKNVF 257


>gi|170732608|ref|YP_001764555.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia MC0-3]
 gi|254245768|ref|ZP_04939089.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia PC184]
 gi|124870544|gb|EAY62260.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia PC184]
 gi|169815850|gb|ACA90433.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia MC0-3]
          Length = 273

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 135/275 (49%), Gaps = 21/275 (7%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+      +    +GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVEALQHSQPADVPLTVYGPAAEAIGVVTQPLSGGDRVTLDAPAVAFDVLDVPGHT 118

Query: 116 IGHICYHFMND----------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
            GHI Y                 +  GDTLFS GCGR+FE + A+M  SL+ + +    T
Sbjct: 119 RGHIAYFQAAGQGAAGQGNAVPHVFCGDTLFSCGCGRLFEGTPAQMLGSLDALAALPGDT 178

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            ++  HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R 
Sbjct: 179 RVHCAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRA 238

Query: 226 ENTSLRKNLNME----NASNLAVFTELRIRKNQSK 256
           ++ ++   L  E        LA FT +R  KN+ +
Sbjct: 239 DSAAIHATLEAELHETVTDRLAAFTLMREWKNRFR 273


>gi|119897499|ref|YP_932712.1| hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
 gi|119669912|emb|CAL93825.1| probable hydroxyacylglutathione hydrolase [Azoarcus sp. BH72]
          Length = 258

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/262 (27%), Positives = 111/262 (42%), Gaps = 11/262 (4%)

Query: 1   MTSLNI---AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHH 57
           M  L +    I  + DN+  L+          +D      +  +L  +   L  +  THH
Sbjct: 1   MRPLPLRVRPIPAFQDNYIWLLTRGD--EAVVVDPGTAGPVLAVLTAERLRLRAVLITHH 58

Query: 58  HIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           H DH      + +     ++GP  E   +        +           +++A PGHT G
Sbjct: 59  HDDHVGGVAEVLRHAAVPVYGPAGEDIAVLTHRVADGERVAVLDDHPGFEVLALPGHTAG 118

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y   +   L  GD LF  GCGR+FE + A+M  +L ++ +    T +Y  HEY+  N
Sbjct: 119 HIGY--FDGTHLFCGDVLFPCGCGRVFEGTPAQMHAALARLAALPPATQVYCAHEYSLAN 176

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
           A FAL+ +P N  LQ     +++ R+    T PS++  E   NPFLR    +LR+     
Sbjct: 177 ARFALAAEPGNRLLQGRQRWMEARRAAGEPTVPSSLRDELDTNPFLRCTEPALRRAAADW 236

Query: 235 -NMENASNLAVFTELRIRKNQS 255
                     VF  LR  KN  
Sbjct: 237 RGHPIEDEAEVFAALRDWKNHF 258


>gi|113477245|ref|YP_723306.1| hydroxyacylglutathione hydrolase [Trichodesmium erythraeum IMS101]
 gi|122964586|sp|Q10Y41|GLO2_TRIEI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110168293|gb|ABG52833.1| Hydroxyacylglutathione hydrolase [Trichodesmium erythraeum IMS101]
          Length = 257

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/254 (37%), Positives = 139/254 (54%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+H+    + A +D  +   +   L   G  L  IFNTHHH DH  AN  
Sbjct: 6   LPALSDNYIFLLHDPNQNIGAVVDPAEVRPVIDKLESLGAELVTIFNTHHHFDHVGANKQ 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM-- 124
           L + F    ++G +E+  +IPG    L +GD   F     +++  PGHTIGHI Y+F   
Sbjct: 66  LIQKFPQLKVYGGVEDRGRIPGQQVFLQEGDRVHFADRVGEVLFVPGHTIGHIAYYFPSV 125

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLF+ GCGR+FE + A+M +SL K+++  D T I+  HEYT  N  FA
Sbjct: 126 AFGETGELFCGDTLFAGGCGRLFEGTPAQMVDSLNKLRNLPDNTRIWCAHEYTLKNLQFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ D  N +LQ   ++VK+ R +N  T PS I +EK+ NPFLR E  +L+  +  ++   
Sbjct: 186 ITVDKDNTDLQSRWAEVKTARGRNEATVPSMIGVEKRTNPFLRWEQPALQLAV--QSQDP 243

Query: 242 LAVFTELRIRKNQS 255
           +  F  LR RK++ 
Sbjct: 244 VQTFARLRGRKDRF 257


>gi|254423476|ref|ZP_05037194.1| metallo-beta-lactamase superfamily protein [Synechococcus sp. PCC
           7335]
 gi|196190965|gb|EDX85929.1| metallo-beta-lactamase superfamily protein [Synechococcus sp. PCC
           7335]
          Length = 290

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 134/254 (52%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  ++HN      A +D  D   + + L E G  L  IFNTHHH DH   N  
Sbjct: 39  LPARSDNYIFVLHNPADNTAAVVDPADAPPVLQKLDELGATLITIFNTHHHNDHVGGNRE 98

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF--- 123
           L  +F    ++G  ++  +IPG  H L +GD   F     ++I  PGHT GHI Y+F   
Sbjct: 99  LLDRFPKAEVYGGAQDQGRIPGQRHFLGEGDRVSFADRTGRVIFVPGHTRGHIAYYFLPI 158

Query: 124 --MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLF+ GCGR+FE +  +M  SL K+++  D TH++ GHEYT +N  FA
Sbjct: 159 KANEPGDLFCGDTLFAGGCGRLFEGTPTQMATSLAKLRNLPDTTHVWCGHEYTLSNLKFA 218

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           ++ +  N EL+   + V + R QN  T PS +S EK  NPFLR  +  L+   N +    
Sbjct: 219 ITVEGKNEELRSRLASVTTARQQNQPTIPSLLSTEKATNPFLRWNSPELQSVANSQ--DP 276

Query: 242 LAVFTELRIRKNQS 255
           + VF  +R  K++ 
Sbjct: 277 ITVFAHIRKLKDRF 290


>gi|254717995|ref|ZP_05179806.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
          Length = 257

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 12  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 71

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 72  AKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 131

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N 
Sbjct: 132 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNS 191

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 192 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 251

Query: 250 IRKNQS 255
            RK+  
Sbjct: 252 KRKDMF 257


>gi|159185823|ref|NP_356997.2| glyoxalase II [Agrobacterium tumefaciens str. C58]
 gi|81591191|sp|Q8U9W1|GLO2_AGRT5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|159140957|gb|AAK89782.2| glyoxalase II [Agrobacterium tumefaciens str. C58]
          Length = 256

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 118/256 (46%), Positives = 168/256 (65%), Gaps = 1/256 (0%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I +     DNF +L+H+ +   TAAIDAP+   I + L   GW LTHIF THHH 
Sbjct: 1   MKPLEIDVFLCRSDNFGVLLHDPESGATAAIDAPEEGPILRALDGHGWKLTHIFTTHHHQ 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  ANL LK  F C + GP +E+  IPG+D   +DGD F+F    +++IATPGHT GHI
Sbjct: 61  DHVEANLVLKDKFRCEVHGPYDEAIAIPGLDRSQADGDEFEFAGRRVQVIATPGHTAGHI 120

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CY+  +D  L   DTLF++GCGR+FE   A+M+ S +K+ +  D T +YFGHEYT +NA 
Sbjct: 121 CYYLPDDGLLFAADTLFAMGCGRLFERPAADMWHSFQKLMALPDDTRVYFGHEYTLSNAR 180

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ DP N  L++  ++V++ R  N +T P+TI LEK+ NP++R+ +  +R++L +E A
Sbjct: 181 FALTVDPDNAVLRERAARVETARQANEFTIPTTIGLEKQTNPYMRVADAGIRRHLGLEGA 240

Query: 240 SNLAVFTELRIRKNQS 255
           ++  VF E+R RK+  
Sbjct: 241 ADADVFAEIRTRKDNF 256


>gi|166367672|ref|YP_001659945.1| hydroxyacylglutathione hydrolase [Microcystis aeruginosa NIES-843]
 gi|189041224|sp|B0JW10|GLO2_MICAN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166090045|dbj|BAG04753.1| probable hydroxyacylglutathione hydrolase [Microcystis aeruginosa
           NIES-843]
          Length = 257

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 88/254 (34%), Positives = 139/254 (54%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           ++   DN+  L+++   ++ A +D  +   + + L      L  IFNTHHH DH  AN  
Sbjct: 6   LNALSDNYIFLLYDPAQKIAAVVDPAEPEPVFRRLEALQVDLVAIFNTHHHGDHVGANQA 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L   +    ++G  E+  +IPG    L +GD  +F     ++   PGHT  HI Y+F   
Sbjct: 66  LINRYPHLCVYGGKEDRGRIPGQQLFLEEGDRVEFAGRWAEVFFVPGHTRAHIAYYFPPV 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +         GDTLFS GCGR+FE +  +M  SL K++S  D+T ++  HEYT NN  FA
Sbjct: 126 NPGDYGELFCGDTLFSGGCGRLFEGTPGQMVASLTKLRSLPDQTRVWCAHEYTLNNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP+N  LQ+   +V+  R+++L T P+ +  EK  NPFLR ++ +L   + M+++  
Sbjct: 186 LTVDPNNAALQQRYREVEKHRAEDLPTIPAILGTEKLTNPFLRWDSPAL--AMTMDSSEP 243

Query: 242 LAVFTELRIRKNQS 255
           + VF  LR +K+  
Sbjct: 244 VQVFARLRGKKDNF 257


>gi|17986413|ref|NP_539047.1| hydroxyacylglutathione hydrolase, mitochondrial [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502786|ref|NP_698913.1| hydroxyacylglutathione hydrolase [Brucella suis 1330]
 gi|62290790|ref|YP_222583.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700701|ref|YP_415275.1| beta-lactamase-like protein [Brucella melitensis biovar Abortus
           2308]
 gi|225628134|ref|ZP_03786169.1| hydroxyacylglutathione hydrolase [Brucella ceti str. Cudo]
 gi|254690077|ref|ZP_05153331.1| Beta-lactamase-like protein [Brucella abortus bv. 6 str. 870]
 gi|254694565|ref|ZP_05156393.1| Beta-lactamase-like protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696190|ref|ZP_05158018.1| Beta-lactamase-like protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700577|ref|ZP_05162405.1| Beta-lactamase-like protein [Brucella suis bv. 5 str. 513]
 gi|254704947|ref|ZP_05166775.1| Beta-lactamase-like protein [Brucella suis bv. 3 str. 686]
 gi|254707539|ref|ZP_05169367.1| Beta-lactamase-like protein [Brucella pinnipedialis M163/99/10]
 gi|254708924|ref|ZP_05170735.1| Beta-lactamase-like protein [Brucella pinnipedialis B2/94]
 gi|254713649|ref|ZP_05175460.1| Beta-lactamase-like protein [Brucella ceti M644/93/1]
 gi|254715997|ref|ZP_05177808.1| Beta-lactamase-like protein [Brucella ceti M13/05/1]
 gi|254731108|ref|ZP_05189686.1| Beta-lactamase-like protein [Brucella abortus bv. 4 str. 292]
 gi|256030450|ref|ZP_05444064.1| Beta-lactamase-like protein [Brucella pinnipedialis M292/94/1]
 gi|256045540|ref|ZP_05448423.1| Beta-lactamase-like protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059910|ref|ZP_05450096.1| Beta-lactamase-like protein [Brucella neotomae 5K33]
 gi|256112268|ref|ZP_05453189.1| Beta-lactamase-like protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158434|ref|ZP_05456332.1| Beta-lactamase-like protein [Brucella ceti M490/95/1]
 gi|256253854|ref|ZP_05459390.1| Beta-lactamase-like protein [Brucella ceti B1/94]
 gi|256258330|ref|ZP_05463866.1| Beta-lactamase-like protein [Brucella abortus bv. 9 str. C68]
 gi|256370338|ref|YP_003107849.1| hydroxyacylglutathione hydrolase, putative [Brucella microti CCM
           4915]
 gi|260169359|ref|ZP_05756170.1| hydroxyacylglutathione hydrolase, putative [Brucella sp. F5/99]
 gi|75496179|sp|Q57AW2|GLO2_BRUAB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81751975|sp|Q8FYE7|GLO2_BRUSU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81852553|sp|Q8YJF4|GLO2_BRUME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123546237|sp|Q2YLU8|GLO2_BRUA2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160386917|sp|A5VSR1|GLO2_BRUO2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|17982007|gb|AAL51311.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|23348807|gb|AAN30828.1| hydroxyacylglutathione hydrolase, putative [Brucella suis 1330]
 gi|62196922|gb|AAX75222.1| hydroxyacylglutathione hydrolase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82616802|emb|CAJ11892.1| Beta-lactamase-like [Brucella melitensis biovar Abortus 2308]
 gi|225616959|gb|EEH14006.1| hydroxyacylglutathione hydrolase [Brucella ceti str. Cudo]
 gi|256000501|gb|ACU48900.1| hydroxyacylglutathione hydrolase, putative [Brucella microti CCM
           4915]
 gi|326539650|gb|ADZ87865.1| hydroxyacylglutathione hydrolase [Brucella melitensis M5-90]
          Length = 257

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 155/246 (63%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 12  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 71

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 72  EKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 131

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N 
Sbjct: 132 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNS 191

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 192 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 251

Query: 250 IRKNQS 255
            RK+  
Sbjct: 252 KRKDMF 257


>gi|284929263|ref|YP_003421785.1| hydroxyacylglutathione hydrolase [cyanobacterium UCYN-A]
 gi|284809707|gb|ADB95404.1| hydroxyacylglutathione hydrolase [cyanobacterium UCYN-A]
          Length = 258

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 139/254 (54%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+HN K +    +D  +  +I   L + G  LT I NTHHH DH  AN  
Sbjct: 6   LPALSDNYIFLLHNFKNKTAVVVDPAEYDVIINCLNKLGIRLTAILNTHHHQDHIGANKK 65

Query: 68  LKKFFNCT-IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L + F    ++G  ++  +IPG +H L +GD F+F     +I   PGHT GHI Y+F   
Sbjct: 66  LIEHFPHISVYGSEQDKGRIPGQNHYLKEGDQFNFAGKNAEIFFIPGHTNGHIAYYFPPS 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                     GDTLF+ GCGR+FE + ++M++SL K+++  D T ++  HEYT NN  FA
Sbjct: 126 SNQKIGELFCGDTLFASGCGRLFEGTASQMYKSLMKLRNLPDTTRVWCSHEYTLNNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ + +N  L    +K  S R  N  T PS +  EK+ NPFLR ++ SL++ + +     
Sbjct: 186 LTIEKNNHNLLLRYNKAISTRKNNKATIPSFLKEEKETNPFLRCDSQSLQEIMGIN--DP 243

Query: 242 LAVFTELRIRKNQS 255
           + VF ++R  K+  
Sbjct: 244 VKVFQKIRELKDNF 257


>gi|76573347|gb|ABA46778.1| unknown [Solanum tuberosum]
          Length = 258

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/261 (27%), Positives = 119/261 (45%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L+I      DN+  +I +   +  A +D  + + + ++ +E    L  +  THHH D
Sbjct: 1   MKVLHI--PCLDDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K+             +     D   +           I  + TP HT GHI 
Sbjct: 59  HAGGNDKIKQLVPGIKIYGGSVDNVRGCTDKVENGDRISLGVDISILSLHTPAHTKGHIS 118

Query: 121 YHFMN----DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           Y+  +    D  +  GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT 
Sbjct: 119 YYVTDKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTLVYCGHEYTV 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FAL+ +P N ++ +  +  +  R   L T PSTI  E + NPF+R++   ++  + 
Sbjct: 179 KNLQFALTVEPDNAKIAQKLAWAERQRRVGLPTIPSTIQEELESNPFMRVDLPEVQDKVG 238

Query: 236 MENASNLAVFTELRIRKNQSK 256
            +  S +    E+R RK+  K
Sbjct: 239 CK--SPVEAMREIRQRKDNWK 257


>gi|254480561|ref|ZP_05093808.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2148]
 gi|214039144|gb|EEB79804.1| hydroxyacylglutathione hydrolase [marine gamma proteobacterium
           HTCC2148]
          Length = 257

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/254 (32%), Positives = 126/254 (49%), Gaps = 7/254 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  ++DN+  LI          +D  D  ++ + L E+   LT +  THHH DH     
Sbjct: 6   PIPAFNDNYIWLICIDGTDQAYVVDPGDAEVVEQALEERQLQLTGVLITHHHFDHVGGLA 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           +LK  +N  ++GP   S  I G+DH +  GD  D     ++++  PGHT+ HI Y    D
Sbjct: 66  DLKAKYNPVVYGPDNPS--IDGLDHIVRAGDVIDVLGASLEVLEVPGHTLDHIAYFLAGD 123

Query: 127 HF-LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +  GDTLF+ GCGR+FE +   M  SL  +     +T IY  HEYT  N  FA + +
Sbjct: 124 APLVFCGDTLFAGGCGRVFEGTPDMMHASLCALAELPAETRIYCAHEYTLANLAFAQAVE 183

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
           P+N  L +     ++ R+    T PST++LE   NPF+R E   L+ +L  ++       
Sbjct: 184 PNNPALAQRVVADQASRAAGEPTVPSTLALELATNPFVRCETHELQNSLRQQDKLISDLP 243

Query: 242 LAVFTELRIRKNQS 255
            +VF  +R  K+  
Sbjct: 244 ASVFATVRGWKDSF 257


>gi|213983201|ref|NP_001135503.1| hydroxyacylglutathione hydrolase, mitochondrial [Xenopus (Silurana)
           tropicalis]
 gi|257096380|sp|B4F6K2|GLO2_XENTR RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|195539928|gb|AAI67912.1| Unknown (protein for MGC:135696) [Xenopus (Silurana) tropicalis]
          Length = 313

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 120/255 (47%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ + + +  A +D      +   +++ G  LT +  THHH DH   N  
Sbjct: 59  IPALTDNYMYLLIDEESKEAAIVDPVQPQKVVDAVKKHGVKLTTVLTTHHHWDHAGGNEK 118

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K  +          S+I  +   +S   TF  GS  +K + TP HT GHICY+    +
Sbjct: 119 LVKMVSGLKVY--GGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPN 176

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+ + +E +     +T +Y GHEYT NN  FA
Sbjct: 177 STEPPAVFTGDTLFVAGCGKFFEGTPEEMYAALIEVLGRLPPETRVYCGHEYTINNLKFA 236

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   +    T PST++ E   NPF+R+   S++++        
Sbjct: 237 RHVEPCNDAIKQKLAWAKETYNSGEPTIPSTLAEEFTFNPFMRVREKSVQEHAGER--DP 294

Query: 242 LAVFTELRIRKNQSK 256
           ++    +R  K+  K
Sbjct: 295 ISTMGAIRKEKDHFK 309


>gi|332162779|ref|YP_004299356.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318606885|emb|CBY28383.1| hydroxyacylglutathione hydrolase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667009|gb|ADZ43653.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863687|emb|CBX73791.1| hydroxyacylglutathione hydrolase [Yersinia enterocolitica W22703]
          Length = 251

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 137/252 (54%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +  +L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADEQ-KHCVIVDPGESAPVLAVLSQGQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L + F        +E++   G    ++ GD    G    ++IA PGHT+GHI Y+   
Sbjct: 63  ADLHRHFPEIPVYGPQETA-NKGATIIVNGGDHLSIGGQNYQVIAVPGHTLGHIAYYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTPAQMYASIQQLAQLPDETLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R++N  + P  + +E+K+N FLR ++  L++ + + +  +  ++
Sbjct: 180 PSDQDIATYQQQIMQLRAKNQPSLPVKLQIERKINVFLRCDDIDLQRKIGVMSPPDSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|239996322|ref|ZP_04716846.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii ATCC 27126]
          Length = 263

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 79/254 (31%), Positives = 116/254 (45%), Gaps = 9/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+   I+N        +D  D   +   ++ KG  L+ +  THHH DHT    
Sbjct: 14  PIPAFTDNYIWCIYNESS--AIVVDPGDAEPVLTFIKAKGLTLSAVLITHHHRDHTGGIA 71

Query: 67  NLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            L        + GP     +         D  +       ++++  PGHT+ HI +    
Sbjct: 72  KLVSAVPDLPVIGPRGNHIRGITKSVSQGDTVSLPVFKMALQVMEVPGHTLDHIAFFGHG 131

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE S  +M  SL K+K   D T ++  HEYT+ N  FAL+ +
Sbjct: 132 A--LFCGDTLFSAGCGRLFEGSPEQMHHSLNKLKRLPDTTKVFCTHEYTQANVQFALAVE 189

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASN 241
           P N  L  Y   V   R+Q   T PS +  +K +NPFLR    S++           A +
Sbjct: 190 PDNKALCDYAQWVAEKRAQGQPTLPSNLKEQKNINPFLRAHELSVKTAAEAYCENNLADD 249

Query: 242 LAVFTELRIRKNQS 255
           +AVF  +R  K++ 
Sbjct: 250 VAVFAAVRRWKDEF 263


>gi|302878566|ref|YP_003847130.1| hydroxyacylglutathione hydrolase [Gallionella capsiferriformans
           ES-2]
 gi|302581355|gb|ADL55366.1| hydroxyacylglutathione hydrolase [Gallionella capsiferriformans
           ES-2]
          Length = 257

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 82/260 (31%), Positives = 118/260 (45%), Gaps = 8/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +  A+  + DN+   IHN        +D  D   +   L E    LT IF TH H D
Sbjct: 1   MYKIT-ALPAFQDNYIWAIHNDS--EAVVVDPGDAVPVLAYLAENNLKLTGIFCTHRHHD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+  +N  ++G   E +          +    D       I+  PGH   HI 
Sbjct: 58  HVGGIEKLRAVYNVAVYGRRHEKNPHITHALLEGEQVRLDAFGLVFDIMEIPGHLDDHIA 117

Query: 121 YHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           +   N        GD LF  GCG+ FE S A++  SL++I    + T  Y  HEYT +N 
Sbjct: 118 FFAQNAVPPLLFCGDVLFGAGCGKSFEGSVAQLHHSLQRISMLPEATLAYCAHEYTASNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---N 235
            FA  C+P N  L+   +    +R+ NL T PST++LEK  NPFLR   T++ ++L    
Sbjct: 178 RFAAVCEPDNAALKIRIADTARLRAANLSTVPSTLALEKATNPFLRCTETAIIRSLQQRG 237

Query: 236 MENASNLAVFTELRIRKNQS 255
           + + S  AVF  LR  ++  
Sbjct: 238 LTDTSEAAVFAALRQWRDSF 257


>gi|332306244|ref|YP_004434095.1| hydroxyacylglutathione hydrolase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173573|gb|AEE22827.1| hydroxyacylglutathione hydrolase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 257

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 84/261 (32%), Positives = 122/261 (46%), Gaps = 10/261 (3%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M SL I  I  + DN+   + N +      +D  D   + K        LT I  THHH 
Sbjct: 1   MPSLKIRPIKAFEDNYIWCLTNGES--CVVVDPGDANPVIKYCSRNNLILTDILITHHHS 58

Query: 60  DHTR-ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT   N  +  F   T++GP     +         D           +++  PGHT+ H
Sbjct: 59  DHTGGVNDLVNAFEGVTVYGPQNPQIQSITQRLQAGDMVQLALLDVEFRVLEVPGHTLDH 118

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I Y       L  GDTLFS GCGR+FE +  +M++SL ++ + +D T +Y  HEYT  N 
Sbjct: 119 IAYVG--SCGLFCGDTLFSAGCGRLFEGTPEQMYQSLGQLTALADDTKVYCTHEYTLANL 176

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----L 234
            FAL+ DP N  L  Y    +S R     T PSTI  +K++NPFLR  + +++ +     
Sbjct: 177 KFALAVDPENENLLNYKGWAESQRVDLKPTLPSTIGQQKEINPFLRTASDAVKAHAEQYA 236

Query: 235 NMENASNLAVFTELRIRKNQS 255
               ++  +VF  LR  K+  
Sbjct: 237 EQTLSTPESVFAALRAWKDNF 257


>gi|320538888|ref|ZP_08038564.1| putative hydroxyacylglutathione hydrolase [Serratia symbiotica str.
           Tucson]
 gi|320031048|gb|EFW13051.1| putative hydroxyacylglutathione hydrolase [Serratia symbiotica str.
           Tucson]
          Length = 251

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 128/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ + ++     ID  ++  +   L         I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLL-DDQHGHCVIIDPGESAPVLGALYRLKLIPDAILLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   +        +E++        + DG+ F+        IA PGHT+GH+ ++   
Sbjct: 63  AQVVAHYPNLPVYGPQETADKGVDHV-VHDGEKFEINGRQYVTIALPGHTLGHVAFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGR+FE +  +M++S +++    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTMFSAGCGRLFESTAEQMYDSFQQLAQLPDNTLICCAHEYTLSNLKFARAVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL--A 243
           P + E++ Y   V+++R++N  + P+ + LE+K+N FLR  +  L+K L   +      +
Sbjct: 180 PEDREIEVYQQHVEALRAKNQPSVPTNLQLERKINLFLRCHDYDLQKKLGFNSPPKQLHS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR+RK+  
Sbjct: 240 VFSELRLRKDNF 251


>gi|289741115|gb|ADD19305.1| glyoxylase [Glossina morsitans morsitans]
          Length = 301

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 124/259 (47%), Gaps = 8/259 (3%)

Query: 3   SLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           ++ + I     DN+  LI     R  A +D      + + ++++   L  +  THHH DH
Sbjct: 45  AMQVKILPALQDNYMYLIICGSTREAAIVDPVYPDTVLQAVKDENVKLKKVLTTHHHWDH 104

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
              N  L               ++I G++  +   D    G+  +  + TP HT GHICY
Sbjct: 105 AGGNEKL-LQMFSLPLEVYGGDNRIGGLNCMVKQNDHLKIGNLDVTCLFTPCHTSGHICY 163

Query: 122 HFMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
           +  +   D ++  GDTLF  GCGR FE +  +M+++  +++ S  D T ++ GHEYT  N
Sbjct: 164 YVQSATGDRYVFTGDTLFQGGCGRFFEGTADQMYDALCKQLSSLPDDTKVFCGHEYTLQN 223

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             +AL  +PHN  + K     K  R+    T PSTI+ EK  NPF+R+   S++K+   +
Sbjct: 224 MSYALHVEPHNENILKRIEWAKLRRATKSPTVPSTIAQEKSWNPFMRVHEPSVQKHA--Q 281

Query: 238 NASNLAVFTELRIRKNQSK 256
               +     LR  K+  K
Sbjct: 282 QTDPIRTMGSLRKEKDNFK 300


>gi|229590110|ref|YP_002872229.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           SBW25]
 gi|259492013|sp|C3K9Q0|GLO2_PSEFS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|229361976|emb|CAY48876.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           SBW25]
          Length = 255

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 86/258 (33%), Positives = 133/258 (51%), Gaps = 10/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ +   +  A +D  D   +   L +  GW L+ I  THHH DH
Sbjct: 2   IQISALPAFTDNYIWLLQDPHTQRCAVVDPGDAAPVLDWLEQNPGWALSDILVTHHHHDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK   N  ++GP     KIP  D  L+D D          I   PGHT+GHI +
Sbjct: 62  VGGVEQLKGATNAKVYGPAN--EKIPARDVALNDNDRITVLGWDFDIYTVPGHTLGHITF 119

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +      L  GDTLF+ GCGR+FE +  +M+ SLE++ +    T +Y  HEYT++N  FA
Sbjct: 120 YH--SGVLLCGDTLFAAGCGRLFEGTPEQMYTSLERLAALPADTRVYCTHEYTQSNLKFA 177

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            + +P N ++ +    V+ +R++   T PS ++LE+  NPFLR   TS+++  +  N  +
Sbjct: 178 QAVEPDNADIAERVESVRQLRARGEITLPSNLALERLTNPFLRTSETSVKQKADERNGRD 237

Query: 242 ----LAVFTELRIRKNQS 255
                 VF  LR  K++ 
Sbjct: 238 NRSGAEVFASLRAWKDKF 255


>gi|195378620|ref|XP_002048081.1| GJ11540 [Drosophila virilis]
 gi|194155239|gb|EDW70423.1| GJ11540 [Drosophila virilis]
          Length = 305

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 82/261 (31%), Positives = 123/261 (47%), Gaps = 9/261 (3%)

Query: 3   SLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S+ + I     DN+  LI + K    A +D  D  ++ K +RE+   L  +  THHH DH
Sbjct: 46  SMQVKILPALQDNYMYLIVDSKTHEAAVVDPVDPELVIKTVREENLKLNKVLTTHHHWDH 105

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
              N  L                +I  +   +   DTF  G+  ++ ++TP HT GHICY
Sbjct: 106 AGGNEKL-VKLWTGELQVYGGDDRIGAMTRKVRQDDTFTIGNLNVRCLSTPCHTSGHICY 164

Query: 122 HFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           H    +         GDTLF  GCGR FE +  EM+++   K+ +  D T ++ GHEYT 
Sbjct: 165 HVTASNSHDPGAVFTGDTLFQGGCGRFFEGTPQEMYDALCAKLSALPDDTKVFCGHEYTL 224

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FA   +P N  +Q      K  R+    T PSTI  EK  NPF+R+  T+++++  
Sbjct: 225 QNMSFARHVEPDNKCIQTRIEWAKLRRASKDPTVPSTIGEEKSWNPFMRVHETTVQQHAG 284

Query: 236 MENASNLAVFTELRIRKNQSK 256
            +  + +     LR  K+  K
Sbjct: 285 GQ-TNPVITMEMLRKEKDNFK 304


>gi|172060231|ref|YP_001807883.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MC40-6]
 gi|171992748|gb|ACB63667.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MC40-6]
          Length = 273

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 135/275 (49%), Gaps = 21/275 (7%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVAALRDSQPDDAPLVVYGPAAEAIGVVTRSLAGGDRVTLDAPALAFDVLDVPGHT 118

Query: 116 IGHICYHFMND----------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
            GHI Y                 +  GDTLFS GCGR+FE + A+M  SL+ + +    T
Sbjct: 119 RGHIAYFQAAGVGGAGQGAATPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDT 178

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            ++  HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R 
Sbjct: 179 RVHCAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRA 238

Query: 226 ENTSLRKNLNME----NASNLAVFTELRIRKNQSK 256
           ++ ++   L  E        LA FT +R  KN+ +
Sbjct: 239 DSAAIHATLEAELHERVPDRLAAFTLMREWKNRFR 273


>gi|300312714|ref|YP_003776806.1| hydroxyacylglutathione hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300075499|gb|ADJ64898.1| hydroxyacylglutathione hydrolase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 264

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 86/263 (32%), Positives = 131/263 (49%), Gaps = 14/263 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  +IH+   R  A +D  D   +   L+ +G  L  I  THHH DH    
Sbjct: 4   LAVPAFDDNYLWIIHD--GRYAAVVDPGDAVPVLAALQAEGLTLAAILLTHHHADHVGGV 61

Query: 66  ------LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH--PIKIIATPGHTIG 117
                      F    ++GP  E S+I G+   L   D  D       +++I  PGHT+G
Sbjct: 62  VELARQAASDTFPIIPVYGPAREQSRIKGMTVPLHGNDQVDIAVLGLRLEVIEVPGHTMG 121

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI YH      L  GDTLF+ GCGR+FE +  +M +SL ++ S   +T +Y  HEYT +N
Sbjct: 122 HIAYHAPEQAMLFCGDTLFAGGCGRLFEGTPQQMVDSLSRLASLPGQTAVYCAHEYTLSN 181

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKN 233
             FA   +P N EL    ++ ++ R +   T P++I+LE++ NPFLR     +    +K 
Sbjct: 182 LKFAAEVEPGNAELHARITRERARRERGEPTVPTSIALERQTNPFLRATEKEILDSLQKA 241

Query: 234 LNMENASNLAVFTELRIRKNQSK 256
             ++    ++ F  LR  KN  K
Sbjct: 242 GRLKELDEVSSFAALREWKNSYK 264


>gi|154245962|ref|YP_001416920.1| hydroxyacylglutathione hydrolase [Xanthobacter autotrophicus Py2]
 gi|154160047|gb|ABS67263.1| Hydroxyacylglutathione hydrolase [Xanthobacter autotrophicus Py2]
          Length = 282

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 98/249 (39%), Positives = 137/249 (55%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+ +LIH+     TA +D P+   +   L ++GW LTHI  THHH DHT+    
Sbjct: 33  VPCLSDNYAVLIHDPVTEATAVVDVPEATPVIAALEKEGWNLTHILVTHHHADHTQGIPA 92

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           +K  F  T+ GP  E+ KIPG+D  + DGD    GS   +++ TPGHT G   Y F  + 
Sbjct: 93  VKARFGATVVGPKSEADKIPGLDVTVVDGDPVAVGSLVGRVLETPGHTAGPATYLFEGEK 152

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF+LGCGR  E     +++SL+++++  +   +Y GHEYT  NA FA + DP 
Sbjct: 153 LLFAGDTLFTLGCGRPLECEPPVLWDSLQRLRALPEDLQVYSGHEYTLANARFAATVDPD 212

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  L +     +  R     T PS +  E   NPFLR ++  + + L M  A    VFTE
Sbjct: 213 NPALIRLYGDAQRKRDAGSPTIPSRLGDEVAANPFLRADDPGMAERLGMAGAEPALVFTE 272

Query: 248 LRIRKNQSK 256
           LR+RKN  K
Sbjct: 273 LRLRKNAFK 281


>gi|148560629|ref|YP_001259758.1| hydroxyacylglutathione hydrolase [Brucella ovis ATCC 25840]
 gi|161619854|ref|YP_001593741.1| hydroxyacylglutathione hydrolase [Brucella canis ATCC 23365]
 gi|163843959|ref|YP_001628363.1| hydroxyacylglutathione hydrolase [Brucella suis ATCC 23445]
 gi|189025004|ref|YP_001935772.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|225853374|ref|YP_002733607.1| hydroxyacylglutathione hydrolase [Brucella melitensis ATCC 23457]
 gi|237816297|ref|ZP_04595290.1| hydroxyacylglutathione hydrolase [Brucella abortus str. 2308 A]
 gi|260546054|ref|ZP_05821794.1| hydroxyacylglutathione hydrolase [Brucella abortus NCTC 8038]
 gi|260562850|ref|ZP_05833336.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260567577|ref|ZP_05838047.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 4 str. 40]
 gi|260755615|ref|ZP_05867963.1| glyoxalase II [Brucella abortus bv. 6 str. 870]
 gi|260758840|ref|ZP_05871188.1| glyoxalase II [Brucella abortus bv. 4 str. 292]
 gi|260760564|ref|ZP_05872907.1| glyoxalase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884641|ref|ZP_05896255.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 9 str. C68]
 gi|261214889|ref|ZP_05929170.1| glyoxalase II [Brucella abortus bv. 3 str. Tulya]
 gi|261217765|ref|ZP_05932046.1| hydroxyacylglutathione hydrolase [Brucella ceti M13/05/1]
 gi|261220992|ref|ZP_05935273.1| hydroxyacylglutathione hydrolase [Brucella ceti B1/94]
 gi|261315020|ref|ZP_05954217.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis
           M163/99/10]
 gi|261316423|ref|ZP_05955620.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis B2/94]
 gi|261321387|ref|ZP_05960584.1| hydroxyacylglutathione hydrolase [Brucella ceti M644/93/1]
 gi|261323882|ref|ZP_05963079.1| hydroxyacylglutathione hydrolase [Brucella neotomae 5K33]
 gi|261751085|ref|ZP_05994794.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 5 str. 513]
 gi|261755647|ref|ZP_05999356.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 3 str. 686]
 gi|261758878|ref|ZP_06002587.1| hydroxyacylglutathione hydrolase [Brucella sp. F5/99]
 gi|265987494|ref|ZP_06100051.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis M292/94/1]
 gi|265991966|ref|ZP_06104523.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993699|ref|ZP_06106256.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996951|ref|ZP_06109508.1| hydroxyacylglutathione hydrolase [Brucella ceti M490/95/1]
 gi|265999286|ref|ZP_05465676.2| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 2 str.
           63/9]
 gi|297247177|ref|ZP_06930895.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|189041218|sp|A9M8S2|GLO2_BRUC2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|189041219|sp|B0CIU0|GLO2_BRUSI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723984|sp|B2S889|GLO2_BRUA1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798840|sp|C0RFI1|GLO2_BRUMB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|148371886|gb|ABQ61865.1| hydroxyacylglutathione hydrolase [Brucella ovis ATCC 25840]
 gi|161336665|gb|ABX62970.1| Probable hydroxyacylglutathione hydrolase [Brucella canis ATCC
           23365]
 gi|163674682|gb|ABY38793.1| Probable hydroxyacylglutathione hydrolase [Brucella suis ATCC
           23445]
 gi|189020576|gb|ACD73298.1| Beta-lactamase-like protein [Brucella abortus S19]
 gi|225641739|gb|ACO01653.1| hydroxyacylglutathione hydrolase [Brucella melitensis ATCC 23457]
 gi|237788364|gb|EEP62579.1| hydroxyacylglutathione hydrolase [Brucella abortus str. 2308 A]
 gi|260096161|gb|EEW80037.1| hydroxyacylglutathione hydrolase [Brucella abortus NCTC 8038]
 gi|260152866|gb|EEW87958.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           16M]
 gi|260157095|gb|EEW92175.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 4 str. 40]
 gi|260669158|gb|EEX56098.1| glyoxalase II [Brucella abortus bv. 4 str. 292]
 gi|260670996|gb|EEX57817.1| glyoxalase II [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675723|gb|EEX62544.1| glyoxalase II [Brucella abortus bv. 6 str. 870]
 gi|260874169|gb|EEX81238.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 9 str. C68]
 gi|260916496|gb|EEX83357.1| glyoxalase II [Brucella abortus bv. 3 str. Tulya]
 gi|260919576|gb|EEX86229.1| hydroxyacylglutathione hydrolase [Brucella ceti B1/94]
 gi|260922854|gb|EEX89422.1| hydroxyacylglutathione hydrolase [Brucella ceti M13/05/1]
 gi|261294077|gb|EEX97573.1| hydroxyacylglutathione hydrolase [Brucella ceti M644/93/1]
 gi|261295646|gb|EEX99142.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis B2/94]
 gi|261299862|gb|EEY03359.1| hydroxyacylglutathione hydrolase [Brucella neotomae 5K33]
 gi|261304046|gb|EEY07543.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis
           M163/99/10]
 gi|261738862|gb|EEY26858.1| hydroxyacylglutathione hydrolase [Brucella sp. F5/99]
 gi|261740838|gb|EEY28764.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 5 str. 513]
 gi|261745400|gb|EEY33326.1| hydroxyacylglutathione hydrolase [Brucella suis bv. 3 str. 686]
 gi|262551419|gb|EEZ07409.1| hydroxyacylglutathione hydrolase [Brucella ceti M490/95/1]
 gi|262764680|gb|EEZ10601.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003032|gb|EEZ15325.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093047|gb|EEZ17197.1| hydroxyacylglutathione hydrolase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659691|gb|EEZ29952.1| hydroxyacylglutathione hydrolase [Brucella pinnipedialis M292/94/1]
 gi|297174346|gb|EFH33693.1| hydroxyacylglutathione hydrolase [Brucella abortus bv. 5 str.
           B3196]
 gi|326409937|gb|ADZ67002.1| Beta-lactamase-like protein [Brucella melitensis M28]
          Length = 260

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 155/246 (63%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 15  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 75  EKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 195 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|265982941|ref|ZP_06095676.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
 gi|306839774|ref|ZP_07472575.1| hydroxyacylglutathione hydrolase [Brucella sp. NF 2653]
 gi|264661533|gb|EEZ31794.1| hydroxyacylglutathione hydrolase [Brucella sp. 83/13]
 gi|306405129|gb|EFM61407.1| hydroxyacylglutathione hydrolase [Brucella sp. NF 2653]
          Length = 260

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 15  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 75  AKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 195 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|145299715|ref|YP_001142556.1| hydroxyacylglutathione hydrolase GloB [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166990452|sp|A4SPI6|GLO2_AERS4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|142852487|gb|ABO90808.1| hydroxyacylglutathione hydrolase GloB [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 254

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 80/254 (31%), Positives = 114/254 (44%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  LI +        +D  D   +   L      L  I  THHH DH    
Sbjct: 5   ITVPAFTDNYIWLIRHE--NHCLVVDPGDAGPVLDRLAALDLQLDAILLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K F        +           L DGD  ++    + +I  PGHT GHI YH   
Sbjct: 63  TALLKHFPHARLYGPKHDPMPDHHGQWLDDGDQINWHGLSLDVIHVPGHTHGHIAYHGHG 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE + A+M +SL+++ +  D T IY  HEYT +N  FA + +
Sbjct: 123 --MLFCGDTLFSGGCGRLFEGTPAQMHDSLQRLAALPDDTLIYCAHEYTLSNLRFAYAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SN 241
           P N  +Q+    +  +R Q L + PS +  E+  N FLR E  S++ +          + 
Sbjct: 181 PDNKAIQQRIGMISKLRQQGLPSLPSRLGDERDFNVFLRCEQDSVKFSAEKYALKCLENP 240

Query: 242 LAVFTELRIRKNQS 255
              F  LR  K+  
Sbjct: 241 EDTFAVLRSWKDVF 254


>gi|118591320|ref|ZP_01548718.1| Beta-lactamase-like protein [Stappia aggregata IAM 12614]
 gi|118435992|gb|EAV42635.1| Beta-lactamase-like protein [Stappia aggregata IAM 12614]
          Length = 260

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 104/246 (42%), Positives = 136/246 (55%), Gaps = 1/246 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     T A+D PD     K L + GW LTHI  THHH DH +    LK
Sbjct: 14  CLDDNFGVLIHDTDSGTTIAVDVPDAAAYEKALEQTGWSLTHILITHHHWDHVQGLGTLK 73

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +    T+ GP     KI   D  + DGD    G + IK I+TPGHT+  I ++       
Sbjct: 74  QKTGATVIGPERSRLKIAEFDRTVEDGDEVRCGPYAIKAISTPGHTLDQISWYIPAIKVA 133

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSF-SDKTHIYFGHEYTENNAYFALSCDPHN 188
             GDTLF+LGCGR+FE     M+ SL K+     D T IY GHEYT  NA FAL+ DP N
Sbjct: 134 HTGDTLFALGCGRVFEGDKEMMWSSLAKLMRQLPDDTTIYCGHEYTLANARFALTIDPDN 193

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
            +L+    +V+++R +   T P+T++ EK  NPFLR    S+ + L ME  S   VFTE+
Sbjct: 194 ADLKARAEEVETLRQEGAPTLPTTMAKEKATNPFLRAGEASVARALGMEGKSAAEVFTEI 253

Query: 249 RIRKNQ 254
           R RK+ 
Sbjct: 254 RTRKDN 259


>gi|254491233|ref|ZP_05104414.1| metallo-beta-lactamase superfamily protein [Methylophaga
           thiooxidans DMS010]
 gi|224463746|gb|EEF80014.1| metallo-beta-lactamase superfamily protein [Methylophaga
           thiooxydans DMS010]
          Length = 256

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 77/253 (30%), Positives = 118/253 (46%), Gaps = 6/253 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+  LI     +    +D  D   + + + +       I  THHH DH     
Sbjct: 6   PVPAFQDNYIWLIQAKNSQKILIVDPGDAIPVIEAINQHNLQPVAILITHHHADHIGGIP 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + FN  ++GP  E+  +        D    D      +++ TPGHT GHICY     
Sbjct: 66  ALLEQFNVPVYGPAAENIPMISHPLNALDELHIDPDFPCFQVLDTPGHTAGHICYL--AA 123

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
           + L  GDTLF+ GCGR+   +  ++F+SL+++ +    T IY  HEYTE N  FA + + 
Sbjct: 124 NKLFCGDTLFAGGCGRLLGGTATDLFDSLQRLSNLPADTEIYCAHEYTEANLRFAKAVEK 183

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA--- 243
           +N +L     + +  R  N  T PS ++ E   NPFLR  N ++++         L    
Sbjct: 184 NNRDLDSRIKQTRQQREDNQATVPSLLAEELATNPFLRSHNPNVKRAAEHYAGHPLDNAE 243

Query: 244 -VFTELRIRKNQS 255
            VFT LR  K+Q 
Sbjct: 244 AVFTTLRQWKDQF 256


>gi|330963308|gb|EGH63568.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 259

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 137/260 (52%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
               + LK+     + GP     +IP  D  L+D D          + A PGHT+GHI +
Sbjct: 62  VGGVVELKQATRARVLGPAT--ERIPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  
Sbjct: 120 YHEDATAPLLFSGDTLFAAGCGRLFEGTPEQMHTSLERLAALPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V  +RS+N  + PS+++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAERLAQVTLLRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|255636437|gb|ACU18557.1| unknown [Glycine max]
          Length = 315

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 102/256 (39%), Positives = 148/256 (57%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    DN+  L+H+        +D  +   +   L  K   LT+I NTHHH D
Sbjct: 60  SSLQIELVPCLKDNYAYLLHDVDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTHHHHD 119

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N+ LK  +   + G   +  +IPGID  L+DGD + F  H +++  TPGHT  HI 
Sbjct: 120 HTGGNVELKARYGAKVIGSGTDKKRIPGIDIHLNDGDKWMFAGHEVRVKDTPGHTQSHIS 179

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GDTLFSL CG++FE +  +M  SL+KI S  D T+IY GHEYT NN  F
Sbjct: 180 FYFPGSGAIFTGDTLFSLSCGKLFEGTPQQMLSSLKKIMSLPDNTNIYCGHEYTLNNTKF 239

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENA 239
           ALS +P N ELQ Y ++V  +RS+ L T P+T+ +EK  NPFLR  + ++R++LN+   A
Sbjct: 240 ALSIEPENEELQSYAAQVAYLRSKGLPTIPTTLKMEKACNPFLRTSSAAIRQSLNIAATA 299

Query: 240 SNLAVFTELRIRKNQS 255
           ++      +R  K+  
Sbjct: 300 NDAEALGGIRQAKDNF 315


>gi|49474824|ref|YP_032866.1| hydroxyacylglutathione hydrolase [Bartonella quintana str.
           Toulouse]
 gi|81646713|sp|Q6FYC3|GLO2_BARQU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49240328|emb|CAF26810.1| Hydroxyacylglutathione hydrolase [Bartonella quintana str.
           Toulouse]
          Length = 253

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 152/246 (61%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+ +   TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK
Sbjct: 8   CREDNFGVLIHDERSGYTAAIDAPESKAICSALKRRNWTLQTIFVTHHHHDHIEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +   + GP  E  KI  +D  L   ++  FG+H +  ++TPGHT+G + Y+F  ++ L
Sbjct: 68  QIYKAVVIGPEAEKEKIGHLDQALQPDESLFFGTHTLLALSTPGHTLGSLSYYFPQENLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE + A+M  S +K++   D+T +Y GHEYT+ NA FAL+ D HN 
Sbjct: 128 FSGDTLFSLGCGRLFEGTPAQMLNSFKKLRQLPDETLLYCGHEYTKTNALFALTLDSHNQ 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +    V  +R++N  T P T+  EK  NPFLR ++ +LRKNL ME  ++  VF E+R
Sbjct: 188 KLHQRVEDVFLLRAKNAMTLPVTLGQEKATNPFLRWDDRTLRKNLAMEKETDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDNF 253


>gi|327280119|ref|XP_003224801.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           [Anolis carolinensis]
          Length = 307

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 120/255 (47%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +   +R+ G  LT +  THHH DH   N  
Sbjct: 53  LPALTDNYMYLLIDEETKEAAIVDPVQPQKVLDAVRKHGVKLTTVLTTHHHWDHAGGNEK 112

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K             S++  +   +S   +F  GS  +K +ATP HT GHICY     +
Sbjct: 113 LVKMEPGLRVY--GGDSRVGALTQKVSHLMSFQVGSLNVKCLATPCHTSGHICYFVTKPN 170

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+++ +E +     +T +Y GHEYT NN  FA
Sbjct: 171 SSDPPAVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGRLPPETKVYCGHEYTINNLKFA 230

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  +Q   S  K+       T PSTI  E   NPF+R+   S++++   + A  
Sbjct: 231 RHVEPNNSAIQHKLSWAKAKYDSGEPTIPSTIGEEFAYNPFMRVREASVQQHA--KEADP 288

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 289 VRTMGAIRREKDGFK 303


>gi|262198528|ref|YP_003269737.1| hydroxyacylglutathione hydrolase [Haliangium ochraceum DSM 14365]
 gi|262081875|gb|ACY17844.1| hydroxyacylglutathione hydrolase [Haliangium ochraceum DSM 14365]
          Length = 263

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 69/260 (26%), Positives = 114/260 (43%), Gaps = 10/260 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          +D  +   +   L  +G  L  I+NTHHH DH   N
Sbjct: 4   VPVPCLKDNYAYLVICEATNAATVVDPSEAAPVLAALEREGVALQAIWNTHHHWDHVGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDG--DTFDFGSHPIKIIATPGHTIGHICYHF 123
             L + F                  +   +   +         +I+  PGHT G I Y  
Sbjct: 64  KELLQRFQEIDVVGHASDKDRIPGQNRFVEDGEEVSLGEELRAQILFNPGHTRGAISYQL 123

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                +  GDTLF  GCGR+FE +  +M  SL ++ +    T ++ GHEYT  N  FA +
Sbjct: 124 AAHDAVFTGDTLFLAGCGRLFEGTAEQMHSSLSRLAALPPTTRVFCGHEYTVANLRFAAA 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--------N 235
            +P N  + +  ++V  +R     + P++I+LE+  NPFLR +   + +++         
Sbjct: 184 VEPDNQAVSERAAEVAKLREAGQPSVPASIALERVTNPFLRTDVAEVIESVRASEAAAQG 243

Query: 236 MENASNLAVFTELRIRKNQS 255
            E++S  A+F  LR  K+  
Sbjct: 244 EEDSSGAAIFAALRRWKDSF 263


>gi|306842915|ref|ZP_07475551.1| hydroxyacylglutathione hydrolase [Brucella sp. BO2]
 gi|306286938|gb|EFM58458.1| hydroxyacylglutathione hydrolase [Brucella sp. BO2]
          Length = 257

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 12  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 71

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             F  +I GP +E +KIPGID  +   D F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 72  AKFGVSIIGPEDEKAKIPGIDRTVKGDDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 131

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEY++NNA FAL+ DP N 
Sbjct: 132 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYSQNNARFALTIDPDNS 191

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 192 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 251

Query: 250 IRKNQS 255
            RK+  
Sbjct: 252 KRKDMF 257


>gi|294851178|ref|ZP_06791851.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
 gi|294819767|gb|EFG36766.1| hydroxyacylglutathione hydrolase [Brucella sp. NVSL 07-0026]
          Length = 260

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 114/246 (46%), Positives = 155/246 (63%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH++H   N  LK
Sbjct: 15  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLNHVEGNEPLK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 75  EKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEYT+NNA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYTQNNARFALTIDPDNS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI+LE   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 195 ALKERAKEIARLRAHERMTLPSTIALEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|269140169|ref|YP_003296870.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda EIB202]
 gi|267985830|gb|ACY85659.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda EIB202]
 gi|304560002|gb|ADM42666.1| Hydroxyacylglutathione hydrolase [Edwardsiella tarda FL6-60]
          Length = 251

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 125/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+ N +      +D      +   L E       I  THHH DH    
Sbjct: 4   IGLPALQDNYIWLLINPQ-HQCLIVDPGVAAPVLHYLTENRITPKAILLTHHHNDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + + +         E+ +  G    ++DGDTF      I ++A PGHT+GH+ Y+   
Sbjct: 63  AEIVQAYPELPVYGPAET-QGLGSTQIVADGDTFSLLGCQISVMALPGHTLGHVGYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE S  +MF+SL++I    D T +   HEYTE+N  FA    
Sbjct: 120 APYLFCGDTLFSAGCGRLFEGSAQQMFDSLQRIMQLPDNTLVCCAHEYTESNLRFARHVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P N  ++ Y   V ++R++   T PST+ +E+++NPFLR  +  L++N+      N    
Sbjct: 180 PQNRAIETYQQHVATLRAKQQPTVPSTLRIEREINPFLRCYDDDLQRNVGFPTQPNEIWR 239

Query: 244 VFTELRIRKNQS 255
           VF  LR  K+  
Sbjct: 240 VFACLRDMKDSF 251


>gi|163759934|ref|ZP_02167018.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Hoeflea phototrophica DFL-43]
 gi|162282892|gb|EDQ33179.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Hoeflea phototrophica DFL-43]
          Length = 247

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 160/246 (65%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +++H+     TA IDAPD  +I+  LR   W LTH+  THHH DH      L 
Sbjct: 2   CRQDNFGVILHDSLTGETATIDAPDGSVIASHLRPGSWKLTHLLITHHHPDHVEGIPALS 61

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + ++  + GP  E++KI G+   L DGDTF+F    +++I+TPGHT GHIC+H  ++  L
Sbjct: 62  ETYSPRVIGPAAEAAKIRGLTDTLRDGDTFEFAGRKVEVISTPGHTAGHICFHIPDEQLL 121

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE S  +MF SL ++ +  D+T +Y GHEYT +NA FA++ DP N 
Sbjct: 122 FAGDTLFALGCGRLFEGSPGDMFASLTRLAALPDETRVYCGHEYTRSNAAFAVTVDPDNS 181

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           EL K  ++++ +  + L T P+TI  EK+ NPF+R  + ++R+ L MENAS L VFTELR
Sbjct: 182 ELAKRRAEIEGLVEKGLATLPTTIGFEKRTNPFMRAGDPAIRRTLGMENASELEVFTELR 241

Query: 250 IRKNQS 255
            RK++ 
Sbjct: 242 ARKDRF 247


>gi|93006258|ref|YP_580695.1| hydroxyacylglutathione hydrolase [Psychrobacter cryohalolentis K5]
 gi|92393936|gb|ABE75211.1| Hydroxyacylglutathione hydrolase [Psychrobacter cryohalolentis K5]
          Length = 259

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 74/261 (28%), Positives = 119/261 (45%), Gaps = 8/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+     I  ++DN+   + N   +    ID      +   L E G  LT I+ THHH D
Sbjct: 1   MSIRIHPIKAFNDNYIWTLINESNKQAIVIDPGQAAPVVAYLEENGLELTSIWTTHHHHD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +  T       +      D  + DG T        ++    GHT  H+ 
Sbjct: 61  HIGGVAELQESYPMTHLV--AHTEHNVDEDQTIKDGSTVSAWGCSAQVWDVSGHTASHMA 118

Query: 121 YHFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           Y    D       GDTLFS GCGR+F  +  ++ +S +++     +T +Y  HEYT +N 
Sbjct: 119 YILDIDGLKHCFCGDTLFSAGCGRVFTGTIEQLHDSFKRLNGLPAETLLYPAHEYTASNL 178

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS----LRKNL 234
            F LS +P N  +Q+  ++ +   +Q + T P T+  E+ +N FLR +  S    ++   
Sbjct: 179 RFGLSIEPDNEAMQQALAQAEDKTAQGIPTLPVTLGHERAINVFLRTQEPSVIAGVKAQF 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
           N+++  +L VF  LR  KN  
Sbjct: 239 NIDDDKSLTVFAALRELKNNF 259


>gi|301769695|ref|XP_002920271.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 318

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI + + +  A +D      + + ++++G  LT +  THHH DH   N  
Sbjct: 64  LPALTDNYMYLIIDDETKEAAIVDPVQPQKVVETVKKRGVKLTTVLTTHHHWDHAGGNEK 123

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 124 LVKLEPGLKVC--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVTKPG 181

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +  EM+ + +E +      T +Y GHEYT NN  FA
Sbjct: 182 SSEPPAVFTGDTLFVAGCGKFYEGTADEMYRALIEILGRLPPDTRVYCGHEYTINNLKFA 241

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PSTI+ E   NPF+R+   +++++        
Sbjct: 242 RHVEPSNAAVQEKLAWAKEKYSIGEPTVPSTIAEELTYNPFMRVREKTVQQHAG--ETDP 299

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 300 VTTMRAIRKEKDHFK 314


>gi|281341589|gb|EFB17173.1| hypothetical protein PANDA_008978 [Ailuropoda melanoleuca]
          Length = 284

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI + + +  A +D      + + ++++G  LT +  THHH DH   N  
Sbjct: 30  LPALTDNYMYLIIDDETKEAAIVDPVQPQKVVETVKKRGVKLTTVLTTHHHWDHAGGNEK 89

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 90  LVKLEPGLKVC--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVTKPG 147

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +  EM+ + +E +      T +Y GHEYT NN  FA
Sbjct: 148 SSEPPAVFTGDTLFVAGCGKFYEGTADEMYRALIEILGRLPPDTRVYCGHEYTINNLKFA 207

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PSTI+ E   NPF+R+   +++++        
Sbjct: 208 RHVEPSNAAVQEKLAWAKEKYSIGEPTVPSTIAEELTYNPFMRVREKTVQQHAG--ETDP 265

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 266 VTTMRAIRKEKDHFK 280


>gi|183601081|ref|ZP_02962574.1| hypothetical protein PROSTU_04706 [Providencia stuartii ATCC 25827]
 gi|188019422|gb|EDU57462.1| hypothetical protein PROSTU_04706 [Providencia stuartii ATCC 25827]
          Length = 251

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 84/252 (33%), Positives = 138/252 (54%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +   +DN+  ++ ++  +    +D  ++  + ++L +K    T I  THHH DHT   
Sbjct: 4   IRVPALNDNYIWILSDN-NQQCIIVDPAESEPVLEILTQKKLTPTAILLTHHHNDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + K F+       +E+ ++ G    +  GD+         +I  PGHT+GHI ++   
Sbjct: 63  KGILKNFSNLPVFGPQET-QVKGATQIVEQGDSVKINDFNFDVIGLPGHTLGHIAFYQ-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +M++S++KI +  D T I   HEYT++N  FA    
Sbjct: 120 APYLFCGDTLFSAGCGRIFEGTPEQMYQSIQKIAALPDDTLICCAHEYTQSNLKFAHHIW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL--A 243
           P N ++ +Y  +V + R++N  T P+T+  E+KVN FL+ +N  L++ LN+  A+    A
Sbjct: 180 PENTQISQYQEEVAAKRNKNQPTVPTTLKTERKVNIFLQCDNAQLQRKLNINQANPPLRA 239

Query: 244 VFTELRIRKNQS 255
           VFT LR  K+  
Sbjct: 240 VFTVLRQLKDHY 251


>gi|115522194|ref|YP_779105.1| hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisA53]
 gi|122298092|sp|Q07VA9|GLO2_RHOP5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|115516141|gb|ABJ04125.1| Hydroxyacylglutathione hydrolase [Rhodopseudomonas palustris
           BisA53]
          Length = 255

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 143/245 (58%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
             +DNF  LIH+     TA++DAP+   I   L  +GW LT I  THHH DH      LK
Sbjct: 10  CLNDNFGYLIHDPATGATASVDAPEAAPIIAALAREGWTLTDILVTHHHGDHVGGVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + + C +  P + + +IP +D  ++ GD    G    +++ TPGHT+ H+ Y F +D  +
Sbjct: 70  QKYRCRVVAPHDRNGRIPEVDLRVAQGDVVKVGGLLARVLETPGHTLDHLAYVFDDDKAV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFS+GCGR+FE +Y  M++SL K++   D   +Y GHEYT  N  FAL  +P N 
Sbjct: 130 FAGDTLFSIGCGRVFEGTYPMMWDSLLKLRVLPDDMRLYCGHEYTAANVKFALGVEPDNP 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            LQ   ++V ++R+    T P+ +  EK  N FLR +  S+  ++ ++ A  +AVFTELR
Sbjct: 190 ALQARAAQVTALRAAGQPTIPTLLGEEKAANVFLRADEPSVAASVRLKGADPVAVFTELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|117924955|ref|YP_865572.1| hydroxyacylglutathione hydrolase [Magnetococcus sp. MC-1]
 gi|117608711|gb|ABK44166.1| Hydroxyacylglutathione hydrolase [Magnetococcus sp. MC-1]
          Length = 254

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 119/249 (47%), Gaps = 3/249 (1%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+            A +D      ++  L++ G  L+HI  THHH DH     
Sbjct: 9   PLPAWEDNYIWCFPTEP-GAVAVVDPGQAEPVTDYLQQHGLRLSHILLTHHHGDHIDGVA 67

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++  +  + G   ++ ++P +D  L  G TF  G H +    TPGHT GH+   +   
Sbjct: 68  PLQRKHHARVLGSALDAHRLPPLDEALRGGQTFCLGPHQVDTYHTPGHTSGHL--CYHIA 125

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFS GCGR+FE +  +M++SL  +++  + T +   HEYT  N  FA S   
Sbjct: 126 DCLFAGDTLFSYGCGRLFEGTPQQMWQSLLILRALPETTRLCCAHEYTLTNLRFARSLPG 185

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
               L     + +  R     T PS ++ EK+ NPFLR ++T  R  +  + AS  A F 
Sbjct: 186 QQEPLAAPWQRAQQTRQLGKPTLPSRLAEEKQYNPFLRCDDTQFRTAVGQQAASAEACFA 245

Query: 247 ELRIRKNQS 255
            +R  +N  
Sbjct: 246 YIRQLRNHF 254


>gi|221067920|ref|ZP_03544025.1| hydroxyacylglutathione hydrolase [Comamonas testosteroni KF-1]
 gi|220712943|gb|EED68311.1| hydroxyacylglutathione hydrolase [Comamonas testosteroni KF-1]
          Length = 257

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 118/258 (45%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  ++H+ +      +D      +   L ++G  L  I  THHH DH    
Sbjct: 4   LPIPAFSDNYIWMLHDAE--HAVVVDPGQAEPVLSTLAQRGLKLQGILVTHHHADHVGGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             ++      ++GP      +P     +  GD+ +    P ++I  PGHT GHI +    
Sbjct: 62  DAIRAATGAPVWGPAY--ESLPEPVTRVQGGDSIELLGGPWQVIDVPGHTSGHIAFFSTR 119

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             ++  L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 120 AQSEPLLFCGDTLFSGGCGRLFEGTAAQMQASLDALAALPGSTLVCCAHEYTISNLRFAQ 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P+N EL +Y    + +R     T PST+  E  +NPF+R     +       +    
Sbjct: 180 AVEPNNPELAQYLEHCQQLRKSGQPTLPSTLQTELAINPFMRSRAADVIAAAVHHDPQTR 239

Query: 240 --SNLAVFTELRIRKNQS 255
                +V   LR  KN  
Sbjct: 240 PEDPASVLATLRQWKNVF 257


>gi|225448353|ref|XP_002267471.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297736644|emb|CBI25515.3| unnamed protein product [Vitis vinifera]
          Length = 258

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 113/256 (44%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  LI +   +  A +D  +   + +   E G  L  +  THHH DH   N
Sbjct: 4   VPVPCLEDNYSYLIIDESSKEAAVVDPVEPQKVLQAAYEYGVHLKLVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K+             +         +           +  + TP HT GHI Y+   
Sbjct: 64  EKIKQLVPGIEVYGGSVDNVKGCTHPLQNGDKLSLGSDLAVLALHTPCHTRGHISYYVTG 123

Query: 126 DHFL----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
                     GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT  N  F
Sbjct: 124 KEEDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLASLPKPTRVYCGHEYTVKNLQF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N+ + +  S  +  R   L T PSTI  E + NPF+R++   L++ +  ++A 
Sbjct: 184 ALTVEPDNVRVGQKLSWAQHQRQAGLPTIPSTIDEEMETNPFMRVDLPELQERVGCQSA- 242

Query: 241 NLAVFTELRIRKNQSK 256
            +    E+R +K+  +
Sbjct: 243 -IDALQEIRRQKDNWR 257


>gi|22126973|ref|NP_670396.1| hydroxyacylglutathione hydrolase [Yersinia pestis KIM 10]
 gi|45442538|ref|NP_994077.1| hydroxyacylglutathione hydrolase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|162420794|ref|YP_001607086.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|167424058|ref|ZP_02315811.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|21960016|gb|AAM86647.1|AE013910_9 probable hydroxyacylglutathione hydrolase [Yersinia pestis KIM 10]
 gi|45437403|gb|AAS62954.1| probable hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162353609|gb|ABX87557.1| metallo-beta-lactamase family protein [Yersinia pestis Angola]
 gi|167056907|gb|EDR66670.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|262361132|gb|ACY57853.1| hydroxyacylglutathione hydrolase [Yersinia pestis D106004]
          Length = 280

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 133/252 (52%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 33  ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 91

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  F        +E++K       ++DGD+         IIA PGHT+GHI Y+   
Sbjct: 92  ADLRHHFPDIPVYGPQETAKKGATVI-VNDGDSLTIAGQNYTIIAVPGHTLGHIAYYS-- 148

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA +  
Sbjct: 149 SPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAIL 208

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  ++
Sbjct: 209 PADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTSPPDSLVS 268

Query: 244 VFTELRIRKNQS 255
           VF ELR RK+  
Sbjct: 269 VFCELRSRKDSF 280


>gi|217978058|ref|YP_002362205.1| hydroxyacylglutathione hydrolase [Methylocella silvestris BL2]
 gi|217503434|gb|ACK50843.1| hydroxyacylglutathione hydrolase [Methylocella silvestris BL2]
          Length = 256

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 105/246 (42%), Positives = 141/246 (57%), Gaps = 1/246 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT-RANLNL 68
              DNF +L+H+ + R T A+DAPD   I   L  + W LT I  THHH DH        
Sbjct: 10  CLSDNFGVLVHDPETRATCAVDAPDGAPILAALAAREWELTDILLTHHHADHVQGVGALK 69

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
             F    + GPL+E+ KI G+D  + +GD    GS   ++IA PGHT GH+ Y F  +  
Sbjct: 70  AAFPKARVVGPLKEAEKIGGLDLKVGEGDLVMVGSLAARVIAVPGHTSGHVAYWFEEEDL 129

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGDTLF++GCGR FE+    +F SL K+ +  D+T +Y GHEYT  NA FALS +P N
Sbjct: 130 AFVGDTLFAMGCGRAFEEPPDVLFHSLSKLAALPDETQVYCGHEYTLANAKFALSVEPGN 189

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L++   +V ++R+   +T P+TIS+E   NPFLR E   L+  + M  A   AVF  L
Sbjct: 190 TLLKERAGEVAALRAAGKFTLPTTISIELATNPFLRAEEPELQAAVGMPGADPAAVFAVL 249

Query: 249 RIRKNQ 254
           R RKN 
Sbjct: 250 RERKNH 255


>gi|224824459|ref|ZP_03697566.1| hydroxyacylglutathione hydrolase [Lutiella nitroferrum 2002]
 gi|224602952|gb|EEG09128.1| hydroxyacylglutathione hydrolase [Lutiella nitroferrum 2002]
          Length = 252

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 73/254 (28%), Positives = 115/254 (45%), Gaps = 11/254 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+  L+   +     A+D  D   +   L   G  L  +  THHH DH     
Sbjct: 6   PVPAFSDNYIWLL--QQAGRAVAVDPGDAAPVLAYLAAHGLALEAVLVTHHHADHVGGLA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + +           +++      + DG  F+  S    ++  PGHT+ H+ Y    D
Sbjct: 64  ELTRHYLHLRIIGPASIAQVNEA---VMDGSRFELLSAQFDVLEVPGHTLDHLAYLT--D 118

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLF  GCGR+FE S  +M  SL +I +  D T +Y  HEYT +N  FA + +P
Sbjct: 119 GRLFCGDTLFGAGCGRLFEGSPEQMHASLGRIAALPDSTRLYPAHEYTLSNLRFAAAVEP 178

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----RKNLNMENASNL 242
            N  +++  ++ ++  +    T PST+  E+  NPFLR    ++     +       +  
Sbjct: 179 DNDAIRQRLAEDQATLAAGEPTLPSTLDKERATNPFLRTAVDAVTRRAAQQAGAPLTTPA 238

Query: 243 AVFTELRIRKNQSK 256
           AVF  LR  KN  +
Sbjct: 239 AVFAVLREWKNSFR 252


>gi|120611319|ref|YP_970997.1| hydroxyacylglutathione hydrolase [Acidovorax citrulli AAC00-1]
 gi|120589783|gb|ABM33223.1| Hydroxyacylglutathione hydrolase [Acidovorax citrulli AAC00-1]
          Length = 258

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 81/259 (31%), Positives = 126/259 (48%), Gaps = 12/259 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+      A +D  +   + + L+  G  L  I  THHH DH    
Sbjct: 2   LPLPAFADNYIWMLHDGHS--AAVVDPGEAGPVLQALQHHGLALQAILVTHHHGDHVGGV 59

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     ++GP      IP     L+DGDT       + +I  PGHT GHI YH  +
Sbjct: 60  AALREATGAPVYGPAR--ESIPQPAQPLADGDTLQVLGLRLSVIDVPGHTAGHIAYHAAD 117

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+++ +   +T +   HEYT +N  FA 
Sbjct: 118 AAGGPLLFCGDTLFSGGCGRLFEGTPAQMQHSLDRLGALPPETRVCCAHEYTLSNLAFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN-----ME 237
           + +P N  L +Y    +++R+    T PS +  E  VNPFLR    ++ +         +
Sbjct: 178 AVEPGNAALLQYSHDCEALRAAGQPTLPSRLGTEHAVNPFLRAREPAVARAAQGFDPRTD 237

Query: 238 NASNLAVFTELRIRKNQSK 256
            A   +V   LR  KN+ +
Sbjct: 238 AADPASVLAALRQWKNEFR 256


>gi|87199342|ref|YP_496599.1| hydroxyacylglutathione hydrolase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135023|gb|ABD25765.1| Hydroxyacylglutathione hydrolase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 254

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 90/248 (36%), Positives = 132/248 (53%), Gaps = 2/248 (0%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+     TA ID PD     +    +GW +T I+NTH H DH   N  +
Sbjct: 9   PCLSDNYGFLVHDSDSGETACIDTPDAEAYLREANARGWRITQIWNTHWHPDHAGGNEAI 68

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K    CT+  P +++ KI G+D  ++ GDT   GS   ++I   GHT+GH  YH      
Sbjct: 69  KAATGCTVVAPEDDAGKIAGVDRAVAHGDTVQLGSFTAEVIDVGGHTMGHCAYHLPEASV 128

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD LF LGCGR+FE +  + + SL +IK+    T +Y  HEYT++NA FAL  DP N
Sbjct: 129 AFVGDALFPLGCGRMFEGTPPQFWASLSRIKALPPGTTLYSAHEYTQSNARFALHADPDN 188

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L+ Y   V++ R++  +T P+T++ E   NPFLR +   +        +S +  F  L
Sbjct: 189 AALRAYADGVEARRARGEWTVPTTLAAELAANPFLRADTPGMAARWG--GSSPVDTFAAL 246

Query: 249 RIRKNQSK 256
           R  K+  +
Sbjct: 247 RAAKDTFR 254


>gi|328868145|gb|EGG16525.1| hydroxyacylglutathione hydrolase [Dictyostelium fasciculatum]
          Length = 258

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 76/259 (29%), Positives = 132/259 (50%), Gaps = 5/259 (1%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + I    DN+  L+ +      AAID  +   + +  ++    +T I +THHH D
Sbjct: 1   MKVIVVPI--LSDNYSYLLVDETTNKAAAIDCAEPNKVVEAAKQHNVEITSILSTHHHWD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K+  N      +    +I  I   +++ +T   G+  +K+ ++P HT GH+ 
Sbjct: 59  HAGGNKQMKELLNNHSLPVIGGDDRIESITQKVNNNETIKVGALNVKVFSSPAHTTGHVL 118

Query: 121 YH--FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIK-SFSDKTHIYFGHEYTENN 177
           Y+     +  L  GDTLF  GCGR+FE    +M+++L ++     + T ++ GHEYT NN
Sbjct: 119 YYVEDEKERNLFTGDTLFIGGCGRLFEGDPTQMYDALYRVIGQLPEDTKLWVGHEYTVNN 178

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA S +P N ++ +     K  R+ NL T PSTI+ E+  NPF+R+    +   ++  
Sbjct: 179 LLFAKSLEPDNQDINQMLEWSKQQRTNNLPTIPSTIAKERTFNPFMRVHLNGIFNGIDYS 238

Query: 238 NASNLAVFTELRIRKNQSK 256
           ++S   +  ++R  K+  K
Sbjct: 239 SSSPQQILGQIRKLKDNFK 257


>gi|289627516|ref|ZP_06460470.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649933|ref|ZP_06481276.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868362|gb|EGH03071.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 259

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATQARVLGPAA--ETIPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|107022362|ref|YP_620689.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia AU 1054]
 gi|116689309|ref|YP_834932.1| hydroxyacylglutathione hydrolase [Burkholderia cenocepacia HI2424]
 gi|105892551|gb|ABF75716.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia AU 1054]
 gi|116647398|gb|ABK08039.1| Hydroxyacylglutathione hydrolase [Burkholderia cenocepacia HI2424]
          Length = 273

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 85/275 (30%), Positives = 135/275 (49%), Gaps = 21/275 (7%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCTI----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+      +    +GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVEALQHSQPADVPLTVYGPAAEAIGVVTRPLSGGDRVTLDAPAVAFDVLDVPGHT 118

Query: 116 IGHICYHFMND----------HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKT 165
            GHI Y                 +  GDTLFS GCGR+FE + A+M  SL+ + +    T
Sbjct: 119 RGHIAYFQAAGQGAAGQGNAVPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDT 178

Query: 166 HIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI 225
            ++  HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R 
Sbjct: 179 RVHCAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRA 238

Query: 226 ENTSLRKNLNME----NASNLAVFTELRIRKNQSK 256
           ++ ++   L  E        LA FT +R  KN+ +
Sbjct: 239 DSAAIHATLEAELHETVTDRLAAFTLMREWKNRFR 273


>gi|302784716|ref|XP_002974130.1| hypothetical protein SELMODRAFT_149526 [Selaginella moellendorffii]
 gi|300158462|gb|EFJ25085.1| hypothetical protein SELMODRAFT_149526 [Selaginella moellendorffii]
          Length = 257

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 116/255 (45%), Gaps = 6/255 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LI +   +  AA+D      +    ++ G  +T +  TH H DH   N
Sbjct: 4   IPVPCLDDNYAYLIIDGASKQAAAVDPVKPESVLSAAKKHGAQVTMVLTTHKHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +KK           + +     D      +        IK + TP HT GHI Y   +
Sbjct: 64  NEIKKLVPGIKVFGGAKDNVEGCTDPLEHGAELELSKDVKIKALHTPCHTKGHISYFVTH 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSF-SDKTHIYFGHEYTENNAYFA 181
              D  +  GDTLF  GCG+ FE    +M+ SL ++ +     T ++ GHEYT  N  FA
Sbjct: 124 KSGDPAVFTGDTLFVAGCGKFFEGKAQDMYHSLSEVLAELPPATRVFCGHEYTAKNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           +S DPHN  L++  +  +  R  +  T PSTI  E + NPF+R+     +  ++M  +  
Sbjct: 184 MSVDPHNDALKQKVAWTEEQRRNDKPTVPSTIREELQTNPFMRVNVKEFQ--VHMGESDP 241

Query: 242 LAVFTELRIRKNQSK 256
           + +   LR  K+Q K
Sbjct: 242 VELLASLRAAKDQFK 256


>gi|121604583|ref|YP_981912.1| hydroxyacylglutathione hydrolase [Polaromonas naphthalenivorans
           CJ2]
 gi|120593552|gb|ABM36991.1| Hydroxyacylglutathione hydrolase [Polaromonas naphthalenivorans
           CJ2]
          Length = 256

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 88/256 (34%), Positives = 127/256 (49%), Gaps = 10/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            IS + DN+  L+H+   +    +D  D   + + L +    L  I  THHH DHT    
Sbjct: 5   PISAFADNYLWLLHD--GKRALVVDPGDAEPVLRALEQSALQLESILVTHHHADHTGGVD 62

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+K     ++GP     +IP     L +GD+        +++  PGHT GHI ++  + 
Sbjct: 63  ALRKATGAKVYGPAN--ERIPAPFEPLHEGDSVHTLGLDFQVLDVPGHTAGHIAFYTPDM 120

Query: 127 HFL---CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                   GDTLFS GCGR+FE + A+M  SL+K+ + S  T +   HEYT +N  FAL+
Sbjct: 121 DGRPLLFCGDTLFSGGCGRLFEGTPAQMLASLDKLAALSGATRVCCAHEYTLDNLRFALA 180

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA---S 240
            +P N +L  Y      +R+Q   T PS+I  E  +NPFLR    SL       +A    
Sbjct: 181 VEPDNTDLAAYQQHCLRLRAQGQPTLPSSIQQEILINPFLRTRRASLVSAARHFDASVHD 240

Query: 241 NLAVFTELRIRKNQSK 256
           + +VF  LR  KNQ K
Sbjct: 241 DTSVFAALRQWKNQFK 256


>gi|261340922|ref|ZP_05968780.1| hydroxyacylglutathione hydrolase [Enterobacter cancerogenus ATCC
           35316]
 gi|288316779|gb|EFC55717.1| hydroxyacylglutathione hydrolase [Enterobacter cancerogenus ATCC
           35316]
          Length = 252

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 83/253 (32%), Positives = 126/253 (49%), Gaps = 6/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  +I +   R    +D  +   I + + +  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVIVDDA-RRCIIVDPGEAAPILQAINDNNWQPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   F         E+ +  G+   + +G+          + ATPGHT GHIC++   
Sbjct: 63  PALLAQFPDLAVYGPAET-RDKGVTQVVDEGEKVIILGLAFSVFATPGHTSGHICFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M++SL+KI +  D T I   HEYT  N  FA S  
Sbjct: 120 APYLFCGDTLFSGGCGRLFEGTPAQMYQSLQKINALPDDTVICCAHEYTLGNMKFAASIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P++  +Q Y  KVK +R++N  T P  +  E+++N FLR  +  L   ++ E       A
Sbjct: 180 PYDRAIQDYYQKVKELRAKNQKTLPVILKKEREINLFLRTNDVDLINEISQETNLQHPEA 239

Query: 244 VFTELRIRKNQSK 256
            F  LR +K+  +
Sbjct: 240 RFAWLRSKKDNFR 252


>gi|159026149|emb|CAO88800.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 257

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/254 (34%), Positives = 138/254 (54%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           ++   DN+  L+++   ++ A +D  +   + + L      L  IFNTHHH DH  AN  
Sbjct: 6   LNALSDNYIFLLYDRAQKIAAVVDPAEPEPVFRRLEALQVDLVAIFNTHHHGDHVGANQA 65

Query: 68  LKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L   +    ++G  E+  +IPG    L +GD  +F     ++   PGHT  HI Y+F   
Sbjct: 66  LINRYPHLCVYGGKEDRGRIPGQQLFLEEGDWVEFAGRRAEVFFVPGHTRAHIAYYFPPV 125

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +         GDTLFS GCGR+FE +  +M  SL K++S  D T ++  HEYT NN  FA
Sbjct: 126 NPGDYGELFCGDTLFSGGCGRLFEGTPGQMVASLTKLRSLPDWTRVWCAHEYTLNNLKFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP+N  LQ+   +V+  R++++ T P+ +  EK  NPFLR ++ +L   + M+++  
Sbjct: 186 LTVDPNNAALQQRYREVEKNRAEDIPTIPAILGTEKLTNPFLRWDSPAL--AMTMDSSEP 243

Query: 242 LAVFTELRIRKNQS 255
           + VF  LR +K+  
Sbjct: 244 VQVFARLRGKKDNF 257


>gi|88813346|ref|ZP_01128584.1| Metallo-beta-lactamase superfamily protein [Nitrococcus mobilis
           Nb-231]
 gi|88789404|gb|EAR20533.1| Metallo-beta-lactamase superfamily protein [Nitrococcus mobilis
           Nb-231]
          Length = 257

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 131/259 (50%), Gaps = 6/259 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M      +  + DN+   +H+ + R    +D  D   + + L+++   LT I  THHH D
Sbjct: 1   MIDPAFPLRAFRDNYIWALHDAQKRRVCVVDPGDPDPVLRFLKQEKLELTGILATHHHAD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L K     ++GP +E         G  D    +     ++++  PGHT GHI 
Sbjct: 61  HVGGIARLVKEHPVPVYGPAKEQIPELTHPLGEGDKVRLEAQDLELEVLEVPGHTAGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y       L  GDTLF+ GCGRIFE +  +M+ SL K+    + T +Y  HEYT+NN  F
Sbjct: 121 YVGH--QMLFCGDTLFAGGCGRIFEGTAEQMYASLCKLAELDNPTRVYCAHEYTQNNLRF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           A++ +P N  + +  + +++MR+ +  T PSTI +E + NPFLR +  +++++       
Sbjct: 179 AITVEPDNTAVWERYTHIRTMRANDEITLPSTIGIELETNPFLRPDIATVKRSAEQHSGR 238

Query: 237 ENASNLAVFTELRIRKNQS 255
           +  S++ VF  +R  K+  
Sbjct: 239 KLTSDVEVFAAVRAWKDDF 257


>gi|51597282|ref|YP_071473.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis IP
           32953]
 gi|153947476|ref|YP_001400033.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|170023352|ref|YP_001719857.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           YPIII]
 gi|186896387|ref|YP_001873499.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           PB1/+]
 gi|81638785|sp|Q667M5|GLO2_YERPS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166990463|sp|A7FFK5|GLO2_YERP3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724039|sp|B2KAD1|GLO2_YERPB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724040|sp|B1JR44|GLO2_YERPY RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|51590564|emb|CAH22205.1| putative hydroxyacylglutathione hydrolase [Yersinia
           pseudotuberculosis IP 32953]
 gi|152958971|gb|ABS46432.1| metallo-beta-lactamase family protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|169749886|gb|ACA67404.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           YPIII]
 gi|186699413|gb|ACC90042.1| hydroxyacylglutathione hydrolase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 251

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 134/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  F        +E++K       ++DGD+         IIA PGHT+GHI Y+   
Sbjct: 63  ADLRHHFPDIPVYGPQETAKKGATVI-VNDGDSLTIAGQNYTIIAVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA +  
Sbjct: 120 SPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ + + +  +  ++
Sbjct: 180 PADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGITSPPDSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF ELR RK+  
Sbjct: 240 VFCELRSRKDSF 251


>gi|255019827|ref|ZP_05291903.1| Hydroxyacylglutathione hydrolase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970756|gb|EET28242.1| Hydroxyacylglutathione hydrolase [Acidithiobacillus caldus ATCC
           51756]
          Length = 254

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/253 (29%), Positives = 115/253 (45%), Gaps = 9/253 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+   +      +D      +S  L  +G   + I  THHH DH      
Sbjct: 6   IPAFRDNYIYLLTLPQESAVWIVDPGAAAPVSAELSRRGLRPSAILCTHHHADHIGGVAE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L   + C ++GP   +              T       I+++  PGHT+ H+ +++  + 
Sbjct: 66  LATAYGCPVYGPGNSTIPARTNPLR---EGTAHVDGREIRVLEVPGHTLDHLAFYW--ED 120

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF+ GCGRIFE   A +F SL+K+    D T +   HEYT  N  FA   +P 
Sbjct: 121 LLFCGDTLFAGGCGRIFEGDAAMLFASLQKLARLPDSTRVCCAHEYTLANLRFAAVVEPD 180

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENASNLA 243
           N  L +   +V+  R     + PST+  E++ NPFLR    S++  +        A  +A
Sbjct: 181 NRILGERLERVRRQREAGQPSLPSTLGEERQSNPFLRCHLPSVQHAVRAVYPETAAEPVA 240

Query: 244 VFTELRIRKNQSK 256
           +F  LR  K+  +
Sbjct: 241 IFAALRRWKDGFR 253


>gi|226945030|ref|YP_002800103.1| hydroxyacylglutathione hydrolase [Azotobacter vinelandii DJ]
 gi|226719957|gb|ACO79128.1| hydroxyacylglutathione hydrolase [Azotobacter vinelandii DJ]
          Length = 258

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 85/261 (32%), Positives = 133/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   +   L    GW L  I  THHH 
Sbjct: 1   MVRID-ALPAFQDNYIWLLQDPTTRRIAVVDPGDATPVLAWLEANPGWQLADILITHHHA 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP +   +IP  D  L DG++ +   +  +I+  PGHT  HI
Sbjct: 60  DHIGGAEILKRTTGARVLGPDD--ERIPARDLTLHDGESVEVLGYAFRILEVPGHTRSHI 117

Query: 120 -CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             +H     +L  GDTLF+ GCGR+FE +  +M  SLE++    + T +Y  HEYT +N 
Sbjct: 118 AYFHAAAQPWLFCGDTLFAAGCGRLFEGTPGQMRRSLERLAGLPEATLVYCSHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FA + +P N  + +  ++V + R+    + PS ++LE++ NPFLR   TS+++ +    
Sbjct: 178 RFAQAVEPDNPAIARRLAEVTAWRNAGSGSLPSELALERETNPFLRTGETSVKERVARRC 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
                    VFTELR  K+  
Sbjct: 238 GQPMLDPDQVFTELRAWKDNF 258


>gi|70730663|ref|YP_260404.1| hydroxyacylglutathione hydrolase [Pseudomonas fluorescens Pf-5]
 gi|123655233|sp|Q4KBH9|GLO2_PSEF5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|68344962|gb|AAY92568.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas fluorescens
           Pf-5]
          Length = 255

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 96/258 (37%), Positives = 136/258 (52%), Gaps = 10/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ +H+ +  A +D  D   +   L +  GW L+ I  THHH DH
Sbjct: 2   IQISALPAFTDNYIWLLQDHRSQRCAVVDPGDAAPVLAWLEQHPGWVLSDILITHHHHDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+    T+ GP     KIP  D GL D           ++ A PGHT+GHI Y
Sbjct: 62  VGGVERLKQHSAATVHGPAR--EKIPARDIGLEDNQRVSILGWEFEVFAVPGHTLGHIAY 119

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +      L  GDTLF+ GCGR+FE +  +M  SL ++ +  D T IY  HEYT +N  FA
Sbjct: 120 YHHG--LLFCGDTLFAAGCGRLFEGTPEQMHHSLGRLAALPDDTLIYCTHEYTLSNLRFA 177

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NME 237
            + +P N ++ +  +KV  MR Q   T PST++LEK  NPFLR   TS+++        +
Sbjct: 178 QAVEPANPDIAERLAKVTQMREQGRMTLPSTLALEKLTNPFLRTGETSVKQKADERNGQD 237

Query: 238 NASNLAVFTELRIRKNQS 255
           N S  AVF  LR  K++ 
Sbjct: 238 NQSQSAVFAALRAWKDKF 255


>gi|49476313|ref|YP_034354.1| hydroxyacylglutathione hydrolase [Bartonella henselae str.
           Houston-1]
 gi|81647469|sp|Q6G1L3|GLO2_BARHE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49239121|emb|CAF28425.1| Hydroxyacylglutathione hydrolase [Bartonella henselae str.
           Houston-1]
          Length = 253

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 156/246 (63%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK
Sbjct: 8   CREDNFGVLIHDETSGYTAAIDAPESNAIQNALKRRNWTLQTIFLTHHHHDHVEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +   + GP  E  KI  ID  L   ++F FG+H I  ++TPGHT+G + Y+F  ++ L
Sbjct: 68  QIYKAIVIGPEAEKEKISHIDQTLKPDESFLFGTHTILALSTPGHTLGALSYYFPQENLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE + A+M  SL+K++   D+T +Y GHEYT++NA FAL+ DP+N 
Sbjct: 128 FAGDTLFSLGCGRLFEGTPAQMLNSLKKLRQLPDETLLYCGHEYTKSNALFALTLDPYNQ 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +LQ+    V  +R++N  T P T+  EKK NPFLR +N +LRK L ME  ++  VF E+R
Sbjct: 188 KLQQRAEDVFLLRAKNAMTLPVTLGQEKKNNPFLRWDNRTLRKTLRMEKETDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDNF 253


>gi|213968846|ref|ZP_03396987.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           T1]
 gi|301384108|ref|ZP_07232526.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059182|ref|ZP_07250723.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           K40]
 gi|302135020|ref|ZP_07261010.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926449|gb|EEB60003.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           T1]
          Length = 259

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 136/260 (52%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKG-WFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +    +D  D   + + L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNQHYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
               + LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVVELKQATQARVLGPAA--ESIPARDVALIDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  
Sbjct: 120 YHEDATAPLLFSGDTLFAAGCGRLFEGTPGQMHASLERLAALPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V  MRS+N  + PS+++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAERLAQVTLMRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|298486275|ref|ZP_07004338.1| Hydroxyacylglutathione hydrolase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159282|gb|EFI00340.1| Hydroxyacylglutathione hydrolase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 259

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATRARVLGPAA--ETIPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|294637715|ref|ZP_06715992.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda ATCC 23685]
 gi|291089145|gb|EFE21706.1| hydroxyacylglutathione hydrolase [Edwardsiella tarda ATCC 23685]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 125/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  L+ N + R    +D      +   L E       I  THHH DH    
Sbjct: 4   IGLPVLQDNYIWLLINPQ-RHCLIVDPGVAAPVLHYLTENRITPKAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + + +         E+ +  G +  ++D D        + ++A PGHT+GH+ Y+   
Sbjct: 63  AEIVQAYPDLPVYGPAET-RAAGCNQVVADNDRLSLLGLEVTVLAVPGHTLGHVAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +MF+SL++I    D T +   HEYTE+N  FA    
Sbjct: 120 APYLFCGDTLFSAGCGRLFEGTAQQMFDSLQRILQLPDNTLVCCAHEYTESNLRFARHVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P N  ++ Y     ++R+++  T P+T+ +EK++NPFLR  +  L++N+      N    
Sbjct: 180 PQNRLIETYQQHAAALRAKHQPTVPTTLQIEKEINPFLRCYDDDLQRNVGFPTQPNEIWR 239

Query: 244 VFTELRIRKNQS 255
           VF  LR  K+  
Sbjct: 240 VFACLRDMKDSF 251


>gi|242035847|ref|XP_002465318.1| hypothetical protein SORBIDRAFT_01g036340 [Sorghum bicolor]
 gi|241919172|gb|EER92316.1| hypothetical protein SORBIDRAFT_01g036340 [Sorghum bicolor]
          Length = 258

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 111/256 (43%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LI +   +  AA+D  +   + K   E G ++  +  THHH DH   N
Sbjct: 4   IPVPCLEDNYAYLIVDESTKKAAAVDPVEPEKVIKAAGEVGAYVDCVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             ++              +     D   +           I  + TP HT GHI Y+   
Sbjct: 64  EKMRLQVPGIKIFGGSLDNVKGCTDQVENGTKLSLGKDIEILCLHTPCHTKGHISYYVTS 123

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
               D  +  GDTLF  GCG+ FE +  +M++S +  + S    T +Y GHEYT  N  F
Sbjct: 124 KEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLIVTLGSLPKSTRVYCGHEYTVKNLKF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L+ +P N + ++     +  R  N  T PSTI  E ++N F+R++   ++        S
Sbjct: 184 ILTVEPENEKTKQKLEWAEKQRQANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGAN--S 241

Query: 241 NLAVFTELRIRKNQSK 256
            +    E+R  K+  K
Sbjct: 242 PVEALREVRKTKDNWK 257


>gi|326317359|ref|YP_004235031.1| hydroxyacylglutathione hydrolase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374195|gb|ADX46464.1| Hydroxyacylglutathione hydrolase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 258

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 123/259 (47%), Gaps = 12/259 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+   R  A +D  +   + + L+  G  L  I  THHH DH    
Sbjct: 2   LPLPAFTDNYIWMLHD--GRSAAVVDPGEAGPVLQALQRHGLALQAILVTHHHGDHVGGV 59

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++     ++GP      IP     L+DG T         +I  PGHT GHI Y+  +
Sbjct: 60  AALREATGALVYGPAR--ESIPQPAQPLADGGTLQVLGLQFSVIDVPGHTAGHIAYYAAD 117

Query: 126 DHFL---CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                    GDTLFS GCGR+FE + A+M  SL+++ +   +T +   HEYT +N  FA 
Sbjct: 118 AAGGPLLFCGDTLFSGGCGRLFEGTPAQMQHSLDRLGALPPETRVCCAHEYTLSNLAFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-----NME 237
           + +P N  L +Y    +++R+    T PS +  E  VNPFLR     + +         +
Sbjct: 178 AVEPGNTALLQYSHDCEALRAAGQPTLPSRLGTEHAVNPFLRTREPGVARAAQAFAPGTD 237

Query: 238 NASNLAVFTELRIRKNQSK 256
            A   +V   LR  KN+ +
Sbjct: 238 TADPASVLAALRQWKNEFR 256


>gi|291613975|ref|YP_003524132.1| hydroxyacylglutathione hydrolase [Sideroxydans lithotrophicus ES-1]
 gi|291584087|gb|ADE11745.1| hydroxyacylglutathione hydrolase [Sideroxydans lithotrophicus ES-1]
          Length = 253

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/258 (30%), Positives = 122/258 (47%), Gaps = 8/258 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++ I I    DN+  L+          +D  +  ++   L+     L  I  TH H D
Sbjct: 1   MLNI-IPIPALQDNYIWLLRRD--NHAVIVDPGEAALVLDYLQANSLQLDAILCTHRHHD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L+  +N  + G     +     D    D    +       II  PGH   HI 
Sbjct: 58  HVDGIEELRGVYNVPVHGRSHPKNPHITHDLREGDRLWLETLDAEFAIIEVPGHLDDHIA 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       +  GD +F  GCG+ FE + A++  SL+++ +  D T +Y  HEYT  N  F
Sbjct: 118 FIA--PRVVFCGDVMFGGGCGKNFEGTPAQLLHSLQRLAALPDDTQVYCAHEYTSYNLPF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---NME 237
           AL+C+P N ++Q+  +  +S+R +NL T P TI+LEK  NPFLR  +  L + L    + 
Sbjct: 176 ALACEPDNPDVQRRIADTRSLRERNLSTVPFTIALEKATNPFLRCSSPELVRTLQARGLA 235

Query: 238 NASNLAVFTELRIRKNQS 255
           + S LAVFT LR  +++ 
Sbjct: 236 DTSELAVFTALREWRDRF 253


>gi|123441270|ref|YP_001005257.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|160395514|sp|A1JKA9|GLO2_YERE8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|122088231|emb|CAL11020.1| putative hydroxyacylglutathione hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 136/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADEQ-KHCVIVDPGESAPVLAALSQGQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L++ F        +E++   G    ++ GD    G    ++IA PGHT+ HI Y+   
Sbjct: 63  ADLRRHFPEIPVYGPQETA-NKGATIMVTGGDHLSIGGQNYQVIAVPGHTLEHIAYYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTPAQMYASIQQLAQLPDETLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R++N  + P  + +E+K+N FLR ++  L++ + + +  N  ++
Sbjct: 180 PSDQDIATYQQQIMQLRAKNQPSLPVKLQIERKINVFLRCDDIDLQRKIGVISPPNSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|121594111|ref|YP_986007.1| hydroxyacylglutathione hydrolase [Acidovorax sp. JS42]
 gi|120606191|gb|ABM41931.1| Hydroxyacylglutathione hydrolase [Acidovorax sp. JS42]
          Length = 259

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 83/264 (31%), Positives = 131/264 (49%), Gaps = 13/264 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L + +  + DN+  ++++ +      +D  D   + + LR  G  L  I  THHH D
Sbjct: 1   MKNL-LPLPAFADNYIWMMYDAQ--RAVVVDPGDAEPVLQALRSMGLPLEAILVTHHHGD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++    T++GP      +P     LS GDT         ++  PGHT GHI 
Sbjct: 58  HVGGVNALREATGATVYGPAT--EPMPEPLIRLSGGDTLQALGLTFSVLDVPGHTAGHIA 115

Query: 121 YHFMN---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           Y+  N   +  L  GDTLFS GCGR+FE +  +M  SL+ + +    T +   HEYT +N
Sbjct: 116 YYCANMEGEPLLLCGDTLFSGGCGRLFEGTPTQMQASLDTLAALPGNTRVCCAHEYTLSN 175

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA + +P N  L +Y ++ +S R  +  T PS I++E+ +NPFLR    ++ +  +  
Sbjct: 176 LKFARAVEPRNAALLQYITECESRRRADQPTLPSRIAIERDINPFLRTRVATVAQAAHGF 235

Query: 238 NA-----SNLAVFTELRIRKNQSK 256
           +A        AV   LR  KN+ +
Sbjct: 236 DALIDPREPAAVLAALRQWKNEFR 259


>gi|108806554|ref|YP_650470.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Antiqua]
 gi|108813079|ref|YP_648846.1| hydroxyacylglutathione hydrolase [Yersinia pestis Nepal516]
 gi|149366918|ref|ZP_01888952.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis
           CA88-4125]
 gi|165924657|ref|ZP_02220489.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938282|ref|ZP_02226840.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011971|ref|ZP_02232869.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211458|ref|ZP_02237493.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399719|ref|ZP_02305237.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419706|ref|ZP_02311459.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167470218|ref|ZP_02334922.1| metallo-beta-lactamase family protein [Yersinia pestis FV-1]
 gi|218928248|ref|YP_002346123.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis CO92]
 gi|229841010|ref|ZP_04461169.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229843115|ref|ZP_04463261.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229895467|ref|ZP_04510639.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Pestoides A]
 gi|229903522|ref|ZP_04518635.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Nepal516]
 gi|294503095|ref|YP_003567157.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Z176003]
 gi|122960103|sp|Q0WHW5|GLO2_YERPE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123372682|sp|Q1CAJ7|GLO2_YERPA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123372998|sp|Q1CFI4|GLO2_YERPN RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|108776727|gb|ABG19246.1| hydroxyacylglutathione hydrolase [Yersinia pestis Nepal516]
 gi|108778467|gb|ABG12525.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Antiqua]
 gi|115346859|emb|CAL19745.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis CO92]
 gi|149291292|gb|EDM41367.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis
           CA88-4125]
 gi|165913660|gb|EDR32279.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923717|gb|EDR40849.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989138|gb|EDR41439.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166207229|gb|EDR51709.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962447|gb|EDR58468.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050427|gb|EDR61835.1| metallo-beta-lactamase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|229679292|gb|EEO75395.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Nepal516]
 gi|229689462|gb|EEO81523.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697376|gb|EEO87423.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701622|gb|EEO89649.1| predicted hydroxyacylglutathione hydrolase [Yersinia pestis
           Pestoides A]
 gi|262365375|gb|ACY61932.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis D182038]
 gi|294353554|gb|ADE63895.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis Z176003]
 gi|320014215|gb|ADV97786.1| putative hydroxyacylglutathione hydrolase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 133/252 (52%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  F        +E++K       ++DGD+         IIA PGHT+GHI Y+   
Sbjct: 63  ADLRHHFPDIPVYGPQETAKKGATVI-VNDGDSLTIAGQNYTIIAVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA +  
Sbjct: 120 SPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  ++
Sbjct: 180 PADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGTTSPPDSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF ELR RK+  
Sbjct: 240 VFCELRSRKDSF 251


>gi|78191468|gb|ABB29955.1| hydroxyacylglutathione hydrolase cytoplasmic-like [Solanum
           tuberosum]
          Length = 258

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 72/260 (27%), Positives = 118/260 (45%), Gaps = 9/260 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L+I      DN+  +I +   +  A +D  + + + ++ +E    L  +  THHH D
Sbjct: 1   MKVLHI--PCLDDNYSYMIIDETTKEAAVVDPVEPHKVLRVAQENEVDLKFVLTTHHHWD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K+             +     D   +           I  + TP HT GHI 
Sbjct: 59  HAGGNDKIKQLVPGIKIYGGSVDNVRGCTDKVENGDRISLGVDISILSLHTPAHTKGHIS 118

Query: 121 YHFMN----DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
           Y+  +    D  +  GDTLF  GCG+ FE +  +M++S    + S    T +Y GHEYT 
Sbjct: 119 YYVTDKEGEDPAVFTGDTLFIAGCGKFFEGTAEQMYQSLCVTLGSLPKPTLVYCGHEYTV 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  FAL+ +P N ++ +  +  +  R   L T PSTI  E + NPF+R++   ++  + 
Sbjct: 179 KNLQFALTVEPDNAKIAQKLAWAERQRRVGLPTIPSTIQEELESNPFMRVDLPEVQDKVG 238

Query: 236 MENASNLAVFTELRIRKNQS 255
            +  S +    E+R RK+  
Sbjct: 239 CK--SPVEAMREIRQRKDNW 256


>gi|127513042|ref|YP_001094239.1| hydroxyacylglutathione hydrolase [Shewanella loihica PV-4]
 gi|226724026|sp|A3QET2|GLO2_SHELP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|126638337|gb|ABO23980.1| Hydroxyacylglutathione hydrolase [Shewanella loihica PV-4]
          Length = 260

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/262 (34%), Positives = 132/262 (50%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++   I  ++DN+  LIH         +D  D   +   L +    L  I  THHH D
Sbjct: 1   MHTVT-PIPAFNDNYIWLIHAKDSGGHYVVDPGDAKAVLDYLEQHQIVLDGILITHHHSD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH---PIKIIATPGHTIG 117
           HT     L+   +  +     ++  I GI+H +S                +   PGHT+G
Sbjct: 60  HTGGIAELQASHDHKLTVYGPDNENIKGINHPISGQTESVKPEKLDSDAAVFHLPGHTLG 119

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI Y    D  L  GDTLFS GCGR+FE + A+M  SL+ +    + T +Y  HEYT+ N
Sbjct: 120 HIAYLI--DDHLFCGDTLFSAGCGRLFEGTPAQMHHSLQTLAQLDETTLVYPAHEYTQAN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FAL+ +  N  L  + +KVK +R QNL + PS+I LEK++NPFLR E  S+++NL+  
Sbjct: 178 LAFALTVENDNEALIAHAAKVKQLRDQNLPSLPSSIGLEKQINPFLRPEQASIKQNLSCH 237

Query: 238 NASNL----AVFTELRIRKNQS 255
            A ++      FT LR  K+  
Sbjct: 238 FAQDVTDDGTSFTLLRQWKDNF 259


>gi|255261560|ref|ZP_05340902.1| hydroxyacylglutathione hydrolase [Thalassiobium sp. R2A62]
 gi|255103895|gb|EET46569.1| hydroxyacylglutathione hydrolase [Thalassiobium sp. R2A62]
          Length = 262

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 85/262 (32%), Positives = 127/262 (48%), Gaps = 7/262 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  +IH+     TA +D  D   I   L  +GW LT ++ THHH D
Sbjct: 1   MAIEIVTLPCLEDNYAYIIHDPVSTATALVDVADHEPILAELDRRGWRLTDVWITHHHWD 60

Query: 61  HTRANLNLKKFFNCTIFGP-------LEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPG 113
           H      L          P                I   + +G    FG HP+++    G
Sbjct: 61  HVDGLAPLLDALAAKGIAPLVTAAAADMHRMPEGLITDTVEEGSNMRFGDHPVQVFDVSG 120

Query: 114 HTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           HTI HI ++    +     D+L +LGCGR+FE + A+M++SL+K++    +T I  GHEY
Sbjct: 121 HTINHIAFYLAAANAAFTADSLMALGCGRLFEGTPAQMWKSLQKLRVLPPETVICSGHEY 180

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +NA FAL+ +P N EL      V + R + + T PS +S E   NPFLR ++  L+  
Sbjct: 181 TASNAKFALTIEPDNSELISRVRAVTAARDKGVPTVPSLLSDEINTNPFLRADHPDLQHA 240

Query: 234 LNMENASNLAVFTELRIRKNQS 255
           + M  A+   VF  +R  K+Q 
Sbjct: 241 VGMAGANASEVFAHVRRAKDQF 262


>gi|92114067|ref|YP_573995.1| hydroxyacylglutathione hydrolase [Chromohalobacter salexigens DSM
           3043]
 gi|122419844|sp|Q1QW62|GLO2_CHRSD RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91797157|gb|ABE59296.1| Hydroxyacylglutathione hydrolase [Chromohalobacter salexigens DSM
           3043]
          Length = 255

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 83/253 (32%), Positives = 123/253 (48%), Gaps = 5/253 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+          +D  D   + + L  +G  L  I  THHH DHT   
Sbjct: 5   IPIPAFQDNYIWLLRQDASDKVVIVDPGDAQPVIEYLEREGLSLAAILVTHHHHDHTGGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K ++  + G   ++S IP ID  + D D         ++ A PGHT+ HI ++   
Sbjct: 65  DALVKRYSPRVIG--PDNSAIPAIDEVVGDEDECRVQGRRFEVFAVPGHTLDHIAFYAPG 122

Query: 126 DHF-LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
               L  GDTLFS GCGR+FE +  +M  SL ++ +  D T ++ GHEYT  N  FA + 
Sbjct: 123 TPGLLFCGDTLFSGGCGRLFEGTAEQMHRSLARLAALPDDTLVFAGHEYTLANLRFAQAA 182

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNL 242
           +P N     +  + +  R     T PSTI  E+++NPFLRI+   L   L  + +   + 
Sbjct: 183 EPDNPARDAHLGECERARQLERPTLPSTIGRERQINPFLRIDQPGLLNALAEQGSVDDDS 242

Query: 243 AVFTELRIRKNQS 255
           A F  LR  K++ 
Sbjct: 243 AAFATLRGWKDRF 255


>gi|330878787|gb|EGH12936.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 259

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 136/260 (52%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
               + LK+     + GP      IP  D  L+D D          + A PGHT+GHI +
Sbjct: 62  VGGVVELKQATRARVLGPAT--ESIPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  
Sbjct: 120 YHEDATAPLLFSGDTLFAAGCGRLFEGTPEQMHTSLERLAALPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V  +RS+N  + PS+++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAERLAQVTLLRSENRISLPSSLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|241663326|ref|YP_002981686.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
 gi|240865353|gb|ACS63014.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12D]
          Length = 279

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 81/265 (30%), Positives = 127/265 (47%), Gaps = 18/265 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L   +            GP  ES           D  T    +   ++I  PGHT GH+
Sbjct: 74  ELLAAYPHNPEGAPLPVIGPAHESIPCRTQAVREGDVVTLAQPAATFRVIDVPGHTSGHV 133

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  HEYT
Sbjct: 134 AYVGQLQGNAASASLFCGDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAHEYT 193

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N +L  +  +V ++R++   T P+TI  E+  NPF+R ++     ++
Sbjct: 194 ASNVRFARAVEPGNADLAAWEDEVTALRAEGRSTVPTTIGHERATNPFMRSDDANVTQAV 253

Query: 231 RKNLNMENASNLAVFTELRIRKNQS 255
            ++  ++    +AVF  LR  KN  
Sbjct: 254 ARHAGIDADDPVAVFAALRQWKNDF 278


>gi|307943545|ref|ZP_07658889.1| hydroxyacylglutathione hydrolase [Roseibium sp. TrichSKD4]
 gi|307773175|gb|EFO32392.1| hydroxyacylglutathione hydrolase [Roseibium sp. TrichSKD4]
          Length = 260

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 106/247 (42%), Positives = 143/247 (57%), Gaps = 1/247 (0%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
              +DNF +LIH  + + T AID PD     K L+++GW LTHI  THHH DH +   +L
Sbjct: 13  PCLNDNFGLLIHEPQSKTTIAIDVPDAMPYKKELQDRGWTLTHILVTHHHWDHVQGIGDL 72

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           K   N  + GP     KI G+  G+ DGD    G   ++ I TPGHT+  I ++F   + 
Sbjct: 73  KTGTNAVVIGPELSRDKIEGMSKGVEDGDKVLCGPLEVQAIGTPGHTLDQISWYFPQLNM 132

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTH-IYFGHEYTENNAYFALSCDPH 187
              GDTLF+LGCGR+FE     M+ SL K+K        IY GHEYT  NA FAL  +P 
Sbjct: 133 AHTGDTLFALGCGRVFEGDKEMMWSSLSKLKRMLPDQTTIYCGHEYTLANALFALRVEPE 192

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N +L+   + ++++RS  L T P+T+ LEK  NPFLR +  SL+  L M   S+ AVFTE
Sbjct: 193 NQDLRARAAVIEALRSDQLPTLPTTMKLEKATNPFLRADQPSLKAALGMTGKSDAAVFTE 252

Query: 248 LRIRKNQ 254
           +R RK+ 
Sbjct: 253 IRTRKDN 259


>gi|313498006|gb|ADR59372.1| GloB [Pseudomonas putida BIRD-1]
          Length = 259

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/262 (33%), Positives = 134/262 (51%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  +  A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH 
Sbjct: 1   MIQIE-ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHN 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      L++     + GP     +IPG D  L +GD  D      +++A PGHT+GHI
Sbjct: 60  DHVGGVERLRQLTGARVCGPAN--ERIPGRDLALDEGDRVDVLGVTFQVLAVPGHTLGHI 117

Query: 120 CYHFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            +         L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N
Sbjct: 118 AFFSDQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTQVYCAHEYTLSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++     
Sbjct: 178 LRFAKAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEW 237

Query: 235 -NMENASNLAVFTELRIRKNQS 255
               N S++AVF  LR  K+  
Sbjct: 238 KGHSNTSHVAVFAALRSWKDTF 259


>gi|332141407|ref|YP_004427145.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551429|gb|AEA98147.1| Hydroxyacylglutathione hydrolase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 263

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 83/260 (31%), Positives = 120/260 (46%), Gaps = 10/260 (3%)

Query: 2   TSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           + + I  I  + DN+   IH+        +D  D   +   +  KG  L+ +  THHH D
Sbjct: 8   SGITIHPIPAFTDNYIWCIHDDTN--AIVVDPGDAEPVLAFINAKGLTLSAVLITHHHRD 65

Query: 61  HTRANLNLKKFFNCTIFGPLEESS-KIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           HT     L              +  +         D  +    +   +++  PGHT+ HI
Sbjct: 66  HTGGIAKLATAVPELPIIGPRGNHIRGITKSVAQGDTVSLPILNLSFQVMEVPGHTLDHI 125

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            +       L  GDTLFS GCGR+FE S  +M+ SL K+K   D T +Y  HEYT+ N  
Sbjct: 126 AFFGHGA--LFCGDTLFSAGCGRLFEGSPEQMYHSLNKLKRLPDDTKVYCTHEYTQANVN 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FAL+ +P N  L  Y   V SMR QNL T PS +  +K +NPFLR    S++        
Sbjct: 184 FALAVEPDNGALNHYADWVASMREQNLPTLPSNLEEQKNINPFLRAHELSVKTAAEAYCE 243

Query: 237 -ENASNLAVFTELRIRKNQS 255
              A ++AVF  +R  K++ 
Sbjct: 244 NNLADDVAVFAAVRRWKDEF 263


>gi|300868557|ref|ZP_07113174.1| Hydroxyacylglutathione hydrolase [Oscillatoria sp. PCC 6506]
 gi|300333435|emb|CBN58366.1| Hydroxyacylglutathione hydrolase [Oscillatoria sp. PCC 6506]
          Length = 257

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 95/254 (37%), Positives = 142/254 (55%), Gaps = 8/254 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  L+H+    + A +D      + + L+  G  LT IFNTHHH DH   N  
Sbjct: 6   LPILSDNYIFLLHDRDRNIAAVVDPGLAQPVLQQLQALGTPLTAIFNTHHHNDHIGGNSE 65

Query: 68  L-KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           L ++F    ++  +++  +IPG +  L DGD   F +   +I   PGHT  HI Y+F  +
Sbjct: 66  LLQRFPYAKVYAGIKDRGRIPGAEVFLEDGDRVSFAAQTAQIFFVPGHTKAHIAYYFPPN 125

Query: 127 HF-----LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           H      L  GDTLF+ GCGR+ E +  +M  SL K+++  D T ++  HEYT  N  FA
Sbjct: 126 HPKENGELFCGDTLFAGGCGRVSESTPDQMLASLNKLRALPDNTRVWCAHEYTLKNLQFA 185

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L+ DP N +LQ   +KVK+ R+++  T PSTI+LEK  NPFLR +  +L+   N ++ + 
Sbjct: 186 LTVDPDNPDLQHRFAKVKAARNRSEATIPSTIALEKNTNPFLRCDRPNLQSATNSKDPTL 245

Query: 242 LAVFTELRIRKNQS 255
              FT LR  K+Q 
Sbjct: 246 --TFTRLRRMKDQF 257


>gi|309782459|ref|ZP_07677183.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
 gi|308918796|gb|EFP64469.1| hydroxyacylglutathione hydrolase [Ralstonia sp. 5_7_47FAA]
          Length = 279

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 128/266 (48%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L   +            GP  ES           D  T    +   ++I  PGHT GH+
Sbjct: 74  ELLDAYPQNPEGAPLPVIGPAHESIPCRTQAVREGDVVTLTQPAATFRVIDVPGHTSGHV 133

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  HEYT
Sbjct: 134 AYVGHLQGNAASASLFCGDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAHEYT 193

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N +L  +  +V ++R++   T P+TI  E+  NPF+R ++     ++
Sbjct: 194 ASNVRFARAVEPGNADLAAWEDEVTALRAEGRSTVPTTIGHERATNPFIRSDDANVTQAV 253

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  ++    +AVF  LR  KN  +
Sbjct: 254 ARHAGIDADDPVAVFAALRQWKNDFR 279


>gi|167034711|ref|YP_001669942.1| hydroxyacylglutathione hydrolase [Pseudomonas putida GB-1]
 gi|226724009|sp|B0KN02|GLO2_PSEPG RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166861199|gb|ABY99606.1| hydroxyacylglutathione hydrolase [Pseudomonas putida GB-1]
          Length = 259

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/262 (33%), Positives = 134/262 (51%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFSDNYIWLLQDTAKRRCAVVDPGDAAPVERWLAANPEWVLSDILVTHHHN 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     +IPG D  L +GD  D      +++A PGHT+GHI
Sbjct: 60  DHVGGVERLKQLSGARVCGPAN--ERIPGRDLALDEGDKVDVLGVTFQVLAVPGHTLGHI 117

Query: 120 CYHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            +            GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N
Sbjct: 118 AFFSDGPPTPVLFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTEVYCAHEYTLSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++     
Sbjct: 178 LRFAKAVEPTNTHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEW 237

Query: 235 -NMENASNLAVFTELRIRKNQS 255
               N S++AVF  LR  K+  
Sbjct: 238 KGHSNTSHVAVFAALRSWKDTF 259


>gi|56551655|ref|YP_162494.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761219|ref|ZP_04759307.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543229|gb|AAV89383.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374126|gb|EER63623.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 241

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 94/255 (36%), Positives = 142/255 (55%), Gaps = 14/255 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   +A+  +  N+  L+H+     T  +D      +   +++KGW +T I+NTH H D
Sbjct: 1   MTIEIVAVPAFETNYIWLLHDKVSDKTVVVDPGQAEPVLDFIQKKGWEVTQIWNTHWHND 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  +K    C + GP  ES  IP ID  + +GD    GS   K++A P HT+GH+ 
Sbjct: 61  HTGGNEVIKAETGCDVIGPSHESHPIPAIDIKVDEGDEIGLGSLVAKVMAIPAHTLGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  + H L  GDTLF++GCGRIFE +  +M+++L++  +   +T +Y GHEYT++N +F
Sbjct: 121 YYIPDHHVLFCGDTLFAMGCGRIFEGTAEQMWQALQRFAALPPETKVYCGHEYTQDNGHF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  LQK   +V  +R+Q   T P+TI+LEK  NPF+R +N             
Sbjct: 181 ALTVDPDNQALQKRVKEVDLLRAQGKITLPTTIALEKATNPFMRAKNP------------ 228

Query: 241 NLAVFTELRIRKNQS 255
                 +LR  K+  
Sbjct: 229 --EELAKLRKAKDIF 241


>gi|240851396|ref|YP_002972799.1| hydroxyacylglutathione hydrolase [Bartonella grahamii as4aup]
 gi|240268519|gb|ACS52107.1| hydroxyacylglutathione hydrolase [Bartonella grahamii as4aup]
          Length = 253

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+ K   TAAIDAP++  I   L+ + W L  IF THHH DH  A   LK
Sbjct: 8   CRKDNFGVLIHDEKSGYTAAIDAPESEAIHNALKRRNWTLQTIFVTHHHHDHVEALEELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +N  + GP  E  KI  +D  L   +   FGSH +  ++TPGHT G + Y+F     L
Sbjct: 68  QVYNAMVIGPEAEKEKIHHLDQTLQPDEKLLFGSHSLLALSTPGHTSGALSYYFPEKGLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYT+NNA+FAL+ DPHN 
Sbjct: 128 FAGDTLFSLGCGRLFEGTPVQMLNSLKKLRQLPDETLLYCGHEYTKNNAFFALTIDPHNK 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +   +V  + + N  T P T+  EK  NPFLR +N ++RKNL+M NA++  VF E+R
Sbjct: 188 KLHQRIEEVFLLSAGNAMTLPVTLGQEKTTNPFLRWDNPAIRKNLSMTNATDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK++ 
Sbjct: 248 KRKDKF 253


>gi|257051017|sp|Q99KB8|GLO2_MOUSE RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
          Length = 309

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 116/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + +  ++    LT +  THHH DH   N  
Sbjct: 55  LPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHHVKLTTVLTTHHHWDHAGGNEK 114

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 115 LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPG 172

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 173 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFA 232

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 233 RHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 290

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 291 VTTMRAIRREKDQFK 305


>gi|332978524|gb|EGK15233.1| hydroxyacylglutathione hydrolase [Psychrobacter sp. 1501(2011)]
          Length = 259

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/261 (28%), Positives = 125/261 (47%), Gaps = 8/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+ +   I  + DN+   + N   +    ID      ++  L++ G  LT I+ THHH D
Sbjct: 1   MSLIITPIPAFTDNYIWAMVNDTNKQAIVIDPGQAEPVADYLQQYGLELTAIWITHHHHD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +  T       S      D  + +G +     +  ++ A PGHT  H+ 
Sbjct: 61  HIGGVAELRELYPMTHVVAS--SDHGVSPDQVVKEGSSVSAWGYTAQVWAVPGHTESHLA 118

Query: 121 YHFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           Y    D    +  GDTLFS GCGR+F  +  ++FES ++       T  Y  HEYT +N 
Sbjct: 119 YVLAKDEIKQVFCGDTLFSAGCGRVFTGTIEQLFESFKRFNKLPKSTLFYPAHEYTASNL 178

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIEN----TSLRKNL 234
            F LS +P N  +Q+  ++V ++  Q   + P ++  E++VN FLR E       +++ +
Sbjct: 179 KFGLSIEPDNTVMQQCLTEVIALTEQGKSSLPVSLEHERQVNVFLRTEELTVIDGVQRQV 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
           ++ +  +L VF+ LR  K+  
Sbjct: 239 SLPDTKSLTVFSALRTLKDNF 259


>gi|304413389|ref|ZP_07394862.1| putative hydroxyacylglutathione hydrolase [Candidatus Regiella
           insecticola LSR1]
 gi|304284232|gb|EFL92625.1| putative hydroxyacylglutathione hydrolase [Candidatus Regiella
           insecticola LSR1]
          Length = 258

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 131/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ + +      +D  +   +  +L ++   +  I  THHH DH    
Sbjct: 11  ISIPALQDNYIWLLIDEQDH-CIIVDPGEASPVLAILNKRHLIVDAILLTHHHQDHLDGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K F         E+ K       + +GD    G     +IA PGHT+GHI Y+   
Sbjct: 70  PELLKHFPQIPVYGPRETEKKGATKL-IEEGDDLIIGRQNFSVIAVPGHTLGHIAYYN-- 126

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ SL+KI    D T I  GHEYT +N  FA S  
Sbjct: 127 APYLFCGDTLFSAGCGRLFEGTGDQMYRSLQKIMQLPDDTLICGGHEYTLSNLAFARSIL 186

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-LNMENASNLA- 243
             + +++ Y  KV  +R++   + P+T+  E+++N FLR +   L+K  L  ++ ++L+ 
Sbjct: 187 AEDKKIEAYQKKVMQLRAEKQPSLPTTLQWEREINIFLRCDEIELQKRVLGGKSLTSLSL 246

Query: 244 VFTELRIRKNQS 255
           VF+ LR+ K++ 
Sbjct: 247 VFSALRMMKDRF 258


>gi|224070242|ref|XP_002188273.1| PREDICTED: putative hydroxyacyl glutathione hydrolase isoform 1
           [Taeniopygia guttata]
          Length = 311

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/256 (28%), Positives = 118/256 (46%), Gaps = 10/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DN+  L+ +   R  A +D      +   +++ G  LT +  THHH DH   N 
Sbjct: 56  ILPALTDNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNE 115

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K             S++  +   +S       GS  +K ++TP HT GHICY+    
Sbjct: 116 KLVKMEPGLRVL--GGDSRVGALTQRVSHLTALQVGSLSVKCLSTPCHTSGHICYYVTKP 173

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
           +         GDTLF  GCG+ FE +  EM+++ +E + S   KT +Y GHEYT NN  F
Sbjct: 174 NSSEPPAVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPKTRVYCGHEYTINNLKF 233

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   +P N  +Q+  +  K+       T PST++ E   NPF+R+   S++ +     + 
Sbjct: 234 ARHVEPGNPNIQEKLAWAKARYDSGEPTIPSTLAEEFTYNPFMRVREKSVQDHAG--ESD 291

Query: 241 NLAVFTELRIRKNQSK 256
            +     +R  K+  +
Sbjct: 292 PVRAMGAIRKEKDNFR 307


>gi|282897994|ref|ZP_06305989.1| Beta-lactamase-like protein [Raphidiopsis brookii D9]
 gi|281197138|gb|EFA72039.1| Beta-lactamase-like protein [Raphidiopsis brookii D9]
          Length = 257

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/256 (35%), Positives = 138/256 (53%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++  + + A +D      + + L E    L  IFNTHHH DH   N
Sbjct: 4   IQLSALSDNYIFLLYDSYHNIAAVVDPAQPEPVIEKLTELQCNLVAIFNTHHHHDHVGGN 63

Query: 66  LNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + F   TI+G +++  +IPG    L   D   FG     ++  PGHT  HI Y+F 
Sbjct: 64  QKLIEKFPQVTIYGGIQDRGRIPGQQVFLQANDIVKFGDRQGIVLFIPGHTRAHIAYYFP 123

Query: 125 N-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE + A+M  SL ++++  D T ++  HEYT NN  
Sbjct: 124 PVTPGETGELFCGDTLFAGGCGRLFEGTPAQMVGSLTQLRALPDNTRVWCAHEYTWNNLR 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N ELQK  ++V ++R     T PS + +EK+ NPFLR +  SL+  +  +++
Sbjct: 184 FALTVDSENQELQKRFTEVTALRQLQQPTVPSILGIEKQTNPFLRWDQPSLQLAV--KSS 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F ++R  K++ 
Sbjct: 242 DPIQTFAKIRGMKDKY 257


>gi|253996676|ref|YP_003048740.1| hydroxyacylglutathione hydrolase [Methylotenera mobilis JLW8]
 gi|253983355|gb|ACT48213.1| hydroxyacylglutathione hydrolase [Methylotenera mobilis JLW8]
          Length = 262

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 80/253 (31%), Positives = 119/253 (47%), Gaps = 5/253 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  ++DN+  LIHN   R    +D  D   +   L++    L  I  THHH DH    
Sbjct: 12  IPIPAFNDNYLWLIHNQ--RKAIVVDPGDAAPVINTLKKLNLDLQTILITHHHQDHIGGV 69

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF-DFGSHPIKIIATPGHTIGHICYHFM 124
             L + +        +                 +        K+I  PGHT+GHI Y+  
Sbjct: 70  ELLLRTYPNAEVFAPKLEHYPFKHTPVGEPQQVYLGDWVSSAKVIDVPGHTLGHIAYYIE 129

Query: 125 ND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
           +D   +L  GDT+F  GCGR+FE + A+M  SL+K+ +    T +Y  HEYT +N  FAL
Sbjct: 130 HDAQQWLFCGDTMFGAGCGRLFEGTPAQMQASLQKLTALPASTQVYCTHEYTLHNISFAL 189

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           + +P N  L K     K+  +    T PS ++LE   NPFLR     ++ +L+ EN + L
Sbjct: 190 TLEPGNASLIKRQQDAKARITSGQPTLPSNLALELATNPFLRCHMPEIQASLHTENTNLL 249

Query: 243 AVFTELRIRKNQS 255
             F+ +R  +N  
Sbjct: 250 QTFSAMRGLRNSY 262


>gi|90407278|ref|ZP_01215464.1| putative hydroxyacylglutathione hydrolase GloB [Psychromonas sp.
           CNPT3]
 gi|90311561|gb|EAS39660.1| putative hydroxyacylglutathione hydrolase GloB [Psychromonas sp.
           CNPT3]
          Length = 258

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 84/254 (33%), Positives = 126/254 (49%), Gaps = 6/254 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  ++DN+  LI + + +    +D  D   + ++L ++   +  I  TH H DH    
Sbjct: 5   ITIKAFNDNYIWLIKDSQSQRCILVDPGDAQPVLEILEQQNLSVDAILVTHAHQDHIGGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   FN  I    ++                F      +K++  PGHT+ H+ Y+  N
Sbjct: 65  SELLAHFNKEIPIYSKDKLFSSSEPVEEGKTLCFFEQRLSLKVMFVPGHTLDHVAYY--N 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFS GCGR+ E ++ +MF SL +I    D T +Y  HEYT+ N  FAL  +
Sbjct: 123 DSSLFCGDTLFSAGCGRVMEGTHQQMFTSLARISQLKDTTKVYCAHEYTQQNLIFALHLE 182

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN---- 241
           P N  L+ +  KV  +R Q L + P+T++LEK +NPFLR  +T L+  L  +        
Sbjct: 183 PKNRALRAHMQKVAKLRQQGLASVPTTLALEKTLNPFLRCSDTGLKNALQNKLCDEIHDA 242

Query: 242 LAVFTELRIRKNQS 255
           L  FT+LR  K+  
Sbjct: 243 LHCFTKLRQYKDVF 256


>gi|227499238|ref|NP_077246.2| hydroxyacylglutathione hydrolase, mitochondrial isoform 1 precursor
           [Mus musculus]
 gi|148690423|gb|EDL22370.1| hydroxyacyl glutathione hydrolase [Mus musculus]
          Length = 309

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 116/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + +  ++    LT +  THHH DH   N  
Sbjct: 55  LPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEK 114

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 115 LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPG 172

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 173 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFA 232

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 233 RHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 290

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 291 VTTMRAIRREKDQFK 305


>gi|227499240|ref|NP_001153098.1| hydroxyacylglutathione hydrolase, mitochondrial isoform 2 [Mus
           musculus]
 gi|74150962|dbj|BAE27615.1| unnamed protein product [Mus musculus]
 gi|74151730|dbj|BAE29657.1| unnamed protein product [Mus musculus]
 gi|74185510|dbj|BAE30223.1| unnamed protein product [Mus musculus]
 gi|74220485|dbj|BAE31462.1| unnamed protein product [Mus musculus]
          Length = 260

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 116/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + +  ++    LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 66  LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPG 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 124 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAIRREKDQFK 256


>gi|306843386|ref|ZP_07475987.1| hydroxyacylglutathione hydrolase [Brucella sp. BO1]
 gi|306276077|gb|EFM57777.1| hydroxyacylglutathione hydrolase [Brucella sp. BO1]
          Length = 260

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA IDAPD Y I   L  +GW L  IF THHH+DH   N  LK
Sbjct: 15  CRSDNYGVLIHDPESALTATIDAPDAYAIEAALERRGWTLDFIFTTHHHLDHVEGNEPLK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             F  +I GP  E +KIPGID  +  GD F FG   +K+I+TPGHT G I Y+  +   +
Sbjct: 75  AKFGVSIIGPEAEKAKIPGIDRTVKGGDEFTFGLFKVKVISTPGHTAGGISYYLPDAKVV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE + A MF SLEK+ +    T +Y GHEY++NNA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPATMFHSLEKLVALPGDTALYCGHEYSQNNARFALTIDPDNS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++   ++  +R+    T PSTI++E   NPFLR  + ++R  L +++A + AVF E+R
Sbjct: 195 ALKERAREIARLRAHERMTLPSTIAIEMATNPFLRWHDRTIRARLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|257483799|ref|ZP_05637840.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331012691|gb|EGH92747.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 259

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 132/260 (50%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + L  I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLADILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATRARVLGPAA--ETIPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAQRLAEVTRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|74227220|dbj|BAE38377.1| unnamed protein product [Mus musculus]
          Length = 260

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 115/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + +  ++    LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T    S  +K ++TP HT GHICY      
Sbjct: 66  LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVESLSVKCLSTPCHTSGHICYFVSKPG 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 124 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAIRREKDQFK 256


>gi|26990837|ref|NP_746262.1| hydroxyacylglutathione hydrolase [Pseudomonas putida KT2440]
 gi|81439999|sp|Q88FF3|GLO2_PSEPK RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24985845|gb|AAN69726.1|AE016608_12 hydroxyacylglutathione hydrolase [Pseudomonas putida KT2440]
          Length = 259

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 134/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH DH
Sbjct: 2   IQIEALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 L++     + GP     +IPG D  L +GD  D      +++A PGHT+GHI +
Sbjct: 62  VGGVERLRQLTGARVCGPAN--ERIPGRDLALDEGDRVDVLGVTFQVMAVPGHTLGHIAF 119

Query: 122 HFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N  
Sbjct: 120 FSDQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTQVYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++       
Sbjct: 180 FAKAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTAETLVKQKADEWKG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
             N S++AVF  LR  K+  
Sbjct: 240 HSNNSHVAVFAALRSWKDTF 259


>gi|148234718|ref|NP_001089873.1| hydroxyacylglutathione hydrolase [Xenopus laevis]
 gi|80477642|gb|AAI08581.1| MGC131075 protein [Xenopus laevis]
          Length = 260

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 122/255 (47%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +   +++ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLLIDEESKEAAIVDPVQPQKVVDAVKKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K  +          S+I  +   +S   TF  GS  +K + TP HT GHICY+    +
Sbjct: 66  LVKMVSGVKVY--GGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPN 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+ + +E +     +T +Y GHEYT NN  FA
Sbjct: 124 STEPPALFTGDTLFVAGCGKFFEGTAEEMYAALIEVLGRLPPQTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  +++  +  K   +    T PST++ E   NPF+R+   S++++   +    
Sbjct: 184 RHVEPNNDAIKQKLAWAKETYNNGEPTIPSTLAEEFTFNPFMRVREKSVQEHAGEQ--DP 241

Query: 242 LAVFTELRIRKNQSK 256
           ++    +R  K+  K
Sbjct: 242 ISTMGAIRKEKDNFK 256


>gi|315630402|ref|NP_203500.2| hydroxyacylglutathione hydrolase, mitochondrial precursor [Rattus
           norvegicus]
 gi|149052065|gb|EDM03882.1| hydroxyacyl glutathione hydrolase [Rattus norvegicus]
          Length = 309

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 74/262 (28%), Positives = 120/262 (45%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + +    DN+  LI +   +  A +D      + + +++    LT +  THHH D
Sbjct: 49  MMKIEL-LPALTDNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWD 107

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  L K              +I  + H ++   T   GS  +K ++TP HT GHIC
Sbjct: 108 HAGGNEKLVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHIC 165

Query: 121 YHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYT 174
           Y               GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT
Sbjct: 166 YFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 225

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            NN  FA   +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++ 
Sbjct: 226 VNNLKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHA 285

Query: 235 NMENASNLAVFTELRIRKNQSK 256
                  +     +R  K+Q K
Sbjct: 286 G--ETDPVTTMRAIRREKDQFK 305


>gi|78369248|ref|NP_001030351.1| hydroxyacylglutathione hydrolase, mitochondrial precursor [Bos
           taurus]
 gi|257051050|sp|Q3B7M2|GLO2_BOVIN RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|77567664|gb|AAI07546.1| Hydroxyacylglutathione hydrolase [Bos taurus]
 gi|296473448|gb|DAA15563.1| hydroxyacylglutathione hydrolase, mitochondrial precursor [Bos
           taurus]
          Length = 308

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ +   +  A +D      + +  R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY     +
Sbjct: 114 LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLHVKCLSTPCHTSGHICYFVTKPN 171

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 172 SPEPPAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFA 231

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PSTI+ E   NPF+R+   +++++        
Sbjct: 232 RHVEPDNTAVREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAG--ETEP 289

Query: 242 LAVFTELRIRKNQSK 256
           +A    +R  K+Q K
Sbjct: 290 VATMRAIRKEKDQFK 304


>gi|66911967|gb|AAH97301.1| Hagh protein [Rattus norvegicus]
          Length = 304

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 74/262 (28%), Positives = 120/262 (45%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + +    DN+  LI +   +  A +D      + + +++    LT +  THHH D
Sbjct: 44  MMKIEL-LPALTDNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWD 102

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  L K              +I  + H ++   T   GS  +K ++TP HT GHIC
Sbjct: 103 HAGGNEKLVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHIC 160

Query: 121 YHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYT 174
           Y               GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT
Sbjct: 161 YFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 220

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            NN  FA   +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++ 
Sbjct: 221 VNNLKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHA 280

Query: 235 NMENASNLAVFTELRIRKNQSK 256
                  +     +R  K+Q K
Sbjct: 281 G--ETDPVTTMRAIRREKDQFK 300


>gi|319406393|emb|CBI80034.1| hydroxyacylglutathione hydrolase [Bartonella sp. AR 15-3]
          Length = 253

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 160/246 (65%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF ILIH+ K   TAAIDAP++  I  ML+++ W L  IF THHH DH  A   LK
Sbjct: 8   CRKDNFGILIHDEKSGYTAAIDAPESNAIHDMLKQRNWTLQFIFVTHHHHDHIEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +N  I GP  E  KI  +D+ L   + F FG++ +  ++TPGHT+G + Y+F   + L
Sbjct: 68  QVYNAMIIGPEAERKKITPLDYALQPDENFCFGTYTLTALSTPGHTLGALSYYFSQANLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE + ++M  SL+K++   D+T +Y GHEYT+ NA FAL+ DP N 
Sbjct: 128 FTGDTLFSLGCGRLFEGTPSQMLTSLKKLRQLPDETILYCGHEYTQINALFALTIDPQNR 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +   +V S+R+QN  T P+T+  EK+ NPFLR + + LRKNL ME A++  VF E+R
Sbjct: 188 KLHQRVEEVFSLRAQNAMTLPTTLGKEKETNPFLRWDASILRKNLAMEKATDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 RRKDNF 253


>gi|71082924|ref|YP_265643.1| hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91762652|ref|ZP_01264617.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|123647338|sp|Q4FP49|GLO2_PELUB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71062037|gb|AAZ21040.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91718454|gb|EAS85104.1| Hydroxyacylglutathione hydrolase cytoplasmic [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 239

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 92/252 (36%), Positives = 132/252 (52%), Gaps = 15/252 (5%)

Query: 4   LNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTR 63
           + I I    DN+  LI +    +   ID  +   + K L +K   L +I NTHHH DH  
Sbjct: 3   IQI-IRCLQDNYSYLIVDKAKNIACVIDPSEAKPVIKYLEDKNIHLKYILNTHHHYDHVG 61

Query: 64  ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF 123
            N  LK+ +  ++ G   +  +IP ID  + D D +   +   KI   PGHT+GHIC++F
Sbjct: 62  GNKELKEKYGASVIGYKGDKDRIPEIDILVGDQDIWHEENFQAKIFHIPGHTLGHICFYF 121

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            N+  +  GDTLFSLGCG+IFE +Y++M+ SL KIK+  +KT IY GHEYT+ N+ F ++
Sbjct: 122 YNEESVFTGDTLFSLGCGKIFEGTYSQMYNSLMKIKALPEKTKIYCGHEYTKQNSKFCIA 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            D  N  L+     +     +NL T PSTI  E + N FLR                   
Sbjct: 182 HDQDNENLKVKIKLIDEKLEKNLPTIPSTIKEELECNIFLRSGTE--------------E 227

Query: 244 VFTELRIRKNQS 255
            F++LR  K+  
Sbjct: 228 NFSKLRDLKDNF 239


>gi|238759157|ref|ZP_04620325.1| Hydroxyacylglutathione hydrolase [Yersinia aldovae ATCC 35236]
 gi|238702573|gb|EEP95122.1| Hydroxyacylglutathione hydrolase [Yersinia aldovae ATCC 35236]
          Length = 251

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 131/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADSQ-KQCVIVDPGESAPVLAALSQDQYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L + F        +E++     +  +  GD+         IIA PGHT+GHI Y+   
Sbjct: 63  ADLCRHFPNIPVYGPQETADKGATEI-VKGGDSLTINGRNHTIIAVPGHTLGHIAYYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S++++    D T I   HEYT  N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTPEQMYASIQQLAQLPDDTLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  K+  +R++N  + P  + +E+++N FLR  +  L++ + + +  +  ++
Sbjct: 180 PADHDIATYQQKIMQLRAKNQPSLPVKLQIEREINVFLRCNDIDLQRKIGVMSPPDSLIS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|257095466|ref|YP_003169107.1| hydroxyacylglutathione hydrolase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047990|gb|ACV37178.1| hydroxyacylglutathione hydrolase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 253

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/253 (35%), Positives = 124/253 (49%), Gaps = 7/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  L+   K    A +D  D   +  ++  +G  LT I  THHH DH    
Sbjct: 5   IRIPAFKDNYIWLLR--KGASAAVVDPGDARPVLAVIEREGLSLTTILVTHHHADHQGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L       +FGP  ES           +  +    +   ++IA PGHT+GHI Y+   
Sbjct: 63  ADLLARHPAEVFGPAAESITGIKRSLCGGETVSVAGCAADFQVIAVPGHTLGHIAYYG-- 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLF+ GCGR+FE + A+M ESL ++ +  D T +Y  HEYT+ N  FAL+ +
Sbjct: 121 SGCLFCGDTLFAGGCGRLFEGTAAQMLESLARLSALPDDTAVYCAHEYTQANLRFALAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA---SNL 242
           P N  LQ+   +V   R+  L T PSTI++EK  NPFLR     +              L
Sbjct: 181 PGNPRLQRRAEEVAVARAAGLATVPSTIAIEKASNPFLRCREPEVVAAAQRRVPGARDEL 240

Query: 243 AVFTELRIRKNQS 255
           AVF  LR  KN  
Sbjct: 241 AVFAALREWKNTF 253


>gi|260752758|ref|YP_003225651.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552121|gb|ACV75067.1| hydroxyacylglutathione hydrolase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 241

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 94/255 (36%), Positives = 142/255 (55%), Gaps = 14/255 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT   +A+  +  N+  L+H+     T  +D      +   +++KGW +T I+NTH H D
Sbjct: 1   MTIEIVAVPAFETNYIWLLHDRVSDKTVVVDPGQAEPVLDFIQKKGWEVTQIWNTHWHND 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  +K    C + GP  ES  IP ID  + +GD    GS   K++A P HT+GH+ 
Sbjct: 61  HTGGNEVIKAETGCDVIGPSHESHPIPAIDIKVDEGDEIRLGSLVAKVMAIPAHTLGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+  + H L  GDTLF++GCGRIFE +  +M+++L++  +   +T +Y GHEYT++N +F
Sbjct: 121 YYIPDHHVLFCGDTLFAMGCGRIFEGTAEQMWQALQRFAALPPETKVYCGHEYTQDNGHF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ DP N  LQK   +V  +R+Q   T P+TI+LEK  NPF+R +N             
Sbjct: 181 ALTVDPDNQALQKRVKEVDLLRAQGKITLPTTIALEKATNPFMRAKNP------------ 228

Query: 241 NLAVFTELRIRKNQS 255
                 +LR  K+  
Sbjct: 229 --EELAKLRKAKDIF 241


>gi|126667363|ref|ZP_01738335.1| putative hydroxyacylglutathione hydrolase GloB [Marinobacter sp.
           ELB17]
 gi|126628119|gb|EAZ98744.1| putative hydroxyacylglutathione hydrolase GloB [Marinobacter sp.
           ELB17]
          Length = 267

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 123/268 (45%), Gaps = 14/268 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +++ AI  ++DN+   I +        +D      +   L ++G  LT I  THHH D
Sbjct: 1   MLTIS-AIPAFNDNYIWCIADPHRHNALIVDPGQAQPVLDHLAQQGLALTAILITHHHPD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +           S   G  + +  GDT  +       +A PGHT+ HI 
Sbjct: 60  HVGGVKALREAYPDCRIIGP-ADSPFKGSTNPIHPGDTALWEGITFTSMAVPGHTLDHIA 118

Query: 121 YHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
           +   +           GDTLF  GCGR+FE + A+M +SLE ++   D T +Y GHEYT 
Sbjct: 119 FFTDDTAITGRPLLFAGDTLFVSGCGRLFEGAPAQMRQSLESLRQLPDNTAVYCGHEYTL 178

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL- 234
            N  FA S  P +  L ++  + +  R+ N  T PST++ EK++N FLR ++  +     
Sbjct: 179 ANLRFARSWLPQSSALVEFEQQCEQARANNKATVPSTLAEEKRLNLFLRWDDPDVIHVAK 238

Query: 235 ------NMENASNLAVFTELRIRKNQSK 256
                  +   S   VF  +R  K+  +
Sbjct: 239 IYASEHKLPINSPDDVFAAIRHSKDHFR 266


>gi|13435786|gb|AAH04749.1| Hydroxyacyl glutathione hydrolase [Mus musculus]
 gi|18043760|gb|AAH19817.1| Hydroxyacyl glutathione hydrolase [Mus musculus]
          Length = 260

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 116/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + +  ++    LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHHVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 66  LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPG 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 124 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAIRREKDQFK 256


>gi|124267715|ref|YP_001021719.1| hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
 gi|124260490|gb|ABM95484.1| Hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
          Length = 259

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+  ++H+        +D  +   +++ L E+   L  I  THHH DH    
Sbjct: 4   IAVPAFTDNYIWMLHDGVS--AIVVDPGEAAPVTRALDERSLKLAAIVVTHHHGDHVGGV 61

Query: 66  LNLKKF-FNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L+    +            IP     L DGD  +      ++I  PGHT GHI Y   
Sbjct: 62  DALRARLPDGRGPVYGPAREDIPQPFLPLRDGDAIELFGTRFEVIDVPGHTAGHIAYFGQ 121

Query: 125 ND---HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                  L  GDTLFS GCGR+FE + A+M  SL ++ +    T +   HEYT  N  FA
Sbjct: 122 PAGEAPILFCGDTLFSGGCGRLFEGTPAQMHASLSRLAALPGDTRVCCAHEYTLGNLKFA 181

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR---KNLNMEN 238
            + +P N +L  Y ++ +S+R ++L T PST++ E++VNPFLR+ +T +R   +      
Sbjct: 182 CAVEPGNADLIDYVAQCESLRQRDLPTLPSTVARERQVNPFLRVTSTQVRTSARAHGAAG 241

Query: 239 ASNLAVFTELRIRKNQSK 256
              ++V   LR  KN+ +
Sbjct: 242 DDAVSVLAALRQWKNEFR 259


>gi|307132182|ref|YP_003884198.1| putative hydroxyacylglutathione hydrolase [Dickeya dadantii 3937]
 gi|306529711|gb|ADM99641.1| predicted hydroxyacylglutathione hydrolase [Dickeya dadantii 3937]
          Length = 251

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 127/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  + DN+  L+ N + +    +D  +   + + L     F   I  THHH DHT   
Sbjct: 4   ISVPAFKDNYIWLLANDE-KQCVIVDPGEAAPVLQALEYHRLFPAAILLTHHHNDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + +        +E+ K  G+ H + +GD          I   PGHT GHI YH   
Sbjct: 63  RQLAEHYPGIQIYGPQET-KPCGVTHTVQEGDIIAAAGSEFSIFFVPGHTAGHIAYHSHP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +MFESL K+    D+T +   HEYT +N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRIFEGTAQQMFESLIKLADLPDETQVCCAHEYTLSNLEFAHHVW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P + ++  Y  K++ +R +   + PST+  E+++N FLR  +  L++ L  N ++  +  
Sbjct: 180 PEDADIHDYLLKIRQLREKGESSLPSTLGRERRINIFLRYHDIDLQRKLSINTDHKGDWQ 239

Query: 244 VFTELRIRKNQS 255
           +F  LR  K++ 
Sbjct: 240 IFAHLRAMKDRF 251


>gi|212720920|ref|NP_001132380.1| hypothetical protein LOC100193826 [Zea mays]
 gi|194694228|gb|ACF81198.1| unknown [Zea mays]
          Length = 258

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 113/256 (44%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LI +   +  AA+D  +   + K   E G ++  +  THHH DH   N
Sbjct: 4   IPVPCLDDNYAYLIVDESTKKAAAVDPVEPEKVLKAAGEVGAYVDCVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             ++              +     D   +           I  + TP HT GHI Y+   
Sbjct: 64  EKMRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISYYVTS 123

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
               D  +  GDTLF  GCG+ FE S  +M++S +  + S    T +Y GHEYT  N  F
Sbjct: 124 KEGEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVKNLKF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L+ +P N + ++     +  R  N  T PSTI  E ++N F+R++   ++   ++   S
Sbjct: 184 MLTLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSVN--S 241

Query: 241 NLAVFTELRIRKNQSK 256
            +    E+R  K+  +
Sbjct: 242 PVEAMREVRKTKDNWR 257


>gi|325927447|ref|ZP_08188694.1| hydroxyacylglutathione hydrolase [Xanthomonas perforans 91-118]
 gi|325542197|gb|EGD13692.1| hydroxyacylglutathione hydrolase [Xanthomonas perforans 91-118]
          Length = 255

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 123/255 (48%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQHQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +  G+         +++  PGHT  HI +    
Sbjct: 63  AELQQRWPNLALFGPAD-ERIPAHAHQVGQGERLRLLDVEFQVLQVPGHTRSHIAFVA-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D +L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DGYLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +      E +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTGRPEIRAAVAPRAAGELSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + VF ELR  K++ +
Sbjct: 240 VDVFAELRRWKDEFR 254


>gi|148546959|ref|YP_001267061.1| hydroxyacylglutathione hydrolase [Pseudomonas putida F1]
 gi|226724008|sp|A5W167|GLO2_PSEP1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|148511017|gb|ABQ77877.1| Hydroxyacylglutathione hydrolase [Pseudomonas putida F1]
          Length = 259

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 86/262 (32%), Positives = 135/262 (51%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   + + L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHN 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      L++     + GP     +IPG D  L +GD  D      +++A PGHT+GHI
Sbjct: 60  DHVGGVERLRQLTGARVCGPAN--ERIPGRDLALDEGDRVDVLGVTFQVLAVPGHTLGHI 117

Query: 120 CYHFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            +         L  GDTLF+ GCGR+FE +  +M  +L ++ +  ++T +Y  HEYT +N
Sbjct: 118 AFFSDQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTAVYCAHEYTLSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +P N  +Q+    V  +R++N  + PSTI LE+  NPFLR   T +++     
Sbjct: 178 LRFAKAVEPTNPHVQQRFEDVSRLRAENRISLPSTIGLERLTNPFLRTSETLVKQKADEW 237

Query: 235 -NMENASNLAVFTELRIRKNQS 255
               N +++AVF  LR  K+  
Sbjct: 238 KGHSNTTHVAVFAALRSWKDTF 259


>gi|71738038|ref|YP_273947.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123637265|sp|Q48KX8|GLO2_PSE14 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71558591|gb|AAZ37802.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320325373|gb|EFW81440.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327642|gb|EFW83650.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 259

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 134/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLTEHPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATRARVLGPAA--ETIPARDVALVDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA + +P N ++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +    
Sbjct: 180 FAQAVEPDNQDIAQRLAEVIRWRSENRISLPSNLALEKRTNPFLRTRETSVKEKADERSS 239

Query: 237 -ENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|140220|sp|P05446|GLO2_RHOBL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|45973|emb|CAA77309.1| URF 3 [Rhodobacter blasticus]
          Length = 255

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 87/255 (34%), Positives = 131/255 (51%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DNF  L+H+     TA +DAP+   +   L  +GW LT I  THHH D
Sbjct: 1   MALNLLTVPCLKDNFAFLLHDAASGRTALVDAPEAAPVLSALAAQGWRLTDILLTHHHDD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +A   +       + G   ++ ++P +DH L +GD    G+    +I  PGHT GHI 
Sbjct: 61  HIQAVPEIHAATGARVHGAAADAHRLPPLDHALREGDRVAIGAESAVVIDVPGHTRGHIA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF        GD+L + GCGR+FE + AEM+ SL K+ +   +T I  GH+Y + N  F
Sbjct: 121 FHFPGSALAFTGDSLMAAGCGRLFEGTPAEMWASLSKLAALPPETLICSGHDYLDGNLRF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N  L     ++  MR +     P T++ E   NPFLR     ++  + +  AS
Sbjct: 181 ALALEPGNPALISRQGRLSEMRREGRLPMPWTLAEELATNPFLRAPLPQMKAAVGLPQAS 240

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 241 DTVVFAEIRARKDLF 255


>gi|330810143|ref|YP_004354605.1| Hydroxyacylglutathione hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378251|gb|AEA69601.1| Hydroxyacylglutathione hydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 255

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 131/258 (50%), Gaps = 10/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ +H  +  A +D  D   +   L    GW L+ I  THHH DH
Sbjct: 2   IQISALPAFTDNYIWLLQDHATQRCAVVDPGDAAPVQAWLETHPGWVLSDILITHHHHDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK   N T++GP      IP  D  L D DT         + A PGHT+GHI Y
Sbjct: 62  VGGVQALKNATNATVYGPAS--ENIPARDKALHDNDTVSVLGWDFDVYAVPGHTLGHIAY 119

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +      L  GDTLF+ GCGR+FE + A+M  SL ++ +  + T +Y  HEYT +N  FA
Sbjct: 120 YHHG--LLFCGDTLFAAGCGRLFEGTPAQMHHSLSRLAALPEDTLVYCTHEYTLSNLKFA 177

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NME 237
            + +P N ++     KV   RS+ + T PST++LEK  NPFLR   TS+++         
Sbjct: 178 AAVEPGNPDVAARLEKVSRQRSEGIMTLPSTLALEKLTNPFLRTTETSVKQKADERNGQR 237

Query: 238 NASNLAVFTELRIRKNQS 255
           N +   VF  LR  K+  
Sbjct: 238 NQTPSEVFAALRAWKDTF 255


>gi|317490805|ref|ZP_07949241.1| hydroxyacylglutathione hydrolase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920352|gb|EFV41675.1| hydroxyacylglutathione hydrolase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 251

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 84/252 (33%), Positives = 122/252 (48%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D      +   L E       I  THHH DH    
Sbjct: 4   ISIPAMQDNYIWLLANEQ-RECLIVDPGVASPVLHYLTENKLTPKAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + + +        +E+    G    +   D          ++  PGHT+GHI Y+ M 
Sbjct: 63  GEILQNYPDITVYGPQET-VNHGCTQQVQGHDEITVLGLNFSVLDVPGHTLGHIAYYAMP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +M+ SL+ I    D T I   HEYTE+N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRIFEGTPEQMYASLQLIAQLPDNTLICCAHEYTESNLRFARYVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P N E++ Y  +VK +R ++  + PS + +EK++NPFLR  +  L++N+  EN  N    
Sbjct: 180 PENKEIETYQKQVKELRLKHQPSVPSLLKIEKEINPFLRCYDNDLQRNIGFENHPNETWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR  K+  
Sbjct: 240 VFARLRDMKDSF 251


>gi|330889983|gb|EGH22644.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 259

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 132/260 (50%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATRARVLGPAA--ETIPARDIALVDHDLLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +           GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT NN  
Sbjct: 120 YHEGATTPLLFSGDTLFAAGCGRLFEGTPKQMHDSLERLAKLPDSTLIYCAHEYTLNNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V   R++N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAQRLAEVTRWRNENRISLPSNLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|149751043|ref|XP_001497889.1| PREDICTED: similar to hydroxyacylglutathione hydrolase [Equus
           caballus]
          Length = 302

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + + +++ G  LT +  THHH DH   N  
Sbjct: 48  LPALTDNYMYLIIDDDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEK 107

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY     +
Sbjct: 108 LIKLEPGLKVY--GGDDRIGALTHKVAHLSTLQVGSLNVKCLSTPCHTSGHICYFVTKPN 165

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +Y GHEYT NN  FA
Sbjct: 166 SSDPPAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTRVYCGHEYTINNLKFA 225

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  +Q+  +  K   S    T PSTI+ E   NPF+R+   +++++        
Sbjct: 226 RHMEPNNAAIQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAG--ETDP 283

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 284 VTTMRAIRKEKDHFK 298


>gi|115351217|ref|YP_773056.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria AMMD]
 gi|115281205|gb|ABI86722.1| Hydroxyacylglutathione hydrolase [Burkholderia ambifaria AMMD]
          Length = 260

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 82/261 (31%), Positives = 130/261 (49%), Gaps = 15/261 (5%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
             + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH DH      L
Sbjct: 2   PAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHADHVGGVAAL 59

Query: 69  KKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
           +          ++GP  E+  +        D    D  +    ++  PGHT GHI Y   
Sbjct: 60  RDSQPDDAPLVVYGPAAEAIGVVTRPLAGGDRVMLDAPALAFDVLDVPGHTRGHIAYFQA 119

Query: 125 ND-----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    +  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  HEYT +N  
Sbjct: 120 AGVGAATPHVFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCAHEYTLSNIR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-- 237
           FAL+C+P N  L  +    +++R++ + T P+TI+ E+ VNPF+R ++ ++   L  E  
Sbjct: 180 FALACEPGNAALAAWRDDAQALRARGVPTLPTTIAHERAVNPFMRADSAAIHATLEAELH 239

Query: 238 --NASNLAVFTELRIRKNQSK 256
                 LA FT +R  KN+ +
Sbjct: 240 ETVPDRLAAFTLMREWKNRFR 260


>gi|28870869|ref|NP_793488.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|81730266|sp|Q87YS8|GLO2_PSESM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|28854118|gb|AAO57183.1| hydroxyacylglutathione hydrolase, putative [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331019242|gb|EGH99298.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 259

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 136/260 (52%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +    +D  D   + + L +     LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCVVVDPGDAAPVLEWLAQNPHCRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
               + LK+     + GP      IP  D  L+D D          + A PGHT+GHI +
Sbjct: 62  VGGVVELKQATRARVLGPAA--ESIPARDVALADHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M  SLE++ +  D T IY  HEYT +N  
Sbjct: 120 YHEDAAAPLLFSGDTLFAAGCGRLFEGTPGQMHASLERLAALPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V  MRS+N  + PS+++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAERLAQVTLMRSENRISLPSSLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|330939727|gb|EGH43016.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 259

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQLTAARVLGPAA--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATPPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|224070244|ref|XP_002188359.1| PREDICTED: putative hydroxyacyl glutathione hydrolase isoform 2
           [Taeniopygia guttata]
 gi|197127698|gb|ACH44196.1| putative hydroxyacyl glutathione hydrolase [Taeniopygia guttata]
          Length = 260

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/256 (28%), Positives = 118/256 (46%), Gaps = 10/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DN+  L+ +   R  A +D      +   +++ G  LT +  THHH DH   N 
Sbjct: 5   ILPALTDNYMYLLIDQDTREAAIVDPVQPQKVLDAVKKHGVKLTTVLTTHHHWDHAGGNE 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K             S++  +   +S       GS  +K ++TP HT GHICY+    
Sbjct: 65  KLVKMEPGLRVL--GGDSRVGALTQRVSHLTALQVGSLSVKCLSTPCHTSGHICYYVTKP 122

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
           +         GDTLF  GCG+ FE +  EM+++ +E + S   KT +Y GHEYT NN  F
Sbjct: 123 NSSEPPAVFTGDTLFVAGCGKFFEGTPEEMYKALIEILGSLDPKTRVYCGHEYTINNLKF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   +P N  +Q+  +  K+       T PST++ E   NPF+R+   S++ +     + 
Sbjct: 183 ARHVEPGNPNIQEKLAWAKARYDSGEPTIPSTLAEEFTYNPFMRVREKSVQDHAG--ESD 240

Query: 241 NLAVFTELRIRKNQSK 256
            +     +R  K+  +
Sbjct: 241 PVRAMGAIRKEKDNFR 256


>gi|78046643|ref|YP_362818.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|123771464|sp|Q3BWP5|GLO2_XANC5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|78035073|emb|CAJ22718.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 255

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 123/255 (48%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQHQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +  G+         +++  PGHT  HI +    
Sbjct: 63  AELQQRWPDLELFGPAD-ERIPADAHQVGHGERLRLLDVEFQVLQVPGHTRSHIAFVA-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D +L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DGYLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM----ENASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +      E +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTGRPEIRAAVAPRAAGELSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + VF ELR  K++ +
Sbjct: 240 VDVFAELRRWKDEFR 254


>gi|315121775|ref|YP_004062264.1| glyoxalase II [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495177|gb|ADR51776.1| glyoxalase II [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 256

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 196/256 (76%), Positives = 224/256 (87%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  LNIAISLY+DNFCIL+H+ +++LT AID PDT  I +MLREK WFLTHIFNTHHHID
Sbjct: 1   MNKLNIAISLYYDNFCILVHDSQHQLTVAIDTPDTNTILRMLREKNWFLTHIFNTHHHID 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HTR NL+LKK FNCT+FGP  ES +IP IDHGLSDGDT +FG H I + +TPGHT+GHIC
Sbjct: 61  HTRGNLDLKKIFNCTVFGPSIESHQIPKIDHGLSDGDTLNFGQHQINVFSTPGHTMGHIC 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHF+ D+ L VGDTLFSLGCG+IFE ++AEMFESLEKI+SF DKTHIYFGHEYTENNA F
Sbjct: 121 YHFIEDYLLFVGDTLFSLGCGKIFEGNFAEMFESLEKIRSFPDKTHIYFGHEYTENNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALSCDPHNLELQ+YCSKVKS+R++NLYTNPS ISLEKKVNPFLR  +  LRKNL+ME+AS
Sbjct: 181 ALSCDPHNLELQQYCSKVKSLRTKNLYTNPSMISLEKKVNPFLRTRDPILRKNLHMEDAS 240

Query: 241 NLAVFTELRIRKNQSK 256
           NLAVFTELRIRK+Q K
Sbjct: 241 NLAVFTELRIRKDQFK 256


>gi|330897779|gb|EGH29198.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 259

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQLTAARVLGPAA--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|170078470|ref|YP_001735108.1| hydroxyacylglutathione hydrolase [Synechococcus sp. PCC 7002]
 gi|226724034|sp|B1XQ70|GLO2_SYNP2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169886139|gb|ACA99852.1| hydroxyacylglutathione hydrolase [Synechococcus sp. PCC 7002]
          Length = 259

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 10/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  ++DN+  L+ +      A +D  D  ++ + L ++   L  I  THHH DH   N
Sbjct: 4   IRLPAFNDNYIFLLVDRATGDCAVVDPGDAKVVLEYLSKEDLTLKTILITHHHADHVGGN 63

Query: 66  LNLKKFFNCTIFG---PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             L   F            +  +IPG    L  G+  D  +  ++I+  PGHT GHI Y+
Sbjct: 64  RQLLSHFPAAAVYGSEIDLQKRRIPGQTVSLKAGNHLDLFNRTVEILFVPGHTQGHIAYY 123

Query: 123 FMN-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           F          L  GDTLF+ GCGR+ E + A++F SL++I    D T+I+  HEYT  N
Sbjct: 124 FPPLQPEDSGDLFCGDTLFANGCGRLLEGTPAQLFASLQQICDLPDNTNIWCAHEYTLKN 183

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             F+L+ DP N  LQ+   +V++ R +   T P+ ++LEK+ NPFLR  +  L+ NL  +
Sbjct: 184 IKFSLTVDPENEALQRRFQQVQTQRQRQKPTIPTVLALEKQTNPFLRCSDRQLQANL--K 241

Query: 238 NASNLAVFTELRIRKNQS 255
               L VFT+LR +++  
Sbjct: 242 TTDPLRVFTKLRGKRDLF 259


>gi|119775019|ref|YP_927759.1| hydroxyacylglutathione hydrolase [Shewanella amazonensis SB2B]
 gi|226724021|sp|A1S6T3|GLO2_SHEAM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|119767519|gb|ABM00090.1| Hydroxyacylglutathione hydrolase [Shewanella amazonensis SB2B]
          Length = 258

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/262 (28%), Positives = 119/262 (45%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +   I  + DN+  +I          +D  D   +   L+     LT +  THHH D
Sbjct: 1   MLDIR-PIPAFADNYIWMIVLPDGG-AVVVDPGDAMPVINTLQRLNLQLTAVLLTHHHRD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG---SHPIKIIATPGHTIG 117
           H      L+ +            +        L            + P+++++ PGHT+ 
Sbjct: 59  HNGGINQLRDWAKSNGQSFTVYGAVTSDYSDVLCRDGDTVDISGLTSPVRVLSVPGHTLD 118

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           H+ +    D+ L  GDTLFS GCGR+FE    ++++SL K+ S  D T +Y  HEYT +N
Sbjct: 119 HLAFVV--DNALFCGDTLFSGGCGRLFEGDAGQLYDSLAKLASLPDDTLVYCAHEYTLSN 176

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIE----NTSLRKN 233
             FAL+ +P N  LQ Y  +V ++R  N  + PST+  EK +NPFLR++    + ++   
Sbjct: 177 LRFALAVEPQNQCLQDYVKQVNNLREANKPSLPSTLGTEKAINPFLRVDTATVHAAVAAQ 236

Query: 234 LNMENASNLAVFTELRIRKNQS 255
              +    +     LR  K+  
Sbjct: 237 AGQKVPDEVTCLALLRRWKDNF 258


>gi|328789071|ref|XP_623458.3| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           isoform 1 [Apis mellifera]
          Length = 302

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 79/258 (30%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 4   LNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + + I     DN+  LI +   +  A +D  D   ++  +++    LT +  THHH DH 
Sbjct: 48  MKVQILPALQDNYMYLIIDETSQEAAIVDPVDPDTVACAVQQNNVSLTKVLTTHHHWDHA 107

Query: 63  RANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             N+ L K FN           +I  +   +   D F+ G   ++ ++TP HT GHICY+
Sbjct: 108 GGNIKLCKKFNNLQVY--GGDERIEALTCKVKHNDIFNIGKLQVQCLSTPCHTTGHICYY 165

Query: 123 FMNDHF---LCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNA 178
              +     +  GDTLF  GCGR FE +  +M+++ +E + S  ++T +Y GHEYT NN 
Sbjct: 166 ITENQDVPAVFTGDTLFVAGCGRFFEGTAEQMYKALIEILGSLPNETKVYCGHEYTANNL 225

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA   +P N  +++    V+  R +N  + PSTI  EK  NPF+R+   S+  +   + 
Sbjct: 226 KFAKHVEPENEAIRQKIEWVRIQREKNNPSVPSTIQEEKLTNPFMRVHEQSVMDHTEQK- 284

Query: 239 ASNLAVFTELRIRKNQSK 256
              +     LR  K+  K
Sbjct: 285 -DPIQTMAFLRREKDNFK 301


>gi|257051018|sp|O35952|GLO2_RAT RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; AltName:
           Full=Round spermatid protein RSP29; Flags: Precursor
          Length = 309

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 73/262 (27%), Positives = 120/262 (45%), Gaps = 11/262 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  + + +    DN+  LI +   +  A +D      + + +++    LT +  THHH D
Sbjct: 49  MMKIEL-LPALTDNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWD 107

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  L K              +I  + H ++   T + GS  +K ++TP HT GHIC
Sbjct: 108 HAGGNEKLVKLEPGLKVY--GGDDRIGALTHKVTHLSTLEVGSLSVKCLSTPCHTSGHIC 165

Query: 121 YHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYT 174
           Y               GDTLF  GCG+ +E +  EM+++ LE +      T +  GHEYT
Sbjct: 166 YFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVICGHEYT 225

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL 234
            NN  FA   +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++ 
Sbjct: 226 VNNLKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHA 285

Query: 235 NMENASNLAVFTELRIRKNQSK 256
                  +     +R  K+Q K
Sbjct: 286 G--ETDPVTTMRAIRREKDQFK 305


>gi|126335462|ref|XP_001362982.1| PREDICTED: similar to Hagh protein [Monodelphis domestica]
          Length = 309

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + + +++ G  LT +  THHH DH   N  
Sbjct: 55  LPALTDNYMYLIIDEDTKEAAIVDPVQPQKVVETVKKHGVKLTTVLTTHHHWDHAGGNEK 114

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              ++  +   +S   T   GS  +K ++TP HT GHICY     +
Sbjct: 115 LVKMERGLKVY--GGDDRVGALTQKVSHLTTLQVGSLTVKCLSTPCHTSGHICYFVSKPN 172

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +     +T +Y GHEYT NN  FA
Sbjct: 173 SSEPPAVFTGDTLFVAGCGKFYEGTADEMYKALLEILGRLPPETKVYCGHEYTINNLKFA 232

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  +Q+  +  K+       T PSTI+ E   NPF+R+   +++++        
Sbjct: 233 RHVEPNNTAIQEKLAWAKTKYGIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAG--ETDP 290

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 291 VTTMRAIRKEKDNFK 305


>gi|325914920|ref|ZP_08177252.1| hydroxyacylglutathione hydrolase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538813|gb|EGD10477.1| hydroxyacylglutathione hydrolase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 255

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 120/254 (47%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +     R    +D      +      +GW  + +  THHH DH     
Sbjct: 5   ALPAFDDNYIWALVAADGR-AVVVDPGQAEPVIAAAEREGWTPSAVLLTHHHGDHIGGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ +        E+  +IP     +   +         +++A PGHT  HI +    D
Sbjct: 64  ALQQRWPQLELFGPEDQ-RIPADARRVGQNERLRLLGTSFEVLAVPGHTRSHIAFVT--D 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  DP
Sbjct: 121 RHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVDP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASNL 242
            N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +        +S +
Sbjct: 181 TNAALQRRQQEAQAMRQAARPTLPISLKSELATNPFLRTSRPEIRAAVAPRTTGALSSEV 240

Query: 243 AVFTELRIRKNQSK 256
            VF ELR  K++ +
Sbjct: 241 DVFAELRHWKDEFR 254


>gi|145598915|ref|YP_001162991.1| hydroxyacylglutathione hydrolase [Yersinia pestis Pestoides F]
 gi|160395515|sp|A4TL56|GLO2_YERPP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145210611|gb|ABP40018.1| hydroxyacylglutathione hydrolase [Yersinia pestis Pestoides F]
          Length = 251

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 133/252 (52%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANRQ-KHCVIVDPGESAPVLATLAQGQYVPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L+  F        +E++K       ++DGD+         IIA PGHT+GHI Y+   
Sbjct: 63  ADLRHHFPDIPVYGPQETAKKGATVI-VNDGDSLTIAGQNYTIIAVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+ E +  +M+ S++++    D+T I   HEYT +N  FA +  
Sbjct: 120 SPYLFCGDTLFSAGCGRLLEGTPEQMYASIQRLAQLPDETLICCAHEYTLSNLKFAHAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  +++ +RS+NL + P  +  E+K+N FLR  +  L++ +   +  +  ++
Sbjct: 180 PADQDIATYQQQIEQLRSKNLPSLPVKLQFERKINVFLRCNDIDLQRKIETTSPPDSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF ELR RK+  
Sbjct: 240 VFCELRSRKDSF 251


>gi|195619270|gb|ACG31465.1| hydroxyacylglutathione hydrolase [Zea mays]
          Length = 258

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 113/256 (44%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  LI +   +  AA+D  +   + K   E G ++  +  THHH DH   N
Sbjct: 4   IPVPCLDDNYAYLIVDESTKKAAAVDPVEPEKVLKAAGEVGAYVDCVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             ++              +     D   +           I  + TP HT GHI Y+   
Sbjct: 64  EKMRLQVPGIKVFGGSLDNVKGCTDQVENGMKLSLGKDIEILCLHTPCHTKGHISYYVTS 123

Query: 125 ---NDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
               D  +  GDTLF  GCG+ FE S  +M++S +  + S    T +Y GHEYT  N  F
Sbjct: 124 KEGEDPAVFTGDTLFIAGCGKFFEGSAEQMYQSLIVTLGSLPKSTRVYCGHEYTVKNLKF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L+ +P N + ++     +  R  N  T PSTI  E ++N F+R++   ++   ++   S
Sbjct: 184 MLTLEPENEKTKQKLEWAEKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFSVN--S 241

Query: 241 NLAVFTELRIRKNQSK 256
            +    E+R  K+  +
Sbjct: 242 PVEAMIEVRKTKDNWR 257


>gi|117620225|ref|YP_856103.1| hydroxyacylglutathione hydrolase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|160386142|sp|A0KIK2|GLO2_AERHH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|117561632|gb|ABK38580.1| probable hydroxyacylglutathione hydrolase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 254

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 79/254 (31%), Positives = 117/254 (46%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  ++DN+  LI +        +D  D   + + L      L  I  THHH DH    
Sbjct: 5   ITVPAFNDNYIWLIRHE--NHCLVVDPGDAEPVLERLAALDLQLDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   F        +           L DGD  ++    +++I  PGHT GHI Y+   
Sbjct: 63  TALLGHFPHARLYGPKLDPMPAHHGQWLDDGDQINWHGLSLEVIHVPGHTHGHIAYYGHG 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE + A+M  SL+++ +  D T IY  HEYT +N  FA + +
Sbjct: 123 --MLFCGDTLFSAGCGRLFEGTPAQMHASLQRLAALPDDTLIYCAHEYTLSNLRFAYAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SN 241
           P N  +Q+    +  +R Q L + PS +  E++ N FLR E  S++ +          + 
Sbjct: 181 PDNHAIQQRIGLISKLRQQGLPSLPSRLGDEREFNVFLRCEQDSVKFSAEKHALKCLENP 240

Query: 242 LAVFTELRIRKNQS 255
              FT LR  K+  
Sbjct: 241 EDTFTVLRSWKDVF 254


>gi|170722633|ref|YP_001750321.1| hydroxyacylglutathione hydrolase [Pseudomonas putida W619]
 gi|226724010|sp|B1JBN3|GLO2_PSEPW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169760636|gb|ACA73952.1| hydroxyacylglutathione hydrolase [Pseudomonas putida W619]
          Length = 259

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 84/262 (32%), Positives = 127/262 (48%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   +   L     W L  I  THHH 
Sbjct: 1   MIQID-ALPAFSDNYIWLLQDTAKRRCAVVDPGDAAPVEAWLAANPDWVLEDILVTHHHN 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LKK     +      + +IP  D  L +GD         +++A PGHT+GHI
Sbjct: 60  DHVGGVERLKKLTGARV--SGPANERIPCRDLALDEGDEVTAVGVTFQVLAVPGHTLGHI 117

Query: 120 CYHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            +            GDTLF+ GCGR+FE +  +M  +L ++ S  ++T +Y  HEYT +N
Sbjct: 118 AFFSDQPATPVLFSGDTLFAAGCGRMFEGTPEQMQPALARLASLPERTEVYCAHEYTLSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +P N  + +    V  +R+ N  T PSTI LE+  NPFLR   T +++     
Sbjct: 178 LRFAKAVEPQNPHVLQRFDDVTRLRADNRITLPSTIGLERLTNPFLRTSATLVKQKADEW 237

Query: 235 -NMENASNLAVFTELRIRKNQS 255
               N +++AVF  LR  K+  
Sbjct: 238 KGHSNTTHVAVFAALRSWKDTF 259


>gi|187929118|ref|YP_001899605.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
 gi|187726008|gb|ACD27173.1| hydroxyacylglutathione hydrolase [Ralstonia pickettii 12J]
          Length = 279

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 129/266 (48%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+E+G  L  I  THHH DH     
Sbjct: 16  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLKERGLALGAIVITHHHGDHVGGVR 73

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L   +            GP +ES           D  T    +   ++I  PGHT GH+
Sbjct: 74  ELLAAYPENPEGAPLQVIGPADESIPCRTQAVREGDVVTLTQPAATFRVIDVPGHTSGHV 133

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ + +  T +Y  HEYT
Sbjct: 134 AYVGRLQGNAASASLFCGDTLFATGCGRLFEGTPAQMRASLAKLAALAPDTRVYCAHEYT 193

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N +L  +  +V ++R++   T P+T+  E+  NPF+R ++     ++
Sbjct: 194 ASNVRFARAVEPGNADLAAWEDEVAALRAEGRSTVPTTVGHERATNPFMRSDDANVTQAV 253

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  ++    +AVF  LR  KN  +
Sbjct: 254 ARHAGIDADDPVAVFAALRQWKNDFR 279


>gi|171318241|ref|ZP_02907404.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MEX-5]
 gi|171096585|gb|EDT41479.1| hydroxyacylglutathione hydrolase [Burkholderia ambifaria MEX-5]
          Length = 283

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 86/285 (30%), Positives = 136/285 (47%), Gaps = 31/285 (10%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + ++L E+GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFEDNYIWLVSD--GRDAIAVDPGEAAPVRRVLAERGWRLTAILLTHHHA 58

Query: 60  DHTRANLNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH      L+          ++GP  E+  +        D  T D  +    ++  PGHT
Sbjct: 59  DHVGGVAALRDGQPDDAPLGVYGPAAEAIGVVTRPLAGGDRVTLDAPALAFDVLDVPGHT 118

Query: 116 IGHICYHFMND--------------------HFLCVGDTLFSLGCGRIFEDSYAEMFESL 155
            GHI Y                           +  GDTLFS GCGR+FE + A+M  SL
Sbjct: 119 RGHIAYFQAAGAGAAGVGAAGAAKAGQGAATPHVFCGDTLFSCGCGRLFEGTPAQMLASL 178

Query: 156 EKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISL 215
           + + +    T ++  HEYT +N  FAL+C+P N  L  +    +++R++ + T P+TI+ 
Sbjct: 179 DALAALPGDTRVHCAHEYTLSNIRFALACEPGNAALAAWRDDAQALRARGVPTLPTTIAH 238

Query: 216 EKKVNPFLRIENTSLRKNLNME----NASNLAVFTELRIRKNQSK 256
           E+ VNPF+R ++T++   L  E        LA FT +R  KN+ +
Sbjct: 239 ERAVNPFMRADSTAIHATLEAELHERVPDRLAAFTLMREWKNRFR 283


>gi|282900670|ref|ZP_06308612.1| Beta-lactamase-like protein [Cylindrospermopsis raciborskii CS-505]
 gi|281194470|gb|EFA69425.1| Beta-lactamase-like protein [Cylindrospermopsis raciborskii CS-505]
          Length = 257

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 91/256 (35%), Positives = 138/256 (53%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++  + + A +D      + + L E    L  IFNTHHH DH   N
Sbjct: 4   IQLSALSDNYIFLLYDSYHNIAAVVDPAQPEPVMEKLTELQCNLVAIFNTHHHHDHVGGN 63

Query: 66  LNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + F   TI+  +++  +IPG    L   D   FG     ++  PGHT  HI Y+F 
Sbjct: 64  QKLIEKFPQVTIYAGIQDRGRIPGQQVFLQANDIVKFGDRQAIVLFIPGHTRAHIAYYFP 123

Query: 125 N-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE + A+M ESL ++++  D T ++  HEYT NN  
Sbjct: 124 PVTPGETGELFCGDTLFAGGCGRLFEGTPAQMVESLTQLRALPDNTRVWCAHEYTWNNLR 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N ELQK  ++V ++R     T PS + +EK+ NPFLR +  SL+  +N  ++
Sbjct: 184 FALTVDSENQELQKRLTEVTALRQLQQPTVPSLLGIEKQTNPFLRWDQPSLQLAVN--SS 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F ++R  K++ 
Sbjct: 242 DPIQTFAKIRGMKDKY 257


>gi|304320137|ref|YP_003853780.1| hydroxyacylglutathione hydrolase, hypothetical [Parvularcula
           bermudensis HTCC2503]
 gi|303299040|gb|ADM08639.1| hydroxyacylglutathione hydrolase, hypothetical [Parvularcula
           bermudensis HTCC2503]
          Length = 260

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 102/247 (41%), Positives = 145/247 (58%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+ +  LTA +D P    I++ L E+GW L  I NTH H DHT  NL L
Sbjct: 14  PCLSDNYGFLLHDTRTGLTATVDTPQHTAITERLTERGWSLDIILNTHWHFDHTGGNLAL 73

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           KK F C I GP  E  +IPG D  + DGD   FG  P+++I TPGHT GH+ ++F  +  
Sbjct: 74  KKHFGCEIIGPEAEGDRIPGRDRAIKDGDRLTFGESPVEVIGTPGHTKGHVIFYFPEEGI 133

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGDTLFSLGCGR+FE   A+M++SL ++++  + T ++  HEY+  NA FALS    N
Sbjct: 134 AFVGDTLFSLGCGRLFEGDPAQMWQSLSRLRALPEDTVLFCAHEYSAANARFALSLGLDN 193

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L    + + + R ++  T P  +  EK  NPFLR ++ +L   +   NA+   VF E+
Sbjct: 194 SALTARAAAIFAARDRDEPTVPIKLGDEKAANPFLRADDPALAAAIGCPNAAPAEVFGEV 253

Query: 249 RIRKNQS 255
           R RK++ 
Sbjct: 254 RARKDRF 260


>gi|330972575|gb|EGH72641.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 259

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 L++     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELQQSTAARVLGPAA--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPANVDIAERLAEVTRWRSENRISLPSNMALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 AQNTSQSAVFASLRAWKDKF 259


>gi|302187970|ref|ZP_07264643.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           642]
          Length = 259

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 133/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQSTAARVLGPAT--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHADATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFACLRAWKDKF 259


>gi|312960546|ref|ZP_07775052.1| Hydroxyacylglutathione hydrolase [Pseudomonas fluorescens WH6]
 gi|311285072|gb|EFQ63647.1| Hydroxyacylglutathione hydrolase [Pseudomonas fluorescens WH6]
          Length = 255

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 132/258 (51%), Gaps = 10/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ + K    A +D  D   +   L +  GW L+ I  THHH DH
Sbjct: 2   IQISALPAFTDNYIWLLQDPKTHRCAVVDPGDAAPVQAWLEQNPGWTLSDILVTHHHHDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK      ++GP     KIP  D  L D D          + + PGHT+GHI +
Sbjct: 62  VGGVEQLKNITGAKVYGPAN--EKIPARDIALHDHDRITVLGWDFDVHSVPGHTLGHIAF 119

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +      L  GDTLF+ GCGR+FE +  +M  SL ++ +    T +Y  HEYT++N  FA
Sbjct: 120 YH--PGVLFCGDTLFAAGCGRLFEGTPEQMHASLTRLAALPADTLVYCTHEYTQSNLKFA 177

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            + +PHN ++ +    V+ +R+++  T PS ++LE + NPFLR   TS+++  +  N  +
Sbjct: 178 QAVEPHNADIAERMEAVRQLRARDEMTLPSDLALELRTNPFLRTAETSVKQKADERNGHD 237

Query: 242 ----LAVFTELRIRKNQS 255
                 VF  LR  K++ 
Sbjct: 238 NRAGAEVFASLRAWKDKF 255


>gi|85058567|ref|YP_454269.1| putative hydroxyacylglutathione hydrolase [Sodalis glossinidius
           str. 'morsitans']
 gi|123519977|sp|Q2NVG1|GLO2_SODGM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|84779087|dbj|BAE73864.1| putative hydroxyacylglutathione hydrolase [Sodalis glossinidius
           str. 'morsitans']
          Length = 250

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 130/252 (51%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+HN   R    +D  D   + + L +       +  THHH DH    
Sbjct: 4   ISIPALADNYIWLLHNDD-RRCLVVDPGDATPVLQALADHRLTPVAVLLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + F   ++GP E   +  G    +++GD+     H   I+A PGHT+GHI ++   
Sbjct: 63  SELLQHFPVPVYGPEET--RSKGATQIVNEGDSLTLLDHTFSIMALPGHTLGHIGFYS-- 118

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS G GR+FE +  +M+ES +K+   S  T I   HEYT +N  FA +  
Sbjct: 119 APWLFCGDTVFSAGSGRLFEGTPRQMYESFQKVNQLSSATLICAAHEYTLSNLNFAAALL 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-- 243
           P +  +  Y  K+K +R +N  + P+ + LE+++N FLR  + +L+  LN+  A +    
Sbjct: 179 PQDSVITDYQRKIKELRLKNQPSMPTKLHLERQINLFLRCHDVNLQNKLNVHPAPSEEWR 238

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 239 VFAALREKKDHF 250


>gi|196000472|ref|XP_002110104.1| hypothetical protein TRIADDRAFT_20939 [Trichoplax adhaerens]
 gi|190588228|gb|EDV28270.1| hypothetical protein TRIADDRAFT_20939 [Trichoplax adhaerens]
          Length = 260

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 84/255 (32%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+ + K    A +D  +   +   +  +   LT +  THHH DH   N  
Sbjct: 6   IPALQDNYMYLLTDPKTNQAAIVDPVEPEKVLAAVNNRKVDLTTVITTHHHWDHAGGNDK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L                +I  +   LS G+ F+ GS  IK +ATP HT GHICY   + +
Sbjct: 66  LVG-MVSKKLKVYGGDERIGSLTEKLSGGEEFNIGSLVIKSLATPCHTSGHICYFVSDPN 124

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCGR FE + A+M+ +    +      T +Y GHEY+ +N  FA
Sbjct: 125 SQESAVVFTGDTLFVGGCGRFFEGTPAQMYNALCNILGKLPSSTRVYCGHEYSASNLIFA 184

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           +  +P N+++QK    VK  R+  L T PSTI+ E   NPF+R+   ++RK+   +  S 
Sbjct: 185 IHVEPDNVDIQKKLEWVKKQRANRLVTVPSTIAEELSYNPFMRVNTNNVRKHTGKK--SG 242

Query: 242 LAVFTELRIRKNQSK 256
           +     LR  KN  K
Sbjct: 243 IEAMGYLREEKNNFK 257


>gi|162456280|ref|YP_001618647.1| hydroxyacylglutathione hydrolase [Sorangium cellulosum 'So ce 56']
 gi|161166862|emb|CAN98167.1| Hydroxyacylglutathione hydrolase [Sorangium cellulosum 'So ce 56']
          Length = 275

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 115/252 (45%), Gaps = 5/252 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+     R    ID  +   I   L  +   L  I NTHHH DH   N
Sbjct: 28  LPVPCLSDNYAYLVAADGRREAIVIDPSEAQPIIAALEREKLGLVAIVNTHHHHDHVGGN 87

Query: 66  LNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L++ +    ++    +  ++P     + +G         ++ +  PGHT+G     + 
Sbjct: 88  EALRERYGDLPVYAHSSDVGRVPAQTERVEEGTPVQVAGLTLQPLHVPGHTLG--AVSYC 145

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            +  +  GDTLF  GCGR+FE +   M  SL K+ +    T ++ GHEYT NN  FA + 
Sbjct: 146 VEDVVFTGDTLFIAGCGRMFEGTPEVMHASLSKLAALPAHTRVFCGHEYTVNNLRFAEAV 205

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAV 244
           +P N  ++K  +  ++ R +   T  ST++ E   NPFLR    SLR       A+   V
Sbjct: 206 EPENEAVRKKLAAARAARERGEPTVGSTMADELATNPFLRCGEPSLRARF--PGAAPSDV 263

Query: 245 FTELRIRKNQSK 256
           F  +R  K+  +
Sbjct: 264 FAAVRRAKDDYR 275


>gi|71065598|ref|YP_264325.1| hydroxyacylglutathione hydrolase [Psychrobacter arcticus 273-4]
 gi|71038583|gb|AAZ18891.1| probable hydroxyacylglutathione hydrolase [Psychrobacter arcticus
           273-4]
          Length = 259

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 74/261 (28%), Positives = 120/261 (45%), Gaps = 8/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+     I  ++DN+  ++ N   +    ID      +   L E    LT I+ THHH D
Sbjct: 1   MSIRIHPIKAFNDNYIWILINESNKQAIVIDPGQAAPVVAYLEESELELTSIWTTHHHYD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +  T       +      D  + DG T       +++    GHT  H+ 
Sbjct: 61  HIGGVAELQESYPMTHLV--AHTEHNVDEDQTIKDGSTVSAWGCSVQVWDVSGHTASHVA 118

Query: 121 YHFMND--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           Y    D       GDTLFS GCGR+F  +  ++ +S E++      T +Y  HEYT +N 
Sbjct: 119 YILDIDGSKHCFCGDTLFSAGCGRVFTGTIEQLHDSFERLNGLPADTLLYPAHEYTASNL 178

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            F LS +P N  +Q+  ++ + + +Q + T P T+  E+ +N FLR +  S+   +    
Sbjct: 179 RFGLSIEPDNEAMQQALAQAEDITAQGIPTLPVTLEHERAINVFLRTQEASVIAGVKSEM 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
           N+E+  +L +F  LR  KN  
Sbjct: 239 NIEDEKSLTIFAALRELKNNF 259


>gi|157369154|ref|YP_001477143.1| hydroxyacylglutathione hydrolase [Serratia proteamaculans 568]
 gi|166990462|sp|A8GA75|GLO2_SERP5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|157320918|gb|ABV40015.1| Hydroxyacylglutathione hydrolase [Serratia proteamaculans 568]
          Length = 251

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 129/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ +++      +D  +   + + L         I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLL-DNQQGHCIIVDPGEAQPVLETLDRLNLTPDAIVLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   ++       +E++        + DG+T +        IA PGHT+GH+ ++   
Sbjct: 63  AQIVARYSGLKVYGPQETADKGANHI-VHDGETIEINGQKFATIAVPGHTLGHVAFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGR+FE +  +MF S +++    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTIFSAGCGRLFEGTAEQMFNSFQQLAQLPDNTLICCAHEYTLSNLKFARAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P +  ++ Y  +V+++R++   + P+T+ LE+K+N FLR  +T L++ L          +
Sbjct: 180 PKDRHIETYQQQVEALRAKGQSSVPTTLQLERKINLFLRCHDTDLQRELGFHTPPEHLHS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR+RK+  
Sbjct: 240 VFSELRLRKDNF 251


>gi|166710935|ref|ZP_02242142.1| hydroxyacylglutathione hydrolase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 255

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 120/255 (47%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +      +G   + I  THHH DH    
Sbjct: 4   IALPAFEDNYIWALVAADGR-AIIVDPGQAAPVIAAAEREGLVPSAILLTHHHGDHIDGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +S G+     +   ++I  PGHT  HI +    
Sbjct: 63  AELQQRWPGLELFGPAD-ERIPTTAHHVSHGERLSLLAVDFQVIEVPGHTRTHIAFVT-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++     +T +  GHEYT  N  FAL  D
Sbjct: 120 DRHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLACLPGETLVCCGHEYTLANVAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
             N  LQ+   + ++MR     T P ++  E   NPFLR  +  +R  +        +S 
Sbjct: 180 STNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTNSPEIRAVVAARAAGALSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + VF ELR  K++ +
Sbjct: 240 VDVFAELRRWKDEFR 254


>gi|304408607|ref|ZP_07390228.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS183]
 gi|307305435|ref|ZP_07585183.1| hydroxyacylglutathione hydrolase [Shewanella baltica BA175]
 gi|304352428|gb|EFM16825.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS183]
 gi|306911738|gb|EFN42163.1| hydroxyacylglutathione hydrolase [Shewanella baltica BA175]
          Length = 263

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 89/266 (33%), Positives = 134/266 (50%), Gaps = 14/266 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQQTHTQVYVVDPGDASVVIDYLEANKLTLAGILLTHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD----FGSHPIKIIATPGHTI 116
           HT     L+ +    +     ++ KI GI H L+          + S  ++++  PGHT 
Sbjct: 60  HTGGVAELQAYSQDRLTVYGPDNEKIEGITHPLNATAQPRLTLDYMSGELQVLDVPGHTA 119

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y   +   L  GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +
Sbjct: 120 GHIAYVIADA--LFCGDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLS 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN--- 233
           N  FAL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +  +   
Sbjct: 178 NLRFALAVNPNNRALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQ 237

Query: 234 ----LNMENASNLAVFTELRIRKNQS 255
               LN  N   L  FT LR  K+  
Sbjct: 238 HFSDLNHANLDELGGFTLLRQWKDNF 263


>gi|238794446|ref|ZP_04638056.1| Hydroxyacylglutathione hydrolase [Yersinia intermedia ATCC 29909]
 gi|238726241|gb|EEQ17785.1| Hydroxyacylglutathione hydrolase [Yersinia intermedia ATCC 29909]
          Length = 251

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/252 (30%), Positives = 134/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + +    +D  ++  +   + +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLANPQ-KHCVIVDPGESAPVLAAVAQGQYIPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ F        +E++   G    ++ GD    G     IIA PGHT+GHI Y+   
Sbjct: 63  AELRRHFPDIPVYGPQETA-NKGATVIVNGGDHLTIGGQNYTIIAVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDTLFS GCGR+FE +  +M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 120 EPYLFCGDTLFSAGCGRLFEGTPEQMYASIQRLALLPDETLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++ +Y  ++  +R++NL + P  +  E+K+N FLR  +  L++ + + +  +   +
Sbjct: 180 PADEDIARYQQQIMQLRAKNLPSLPVKLQFERKINVFLRCNDIDLQRKIGVISPPSSLAS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|325277449|ref|ZP_08143058.1| hydroxyacylglutathione hydrolase [Pseudomonas sp. TJI-51]
 gi|324097419|gb|EGB95656.1| hydroxyacylglutathione hydrolase [Pseudomonas sp. TJI-51]
          Length = 260

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 85/263 (32%), Positives = 130/263 (49%), Gaps = 11/263 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   + + L    GW L+ I  THHH 
Sbjct: 1   MIQID-ALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPGWALSDILITHHHN 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     +IP  D  L +G   +      +++A PGHT+GHI
Sbjct: 60  DHVGGVARLKQLTGARVCGPAN--EQIPCRDLALDEGAEVEVLGVVFQVLAVPGHTLGHI 117

Query: 120 CYHFMNDHFL---CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            +             GDTLF+ GCGR+FE +  +M  +L ++ +    T +Y  HEYT  
Sbjct: 118 AFFSDQPSETPLLFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPAHTQVYCAHEYTLA 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-- 234
           N  FA + +P N  +Q+   +V  +R+    T PSTI LE+  NPFLR   T +++    
Sbjct: 178 NLRFAKAVEPDNPHVQQRFDEVTRLRADQRITLPSTIGLERLTNPFLRTSETLVKQKADE 237

Query: 235 --NMENASNLAVFTELRIRKNQS 255
                NA+++AVF  LR  K+  
Sbjct: 238 WKGHSNATHVAVFAALRSWKDTF 260


>gi|254294710|ref|YP_003060733.1| hydroxyacylglutathione hydrolase [Hirschia baltica ATCC 49814]
 gi|254043241|gb|ACT60036.1| hydroxyacylglutathione hydrolase [Hirschia baltica ATCC 49814]
          Length = 262

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 141/247 (57%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+  LIH+     T +ID+PD   I  +   KGW +THI NTH H DH   N  ++
Sbjct: 16  CLSDNYGYLIHHPASNSTISIDSPDAETILNIAASKGWNITHILNTHWHADHAGGNAKIQ 75

Query: 70  KFFNCTIFGPLEESSKIPGI-DHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
           +   C IFGP E +S++    D  L+ G+T +FG   I++++TPGHT+ HI Y+      
Sbjct: 76  EATGCRIFGPQEVNSRLQAPLDDVLTGGETLNFGDLSIEVLSTPGHTLEHISYYIPILDA 135

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGDT+F+LGCGR+FE +    + SL+KI++  D T IY  HEYT  N  F  S D  N
Sbjct: 136 AFVGDTMFALGCGRMFEGNPEMFWNSLKKIRALPDTTKIYCAHEYTLANLKFTESIDAEN 195

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
            +L+ Y   ++ +R+    T P+ +  EK+ NPFLR ++T +   LNM+  S + VF  +
Sbjct: 196 EDLKAYAKTLRELRADQQPTIPALLGKEKQTNPFLRADSTQMINLLNMQGKSPIDVFAHI 255

Query: 249 RIRKNQS 255
           R  K+  
Sbjct: 256 RKMKDNF 262


>gi|194290092|ref|YP_002005999.1| hydroxyacylglutathione hydrolase [Cupriavidus taiwanensis LMG
           19424]
 gi|226723985|sp|B3R1Y0|GLO2_CUPTR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|193223927|emb|CAQ69936.1| Hydroxyacylglutathione hydrolase [Cupriavidus taiwanensis LMG
           19424]
          Length = 266

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 123/263 (46%), Gaps = 15/263 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+   IH+      A +D  +   + + L + G  L  I  THHH DH     
Sbjct: 6   PIPAFQDNYIWAIHD--GHCAAVVDPGEAAPVERFLAQSGLALGAIVITHHHGDHQGGVA 63

Query: 67  NLKKFFNCTIFGPL-----EESSKIPGIDHGLSDGDTFDFGSHPIKII--ATPGHTIGHI 119
            L         G           +I G    L +GD     +  + +     PGHT GHI
Sbjct: 64  GLLAAHPRAPSGGPLPVLGPAGERIGGRTQALREGDVATLEAPALTLRVLDVPGHTAGHI 123

Query: 120 CYHFM---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y          L  GDTLF+ GCGR+FE + A+M  SL+K+ +    T +Y  HEYT +
Sbjct: 124 AYVADLGEAGPALFCGDTLFASGCGRLFEGTPAQMLASLDKLAALPGDTRVYCAHEYTRS 183

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P N  L  + ++V+++R+ N  T P+TI+ E++VNPFLR    ++R  ++ 
Sbjct: 184 NVRFARAVEPGNAALAAWEARVEALRATNQPTLPTTIAHERQVNPFLRSREPAVRAAVSA 243

Query: 237 EN---ASNLAVFTELRIRKNQSK 256
                A +   F  LR  K+  +
Sbjct: 244 HGGTAADDAQNFGALRGWKDNFR 266


>gi|268592018|ref|ZP_06126239.1| hydroxyacylglutathione hydrolase [Providencia rettgeri DSM 1131]
 gi|291312410|gb|EFE52863.1| hydroxyacylglutathione hydrolase [Providencia rettgeri DSM 1131]
          Length = 251

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 132/252 (52%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +   +DN+  ++ +  ++    +D  +   + +++  K      I  THHH DHT   
Sbjct: 4   IRVPALNDNYIWVLAD-SHQQCIIVDPAEAEPVLEIITAKRLTPVAILLTHHHNDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   F        +E+ +  G    + +GD        +++I+  GHT  HI ++   
Sbjct: 63  KGILSKFTTLPVFGPKET-QSKGATEIVENGDKVIIDEFNLQVISLSGHTSEHIGFYQ-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +MFES++KI +  D+T I   HEYT +N  FA    
Sbjct: 120 APYLFCGDTLFSAGCGRIFEGTPEQMFESIQKIAALPDETLICCAHEYTLSNLKFAHHIW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P N  + +Y  K+  +R ++  T P+T+ +EKK+N FL+ +N  L+K L  N++N    A
Sbjct: 180 PENEAITQYLQKITQIRDKHQPTVPTTLKIEKKINIFLQCDNPQLQKKLNINLQNPPLRA 239

Query: 244 VFTELRIRKNQS 255
           +FT LR  K+Q 
Sbjct: 240 IFTLLRQLKDQY 251


>gi|312281789|dbj|BAJ33760.1| unnamed protein product [Thellungiella halophila]
          Length = 330

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/256 (34%), Positives = 141/256 (55%), Gaps = 2/256 (0%)

Query: 2   TSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +SL I  +    +N+  L+H+        +D  +   +   L  K W LT+I NTHHH D
Sbjct: 75  SSLKIELVPCSRENYAYLLHDEDTGTVGVVDPSEAAPVIDALSRKNWNLTYILNTHHHED 134

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK+ +   + G   +  +IPGID  L D D + F  H +++I TPGHT GHI 
Sbjct: 135 HIGGNAELKERYGAKVIGSAVDKDRIPGIDILLKDSDEWMFAGHEVRVIDTPGHTQGHIS 194

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           ++F     +  GD ++SL CG + E +  +M  SL+KI +  D T+IY G E T +N  F
Sbjct: 195 FYFPGSAAIFTGDLIYSLSCGTLSEGTPEQMLSSLQKIVALPDDTNIYCGRENTASNLKF 254

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN-A 239
           ALS +P N  L+ Y ++V  +RSQ L + P+T+ +EK  NPFLR  +  +R++L++ + A
Sbjct: 255 ALSVEPKNETLRSYATQVAHLRSQGLPSIPTTVKVEKACNPFLRTSSKDIRRSLSIPDSA 314

Query: 240 SNLAVFTELRIRKNQS 255
           +       +   +++ 
Sbjct: 315 NEAEALHRIHRARDRF 330


>gi|242240259|ref|YP_002988440.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech703]
 gi|242132316|gb|ACS86618.1| hydroxyacylglutathione hydrolase [Dickeya dadantii Ech703]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 123/252 (48%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I++  + DN+  L+          +D  D   +   + ++      I  THHH DHT   
Sbjct: 4   ISVPAFTDNYIWLL--EHENQCVIVDPGDASPVLSAIEKRQLNPAAILLTHHHNDHTGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+ F        EE+ +  G    + +G           + + PGHT GH+ Y+   
Sbjct: 62  TALKERFASIPVYGPEET-RQKGATQIVHEGGVILLLGSEFSVFSVPGHTAGHLAYYS-- 118

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +M+ S+ ++    D+T +   HEYT++N  FA    
Sbjct: 119 APYLFCGDTLFSAGCGRIFEGTPEQMWGSVSRLAQLPDETLVCCAHEYTQSNLEFAHHIW 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--NMENASNLA 243
           P   +++ Y  K++ +R +   + PS + +E+++N FLR  +  L++    NM+  ++  
Sbjct: 179 PEETDIRDYLLKIRQLREKGSPSLPSRLGVERRINIFLRCNDIDLKRKFSNNMDTNTDWQ 238

Query: 244 VFTELRIRKNQS 255
           +F  LR  KNQ 
Sbjct: 239 IFAHLRTMKNQF 250


>gi|66045006|ref|YP_234847.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           B728a]
 gi|75502661|sp|Q4ZVL3|GLO2_PSEU2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|63255713|gb|AAY36809.1| Hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 259

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 134/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQSTAARVLGPAA--ETIPARDIALVDNDRMTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--- 236
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++  +    
Sbjct: 180 FAQAVEPANVDIAERLAEVTRWRSENRISLPSNMALEKRTNPFLRTGETSVKEKADERSD 239

Query: 237 -ENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 AQNTSQSAVFASLRAWKDKF 259


>gi|270263402|ref|ZP_06191671.1| hydroxyacylglutathione hydrolase [Serratia odorifera 4Rx13]
 gi|270042286|gb|EFA15381.1| hydroxyacylglutathione hydrolase [Serratia odorifera 4Rx13]
          Length = 251

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 127/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ +++      +D  +       L         I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLL-DNQQGHCVLVDPGEAQPALDALERLNLKPDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   +        +E++        + DG+T +       +IA PGHT+GH+ ++   
Sbjct: 63  AQIAARYPGLKVYGPQETADKGANHI-VHDGETIEINGRQYAVIAVPGHTLGHVAFYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGR+FE +  +M+ + +++    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTIFSAGCGRLFEGTAEQMYNAFQQLAQLPDNTLICCAHEYTLSNLKFARAIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + E++ Y  +V+++R++   + P+ +  E+K+N FLR  +T L+K L      +   +
Sbjct: 180 PEDREIETYQQQVEALRAKGQPSVPARLQTERKINLFLRCHDTDLQKKLGFYTPPDHLHS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR+RK+  
Sbjct: 240 VFSELRLRKDNF 251


>gi|74317683|ref|YP_315423.1| hydroxyacylglutathione hydrolase [Thiobacillus denitrificans ATCC
           25259]
 gi|123611696|sp|Q3SIB0|GLO2_THIDA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|74057178|gb|AAZ97618.1| hydroxyacylglutathione hydrolase [Thiobacillus denitrificans ATCC
           25259]
          Length = 256

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/259 (31%), Positives = 124/259 (47%), Gaps = 9/259 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L I +  + DN+  + H+   +   A+D  D  ++S  L  +G  L  +  THHH D
Sbjct: 1   MLTL-IPLPAFEDNYIWVWHDA--KYAVAVDPGDPAVLSTYLDSRGLALAAVLVTHHHRD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT  N  L++ +NC I+ P               D          + ++ATPGHT+ H+ 
Sbjct: 58  HTGGNTWLRQRYNCAIYAPDNPRIPAVSHVVRGGDSVAVPELGLALAVLATPGHTLDHVS 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    +  L  GDTLF  GCG++FE   A M  SL+ + +    T +   HEYT +N  F
Sbjct: 118 YVG--NGHLFCGDTLFGCGCGKLFEGDAAMMSASLDALAALPPTTRVCCAHEYTLSNIDF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNM 236
           A + D  N  L +     ++ R+QN  T PST++LE+  NPFLR  +  +R      L  
Sbjct: 176 AKTIDGANPALLERERIDRAARAQNRPTLPSTLALERTTNPFLRFHDADMRAFAVGELGS 235

Query: 237 ENASNLAVFTELRIRKNQS 255
            +     VF  +R  K++ 
Sbjct: 236 PDPGPATVFGAIRAAKDRW 254


>gi|319762431|ref|YP_004126368.1| hydroxyacylglutathione hydrolase [Alicycliphilus denitrificans BC]
 gi|330825718|ref|YP_004389021.1| hydroxyacylglutathione hydrolase [Alicycliphilus denitrificans
           K601]
 gi|317116992|gb|ADU99480.1| hydroxyacylglutathione hydrolase [Alicycliphilus denitrificans BC]
 gi|329311090|gb|AEB85505.1| Hydroxyacylglutathione hydrolase [Alicycliphilus denitrificans
           K601]
          Length = 256

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 118/259 (45%), Gaps = 12/259 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+  ++H+   R    +D  D   + + L   G  L  I  THHH DH    
Sbjct: 2   LPLPAFSDNYIWMLHDA--RHALVVDPGDAAPVLQALHGMGLSLRTILVTHHHGDHVGGV 59

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             L++     I+GP      +P     L  G+          +I  PGHT GHI Y+   
Sbjct: 60  NALREATGAAIYGPAG--EAMPEPITRLRHGEAVTALGLRFAVIDVPGHTAGHIAYYCAD 117

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE + A+M  SL+ + +    T +   HEYT +N  FA 
Sbjct: 118 VDGAPLLFCGDTLFSGGCGRLFEGTPAQMQASLDTLAALPGDTRVCCAHEYTLSNLKFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P N  L +Y    +S+R     T PS +  E+ +NPFLR    ++ +  +  +A   
Sbjct: 178 AVEPGNQALLQYLGHCESLRQAGRPTLPSRMDTERAINPFLRTREATVAQAAHGFDAHVD 237

Query: 240 --SNLAVFTELRIRKNQSK 256
                 V   LR  KN+ +
Sbjct: 238 PREPATVLAALRQWKNEFR 256


>gi|238790136|ref|ZP_04633913.1| Hydroxyacylglutathione hydrolase [Yersinia frederiksenii ATCC
           33641]
 gi|238721805|gb|EEQ13468.1| Hydroxyacylglutathione hydrolase [Yersinia frederiksenii ATCC
           33641]
          Length = 251

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 131/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  + + +  ML +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADSQ-KHCVIVDPGEAHPVLAMLNQGDYLPQAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +        +E++   G    +   D          + A PGHT+GHI Y+   
Sbjct: 63  AELRRHYPNIPVYGPQETA-NKGATVIVKGDDDLVIAGQNYHVFAVPGHTLGHIAYYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTAAQMYSSIQQLAQLPDETLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R++NL + P  + +E+K+N FLR  +  L++ + + +     ++
Sbjct: 180 PSDHDIATYQQQIMQLRAKNLPSLPVKLQIERKINVFLRCNDVDLQRKIGVISPPESLVS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|2459803|gb|AAC39944.1| RSP29 [Rattus norvegicus]
          Length = 260

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 117/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI +   +  A +D      + + +++    LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  + H ++   T + GS  +K ++TP HT GHICY      
Sbjct: 66  LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLEVGSLSVKCLSTPCHTSGHICYFVSKPG 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+++ LE +      T +  GHEYT NN  FA
Sbjct: 124 SSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVICGHEYTVNNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   +    T PST++ E   NPF+R++  +++++        
Sbjct: 184 RHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAIRREKDQFK 256


>gi|126174220|ref|YP_001050369.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS155]
 gi|226724022|sp|A3D437|GLO2_SHEB5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|125997425|gb|ABN61500.1| Hydroxyacylglutathione hydrolase [Shewanella baltica OS155]
          Length = 263

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/266 (33%), Positives = 133/266 (50%), Gaps = 14/266 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLAGILLTHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI----KIIATPGHTI 116
           HT     L+ +    +     ++ KI GI H L+      F    +    +++  PGHT 
Sbjct: 60  HTGGVAELQAYSQNRLTVYGPDNEKIEGITHPLNATAQPRFILDYMSGELQVLDVPGHTA 119

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y   +   L  GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +
Sbjct: 120 GHIAYVIADA--LFCGDTLFSAGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLS 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN--- 233
           N  FAL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +  +   
Sbjct: 178 NLKFALAVNPNNRALQDYNERAVALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQ 237

Query: 234 ----LNMENASNLAVFTELRIRKNQS 255
               LN  N   L  FT LR  K+  
Sbjct: 238 HFSDLNHANLDELGGFTLLRQWKDNF 263


>gi|242015528|ref|XP_002428405.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus
           corporis]
 gi|212513017|gb|EEB15667.1| Hydroxyacylglutathione hydrolase, putative [Pediculus humanus
           corporis]
          Length = 303

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 84/259 (32%), Positives = 122/259 (47%), Gaps = 9/259 (3%)

Query: 3   SLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           ++ I +     DN+  LI + + +    +D      + K + E+   L ++  THHH DH
Sbjct: 48  NMKIKVLPALQDNYMYLIIDVRTKDAGIVDPVAPDTVLKAVSEENVNLKYVLTTHHHWDH 107

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
              N  L K              +I G+   +   DTF  G+   + + TP HT GHICY
Sbjct: 108 AGGNSALIKKLPNLTVLG--GDDRIQGLSKKVGHNDTFHIGNLHGECLFTPCHTSGHICY 165

Query: 122 HFMNDHFL---CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
               D        GDTLF  GCGR FE S  +M+++ +E +    D T ++ GHEYT NN
Sbjct: 166 LIKQDGEPSAVFTGDTLFIAGCGRFFEGSAEQMYKALIEILGQLPDNTLVFCGHEYTLNN 225

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA   +P N  +Q+     +  R  N  T PSTI  EK  NPFLR+  TS++  +   
Sbjct: 226 LSFAKMVEPKNSNIQERIEWAEKKRKLNEPTVPSTIKDEKLTNPFLRVNTTSVQSFVGHS 285

Query: 238 NASNLAVFTELRIRKNQSK 256
           NA  +     LR +K+  K
Sbjct: 286 NA--IDTMRALRAKKDNFK 302


>gi|326929068|ref|XP_003210693.1| PREDICTED: hydroxyacylglutathione hydrolase-like protein-like
           [Meleagris gallopavo]
          Length = 282

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 120/256 (46%), Gaps = 10/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DN+  L+ + + +  A +D      + +++R++   L  I +THHH DH R N 
Sbjct: 5   ILPALTDNYMYLLIDEETKEAAIVDPVQPQKLLEIVRKEDVVLRAILSTHHHWDHARGNE 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L +              +I  + H ++  +   FG+  ++ + TP HT GH+CY    D
Sbjct: 65  ELVRLCPGLRVYGA--DERIGALTHRVAPDEELTFGAIRVRCLFTPCHTSGHVCYFMWED 122

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYF 180
                     GDTLF  GCGR  E +  +M+ +  ++  +   +T ++ GHE T  N  F
Sbjct: 123 GSPDAPALFSGDTLFVGGCGRFLEGTAEQMYANFTQVLGNLPKETKVFCGHECTVRNLKF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL  +P N  ++K  +  +    +++ T PST+  E   NPFLR+   +++K    +   
Sbjct: 183 ALKVEPENEAVKKKLAWARQRDDEDMPTVPSTLQEEFLYNPFLRVTEEAVQKFTGRK--E 240

Query: 241 NLAVFTELRIRKNQSK 256
            + V   LR  K+  K
Sbjct: 241 PVEVLRALRTEKDNFK 256


>gi|321477169|gb|EFX88128.1| hypothetical protein DAPPUDRAFT_96363 [Daphnia pulex]
          Length = 259

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/256 (29%), Positives = 121/256 (47%), Gaps = 10/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I    DN+  L+ +      A +D  +   + +++ ++   LT +  THHH DH   N 
Sbjct: 5   IIPALQDNYMYLLVDESSNEAAIVDPVNPSKVVEIVNQENVKLTTVLTTHHHWDHAGGNE 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K             ++I  ++  +S GD    G+  I+ + TP HT GHICY+  + 
Sbjct: 65  ELVKLVPGLAVY--GGDNRIGALNKKVSHGDKLQVGNLEIQCLFTPCHTSGHICYYLPSS 122

Query: 127 HFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYF 180
                     GDTLF  GCGR FE +  +M+ +L  +  +  D T +Y GHEY+  N  F
Sbjct: 123 SVNGQSAVFTGDTLFQGGCGRFFEGTADQMYHALINVLGALPDDTRVYCGHEYSLQNLAF 182

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L  +P+N  + K  S  +  R ++  T PS +S EK+ NPF+R+   S++ +   +   
Sbjct: 183 GLYVEPNNEFVSKRISWAREQREKSQPTIPSLLSEEKQFNPFMRVHEPSVQSHA--KQTD 240

Query: 241 NLAVFTELRIRKNQSK 256
            +     LR  K+  K
Sbjct: 241 PIETMKSLRTEKDSFK 256


>gi|312795587|ref|YP_004028509.1| Hydroxyacylglutathione hydrolase [Burkholderia rhizoxinica HKI 454]
 gi|312167362|emb|CBW74365.1| Hydroxyacylglutathione hydrolase (EC 3.1.2.6) [Burkholderia
           rhizoxinica HKI 454]
          Length = 280

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 128/263 (48%), Gaps = 14/263 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  +I N      A +D  D   ++  L+ +G  LT I  THHH DH    
Sbjct: 20  IPVPAFEDNYIWVISN--GCDAAVVDPGDAAPVADFLQRQGLRLTAILLTHHHADHVGGV 77

Query: 66  LNLKKFFNCT----IFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
             L +         ++GP  E+ ++        D    +     + +I  PGHT GHI Y
Sbjct: 78  ATLIQTCGAHGAVPVYGPGSETIQVVTDPLAGGDEIRIEPLRLVLSVIDVPGHTRGHIAY 137

Query: 122 H----FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
                      L  GDTLF+ GCGR+FE +  +M  SL+ + +  D T ++  HEYT +N
Sbjct: 138 FAAAGEDPVPHLLCGDTLFASGCGRLFEGTPQQMLASLDALAALPDATEVHCAHEYTLSN 197

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FAL+ +P N +L  +  + + +R+  + T P+T+  EK+VNPFLR    S+R+ L   
Sbjct: 198 IAFALAVEPDNADLLVWRDRAQGLRADGVATVPTTVGHEKRVNPFLRAHLPSIRQQLADK 257

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
            ++  +  L  F  LR  KN  +
Sbjct: 258 RHVHVSGRLDTFAALREWKNVFR 280


>gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040260|gb|ACT57056.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62]
          Length = 256

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 256/256 (100%), Positives = 256/256 (100%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID
Sbjct: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC
Sbjct: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF
Sbjct: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS
Sbjct: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240

Query: 241 NLAVFTELRIRKNQSK 256
           NLAVFTELRIRKNQSK
Sbjct: 241 NLAVFTELRIRKNQSK 256


>gi|153000536|ref|YP_001366217.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS185]
 gi|226724023|sp|A6WMW5|GLO2_SHEB8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|151365154|gb|ABS08154.1| Hydroxyacylglutathione hydrolase [Shewanella baltica OS185]
          Length = 263

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/266 (33%), Positives = 131/266 (49%), Gaps = 14/266 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANKLTLAGILLTHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI----KIIATPGHTI 116
           HT     L+ +    +     ++ KI GI H L       F    +    +++  PGHT 
Sbjct: 60  HTGGVAELQAYSQNRLSVYGPDNEKIEGITHPLHATAQPRFILDYMSGELQVLDVPGHTA 119

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y   +   L  GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +
Sbjct: 120 GHIAYVIADA--LFCGDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTLS 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN--- 233
           N  FAL+ +P+N  LQ Y  +  ++R Q   T PSTI+LE+ +NPFLR  +T +  +   
Sbjct: 178 NLKFALAVNPNNRALQDYNERAIALRRQEKATIPSTIALERAINPFLRASDTEIVDSIKQ 237

Query: 234 ----LNMENASNLAVFTELRIRKNQS 255
               LN  N   L  FT LR  K+  
Sbjct: 238 HFSDLNHANLDELGGFTLLRQWKDNF 263


>gi|308049178|ref|YP_003912744.1| hydroxyacylglutathione hydrolase [Ferrimonas balearica DSM 9799]
 gi|307631368|gb|ADN75670.1| hydroxyacylglutathione hydrolase [Ferrimonas balearica DSM 9799]
          Length = 253

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/256 (28%), Positives = 118/256 (46%), Gaps = 8/256 (3%)

Query: 4   LNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTR 63
           +   I+  +DN+   +H         +D      +   L ++   L  I  THHH DHT 
Sbjct: 2   MITPIAALNDNYIWCLHRD--NAAWVVDPGSADAVLAHLEQQQLQLRGILITHHHWDHTD 59

Query: 64  ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG-SHPIKIIATPGHTIGHICYH 122
               L+  F        +                    G     ++IA PGHT+ H+ Y 
Sbjct: 60  GIETLRNAFAAIPVIGPDNPVIQGLTQRVQHGQQVELDGLGVTAEVIALPGHTLDHLGYC 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              D+ +  GDTLFS GCGR+FE + A+M  SL ++ +    T ++  HEYT  N  FA 
Sbjct: 120 V--DNAVFCGDTLFSGGCGRLFEGTAAQMHSSLSQLAALPADTRVFCTHEYTLANLAFAS 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM---ENA 239
           + +P N  L +Y    ++ R+  L T PSTI  E+ +NPFLR++  +++  L+      +
Sbjct: 178 AVEPDNEALLEYRRWCEAQRAAGLPTLPSTIGQERAINPFLRVDTAAVKAALSQREGTES 237

Query: 240 SNLAVFTELRIRKNQS 255
            ++A F  LR  K++ 
Sbjct: 238 DSVARFAALRHWKDKF 253


>gi|288940187|ref|YP_003442427.1| hydroxyacylglutathione hydrolase [Allochromatium vinosum DSM 180]
 gi|288895559|gb|ADC61395.1| hydroxyacylglutathione hydrolase [Allochromatium vinosum DSM 180]
          Length = 258

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/258 (27%), Positives = 112/258 (43%), Gaps = 9/258 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++   I  + DN+  L+          +D  D   + + L  +   LT +  THHH D
Sbjct: 1   MLAVQ-PIPAFEDNYIWLLT-EGGGNAVVVDPGDAEPVLERLSAEHLTLTAVLITHHHYD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESS-KIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           HT     L   F        ++   +         +       + P +++  PGHT  HI
Sbjct: 59  HTGGLDELLAAFPGLEINGPDDDRIRALTHRRREGETFVPAGLTTPFQVLEVPGHTSSHI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y       L  GDTLF+ GCGR+F+ ++ ++  SLE+I +    T  Y  HEYT+ N  
Sbjct: 119 AYLG--AGRLFCGDTLFAAGCGRVFDGTFEQLAHSLERIAALPVDTLCYCAHEYTQANLG 176

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LN 235
           FA   +P +  L +   + +  R++   T PS + LE+  NPFLR     +         
Sbjct: 177 FAEWVEPDSPALAERVRQTQLQRARGQPTVPSRLDLERATNPFLRTREPKVIAAAERQAG 236

Query: 236 MENASNLAVFTELRIRKN 253
              A++  VFT LR  K+
Sbjct: 237 HRMATSAEVFTALRRWKD 254


>gi|289679438|ref|ZP_06500328.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. syringae
           FF5]
          Length = 259

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 132/260 (50%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQLTAARVLGPAA--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+ +       
Sbjct: 180 FAQAVEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVNEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|298491671|ref|YP_003721848.1| hydroxyacylglutathione hydrolase ['Nostoc azollae' 0708]
 gi|298233589|gb|ADI64725.1| hydroxyacylglutathione hydrolase ['Nostoc azollae' 0708]
          Length = 257

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/256 (34%), Positives = 140/256 (54%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +S   DN+  L+++ +  +   +D  ++  + K L++    L  IFNTHHH DH   N
Sbjct: 4   IRLSALSDNYIFLLYDSQQDIAVVVDPAESEPVLKHLQQIKAKLVAIFNTHHHDDHVGGN 63

Query: 66  LN-LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
              +++F    ++G +E+  +IP     L +GD   F +   K+   PGHT  HI Y+F 
Sbjct: 64  QQLIQEFPELKVYGGIEDQGRIPRQQVFLQEGDHVPFANRTAKVFFVPGHTRAHIAYYFP 123

Query: 125 N-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    L  GDTLF+ GCGR+FE + A+M +SL K+++  D T I+  HEYT NN  
Sbjct: 124 PVTTGDTGELFCGDTLFAGGCGRLFEGTPAQMLDSLSKLRALPDNTRIWCAHEYTLNNLR 183

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FAL+ D  N +L K   +V +MR +   T PS + +EK+ NPFLR +  SL+  L+ ++ 
Sbjct: 184 FALTVDGDNPDLGKRYKEVIAMRKRQEATVPSLLEVEKRTNPFLRWDKPSLQ--LSAKSN 241

Query: 240 SNLAVFTELRIRKNQS 255
             +  F  +R  K++ 
Sbjct: 242 EAVQTFAWIRSMKDKF 257


>gi|225710232|gb|ACO10962.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
          Length = 269

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/261 (32%), Positives = 130/261 (49%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++ + I I   + DN+  +I + K R    +D  D  +++K ++E    LT I  THHH 
Sbjct: 13  LSGMTIEILPAFKDNYMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHHW 72

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  +K               +I G+ H +S GD     S       TP HT GHI
Sbjct: 73  DHAGGN--MKMKEMFPDIKIYGGDDRIDGLTHKVSSGDVIHIDSLQFHCHFTPCHTQGHI 130

Query: 120 CYHFMN-DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
           CYHF   +  +  GDTLF  GCGR FE +  EM ++ +E + S  ++T +Y GHEY+ NN
Sbjct: 131 CYHFSGLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEYSLNN 190

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQN--LYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
             F    +P N  +    +  K  RS++    T PSTI  EK +NPF+R++  S++++  
Sbjct: 191 LRFGAHVEPDNKVISDKIAWCKEKRSRDNPEPTVPSTIGEEKSINPFMRVDVESVQRHT- 249

Query: 236 MENASNLAVFTELRIRKNQSK 256
            + +  +     LR  K+  K
Sbjct: 250 -KTSDPIETMKALRDEKDNFK 269


>gi|322831643|ref|YP_004211670.1| hydroxyacylglutathione hydrolase [Rahnella sp. Y9602]
 gi|321166844|gb|ADW72543.1| hydroxyacylglutathione hydrolase [Rahnella sp. Y9602]
          Length = 251

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 77/252 (30%), Positives = 126/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  ++ + +      +D  +   +   L++     T I  THHH DH    
Sbjct: 4   ISIPALQDNYIWML-DDQQGHCLIVDPGEAAPVLAALKKANLTPTAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   F         E+         L +G+    G    +I ATPGHT+GHI Y+   
Sbjct: 63  DEISSHFPGLKVYGPHETE-NKFSQTSLKNGEKRVIGGLEWQIFATPGHTLGHISYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGR+FE +  +M++S +++ +  D+T +   HEYT +N  FA S  
Sbjct: 120 APYLFCGDTMFSAGCGRLFEGTPEQMYQSFQRLAALPDETLVCAAHEYTLSNLKFARSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P + ++  +  KV+ MR +   + PST+ LE+K+N FLR ++  L+  LN+ +    +  
Sbjct: 180 PEDDDILSHEHKVQQMREKGQSSLPSTLGLERKINLFLRCDDVDLQNKLNLNDPLKPDWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR  K+  
Sbjct: 240 VFAYLRALKDSY 251


>gi|68164579|gb|AAY87308.1| predicted hydroxyacylglutathione hydrolase [uncultured bacterium
           BAC17H8]
          Length = 251

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/255 (40%), Positives = 150/255 (58%), Gaps = 7/255 (2%)

Query: 4   LNIAISLY---HDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +++AI  +    DN+ +L+H+ +   TA IDA D       L   GW LT I+ THHH D
Sbjct: 1   MSLAIDQFTYNQDNYGVLLHDGETGETALIDAGDATAALSALESNGWELTQIWITHHHGD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L    N  IFGP   +     I+  ++DG +FDF    +++IATPGHT+  + 
Sbjct: 61  HTAGLQELVAETNAEIFGPAGVAG----IEQVMADGGSFDFARLKVEVIATPGHTLDMLN 116

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH   +  +  GDTLF++GCGR+FE   A M+ESL+++ +  D T IY GHEYT  NA F
Sbjct: 117 YHLPQEKLVFTGDTLFAMGCGRLFEGDAAMMWESLKRLMALDDDTIIYCGHEYTAANAAF 176

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS DP N+ LQ+    V  +R+    T P+ ++LEK+ NPFLR  +T++R NL + +  
Sbjct: 177 ALSVDPDNVALQRRAEAVAELRAAGAPTVPTIMALEKETNPFLRASDTAIRDNLGLPSVP 236

Query: 241 NLAVFTELRIRKNQS 255
           +  VF E+R RK+  
Sbjct: 237 DEDVFAEIRRRKDSF 251


>gi|289664178|ref|ZP_06485759.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668770|ref|ZP_06489845.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 255

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 119/255 (46%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +      +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALVAADGR-AIIVDPGQAAPVIAAAEREGLIPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP     +  G+         +++  PGHT  HI +    
Sbjct: 63  AELQQRWPDLELFGSAD-ERIPETAQEVGHGERLSLLDVDFQVLEVPGHTRNHIAFVT-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DSHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +        +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTNRPEIRAAVAPRAAGALSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + +F ELR  K++ +
Sbjct: 240 VDIFAELRRWKDEFR 254


>gi|324515767|gb|ADY46309.1| Hydroxyacylglutathione hydrolase [Ascaris suum]
          Length = 256

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 83/253 (32%), Positives = 121/253 (47%), Gaps = 6/253 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +    DN+  L+ +   R  A +D  D   I   ++  G  L+    THHH DH     
Sbjct: 5   PVPALTDNYMYLLIDENTRQAAIVDPVDVPAIRSAVQSAGAELSAALVTHHHWDHAGETA 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L                +I  + + + DGD F  GS  +  + TP HT GHICY+ ++ 
Sbjct: 65  GLSN-SYGNRLAIYGGDDRISKLTNKVKDGDKFKIGSLEVTCLFTPCHTRGHICYYVVDT 123

Query: 127 ---HFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                +  GDTLF  GCGR FE +  EM  +  EK+ S  D T +Y GHEYT  N  FA 
Sbjct: 124 SGKKAVFTGDTLFIGGCGRFFEGNATEMHSALNEKLASLPDDTEVYCGHEYTVTNLRFAH 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
           S +P N E+ K  +  K+ + ++  T PSTI  EK+ NPF+R+  +   + L  ++   +
Sbjct: 184 SVEPSNEEVSKKLAWSKAKQERHEPTVPSTIGEEKRFNPFMRVAVSEELQKL-AKSTDPV 242

Query: 243 AVFTELRIRKNQS 255
           AV   +R  KN  
Sbjct: 243 AVMAVIREMKNNF 255


>gi|254502834|ref|ZP_05114985.1| metallo-beta-lactamase superfamily protein [Labrenzia alexandrii
           DFL-11]
 gi|222438905|gb|EEE45584.1| metallo-beta-lactamase superfamily protein [Labrenzia alexandrii
           DFL-11]
          Length = 260

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/246 (39%), Positives = 131/246 (53%), Gaps = 1/246 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+ +   T A+D PD      +L E GW L+HI  THHH DH +    LK
Sbjct: 14  CLDDNFGVLIHDRESGTTVAVDVPDAAAYEAVLAETGWKLSHILITHHHWDHVQGLGELK 73

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
                 + GP     KI  +D  + DGD    G + +K IATPGHT+  I ++  +    
Sbjct: 74  TKTGAVVIGPERSRQKISELDRTVEDGDDVLCGPYEVKAIATPGHTLDQISWYIPSIKVA 133

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEK-IKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             GDTLF+LGCGR+FE     M+ SL   +    D T IY GHEYTE NA FA++ +P N
Sbjct: 134 HTGDTLFALGCGRVFEGDKEMMWASLSHLMHRLPDDTTIYCGHEYTEANAKFAVTIEPGN 193

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             LQ    ++  +R+    T P+T++ EK  NPFLR    S+   L M      AVF E+
Sbjct: 194 EALQARAKEIADIRALGKPTLPTTMAAEKATNPFLRAGEASVADALGMAGQPAEAVFAEI 253

Query: 249 RIRKNQ 254
           R RK+ 
Sbjct: 254 RTRKDN 259


>gi|53718983|ref|YP_107969.1| putative gultathione hydrolase [Burkholderia pseudomallei K96243]
 gi|76808758|ref|YP_333006.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710b]
 gi|126452658|ref|YP_001065771.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           1106a]
 gi|134282857|ref|ZP_01769560.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|167815233|ref|ZP_02446913.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           91]
 gi|167823641|ref|ZP_02455112.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei 9]
 gi|167845185|ref|ZP_02470693.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           B7210]
 gi|167910429|ref|ZP_02497520.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           112]
 gi|167918454|ref|ZP_02505545.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           BCC215]
 gi|226196229|ref|ZP_03791814.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237811764|ref|YP_002896215.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           MSHR346]
 gi|242315974|ref|ZP_04814990.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106b]
 gi|254188365|ref|ZP_04894876.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198220|ref|ZP_04904642.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|254259838|ref|ZP_04950892.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710a]
 gi|254298050|ref|ZP_04965503.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|52209397|emb|CAH35342.1| putative gultathione hydrolase [Burkholderia pseudomallei K96243]
 gi|76578211|gb|ABA47686.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710b]
 gi|126226300|gb|ABN89840.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106a]
 gi|134245943|gb|EBA46034.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           305]
 gi|157807384|gb|EDO84554.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           406e]
 gi|157936044|gb|EDO91714.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169654961|gb|EDS87654.1| metallo-beta-lactamase family protein [Burkholderia pseudomallei
           S13]
 gi|225931815|gb|EEH27817.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237506133|gb|ACQ98451.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei
           MSHR346]
 gi|242139213|gb|EES25615.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1106b]
 gi|254218527|gb|EET07911.1| hydroxyacylglutathione hydrolase [Burkholderia pseudomallei 1710a]
          Length = 268

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/270 (31%), Positives = 130/270 (48%), Gaps = 16/270 (5%)

Query: 1   MTSLN-IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L  + +  + DN+  L+ +   R   A+D  +   + + L  +GW LT I  THHH 
Sbjct: 1   MNELEYVPVPAFDDNYIWLVSD--GRQAVAVDPGEAAPVRRHLDARGWRLTAILLTHHHR 58

Query: 60  DHTRANLN----LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHT 115
           DH           ++     +FGP  E+ +         +       +    +I  PGHT
Sbjct: 59  DHVGGVAELLAGAREGEPIAVFGPAHEAIEHITRRVAGGERVRIGAPALEFDVIDVPGHT 118

Query: 116 IGHICYHF-----MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFG 170
            GHI Y            L  GDTLFS GCGR+FE + A+M  SL+ + +    T ++  
Sbjct: 119 RGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASLDALAALPGDTRVHCA 178

Query: 171 HEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL 230
           HEYT +N  FAL+C+P N  L  +  + ++ R++   T P+TI+ E  VNPFLR ++ S+
Sbjct: 179 HEYTLSNIQFALACEPGNAALAAWRDEARARRARGEPTLPTTIAHECAVNPFLRADSASI 238

Query: 231 R----KNLNMENASNLAVFTELRIRKNQSK 256
           R      L+      LA FT +R  KN+ +
Sbjct: 239 RATLEARLHEAAPDRLAAFTLMREWKNRFR 268


>gi|330985653|gb|EGH83756.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 259

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 132/260 (50%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L E   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAEHPDYQLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQATRARVLGPAA--ETIPARDIALVDHDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SLE++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPEQMHDSLERLAKLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N ++ +  ++V   RS+N  +  S ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNQDIAQRLAEVTRWRSENRISLTSNLALEKRTNPFLRTRETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|194387612|dbj|BAG61219.1| unnamed protein product [Homo sapiens]
          Length = 308

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 114 LVKLESGPKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 171

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 172 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 231

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 232 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 289

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 290 VTTMRAVRREKDQFK 304


>gi|85374329|ref|YP_458391.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter litoralis
           HTCC2594]
 gi|122544277|sp|Q2N9P7|GLO2_ERYLH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|84787412|gb|ABC63594.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter litoralis
           HTCC2594]
          Length = 251

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 126/247 (51%), Gaps = 3/247 (1%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+     TAAID PD     K  + KGW +THI+NTH H DH   N ++
Sbjct: 8   PCLSDNYGFLLHDPDSGETAAIDTPDGKEYLKQAKAKGWTITHIWNTHWHPDHAGGNKDI 67

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
            +     +    +E  K+ GID  +  GDT D G     +I   GHT GHI YH      
Sbjct: 68  VEATGAKVIA-PQEVEKLSGIDRVVGHGDTVDIGDFTADVIDVSGHTNGHIAYHLPEAGI 126

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD++F+LGCGR+FE    + ++SL +IK+   +T +Y  HEYT  NA FA+  DP N
Sbjct: 127 AFVGDSVFALGCGRMFEGEPKQFWDSLSRIKALPPETMLYCAHEYTAANARFAVHADPEN 186

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             L  Y  ++ + R ++  T P+ +  E   NPFLR ++ +L         +    F  L
Sbjct: 187 DALVAYVEEITAKRERDEPTVPTQLKRELATNPFLRADDPALVAKWG--GDAPHETFAAL 244

Query: 249 RIRKNQS 255
           R  K+  
Sbjct: 245 RAGKDNF 251


>gi|207723986|ref|YP_002254384.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           MolK2]
 gi|206589194|emb|CAQ36156.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           MolK2]
          Length = 275

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 121/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L                GP+ ES           D  T    +    ++  PGHT GH+
Sbjct: 70  ALVDAHPRDPSGAPLPVIGPVGESIPCRTQSVREGDTVTLAHPAAIFHVLDVPGHTRGHV 129

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 130 AYVGRLQGQDAPASLFCGDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCAHEYT 189

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +      S+
Sbjct: 190 ASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTVAASV 249

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +AVF  LR  KN  +
Sbjct: 250 ARHAGIGTDDPVAVFAALREWKNGFR 275


>gi|294627918|ref|ZP_06706497.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292597832|gb|EFF41990.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 255

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 120/255 (47%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +  G+         +++  PGHT  HI +    
Sbjct: 63  AELQQRWPDLELFGPAD-ERIPANAHQVGHGERLRLLDVEFQVLDVPGHTRSHIAFVA-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 AGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +        +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTSRPEIRAAVAPRAAGALSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + VF ELR  K++ +
Sbjct: 240 VDVFAELRRWKDEFR 254


>gi|197284134|ref|YP_002150006.1| hydroxyacylglutathione hydrolase [Proteus mirabilis HI4320]
 gi|194681621|emb|CAR40645.1| putative hydroxyacylglutathione hydrolase [Proteus mirabilis
           HI4320]
          Length = 251

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 121/252 (48%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+ N        +D      +  ++ ++      I  THHH DH    
Sbjct: 4   IRIPALSDNYIWLLSNENS-ECVIVDPSQAKPVIDIISQRSLTPVAILLTHHHEDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +        +E+ +  G +  + D +     S    +I TPGHT+GH+ Y+   
Sbjct: 63  AGLVSKYPNIEVFGPQET-QTKGANKIIHDQEHIIVDSFSFLVIGTPGHTLGHVAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDTLFS GCGR+FE S  +MF SL+K+ +  D T I   HEYT  N  FA    
Sbjct: 120 EPYLFCGDTLFSGGCGRLFEGSAQQMFSSLQKLMALPDNTLICCAHEYTLANLTFAHHIM 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NLA 243
           P N ++  Y +KV  MR     T P T+  EK +N FL+ ++  L++ L + + +   + 
Sbjct: 180 PKNPDITDYLNKVTEMRHHLQPTVPITLKNEKNINLFLKSDDIDLQRILGITSNTYAPIK 239

Query: 244 VFTELRIRKNQS 255
            FT+LR  K+  
Sbjct: 240 TFTKLRELKDNF 251


>gi|114797885|ref|YP_762079.1| putative hydroxyacylglutathione hydrolase [Hyphomonas neptunium
           ATCC 15444]
 gi|122942021|sp|Q0BWR4|GLO2_HYPNA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114738059|gb|ABI76184.1| putative hydroxyacylglutathione hydrolase [Hyphomonas neptunium
           ATCC 15444]
          Length = 256

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 97/258 (37%), Positives = 146/258 (56%), Gaps = 5/258 (1%)

Query: 1   MTSLNIAI---SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHH 57
           M+ L I I      +DN+  L+H      T AID PD  +      +  W ++ I+NTH 
Sbjct: 1   MSVL-IEIHQFPCLNDNYGYLVHEPGSGRTIAIDTPDAAVYLAEAEKMSWTISEIWNTHW 59

Query: 58  HIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           H DH   NL +K+   C I GP  E+ KIPGID  +  GDT + G     +I  PGHT+G
Sbjct: 60  HPDHAGGNLKIKEATGCKIIGPAGEADKIPGIDRRVKGGDTVELGGATATVIDVPGHTLG 119

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           HI +HF +     VGD +F+LGCGR+FE +   M+ESL++IK    KT +Y  HEYT +N
Sbjct: 120 HIAFHFPDQEAAFVGDAVFALGCGRVFEGTMEMMWESLKRIKKLPKKTQLYCAHEYTASN 179

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           A FA++ +P N  L++Y + ++  R+++  T P+ +  E + NPFLR +   ++  +   
Sbjct: 180 AKFAVTIEPENKALKEYVAWIEKRRAEDKPTVPALLERELETNPFLRADLPEMQLAMGHA 239

Query: 238 NASNLAVFTELRIRKNQS 255
             +  A F E+R RK++ 
Sbjct: 240 G-NAAATFGEIRGRKDRF 256


>gi|160875173|ref|YP_001554489.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS195]
 gi|226724024|sp|A9L0E9|GLO2_SHEB9 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|160860695|gb|ABX49229.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS195]
 gi|315267367|gb|ADT94220.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS678]
          Length = 263

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 88/266 (33%), Positives = 131/266 (49%), Gaps = 14/266 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLVGILLTHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI----KIIATPGHTI 116
           HT     L+ +    +     ++ KI GI H L       F    I    +++  PGHT 
Sbjct: 60  HTGGVAELQAYSQDRLTVYGPDNEKIEGITHPLHATAQPRFTLDYISGELQVLDVPGHTA 119

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y   +   L  GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +
Sbjct: 120 GHIAYVIADA--LFCGDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPAYTRVYCAHEYTLS 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FAL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +  ++  
Sbjct: 178 NLKFALAVNPNNCALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVGSIKQ 237

Query: 237 E-------NASNLAVFTELRIRKNQS 255
                   N   L  FT LR  K+  
Sbjct: 238 HFSDLSHANLDELGGFTLLRQWKDNF 263


>gi|21230446|ref|NP_636363.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769560|ref|YP_244322.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992768|ref|YP_001904778.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|81304485|sp|Q4URM1|GLO2_XANC8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81796010|sp|Q8PBY0|GLO2_XANCP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724036|sp|B0RTE9|GLO2_XANCB RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|21112009|gb|AAM40287.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574892|gb|AAY50302.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734528|emb|CAP52738.1| hydroxyacylglutathione hydrolase [Xanthomonas campestris pv.
           campestris]
          Length = 255

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/254 (30%), Positives = 124/254 (48%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +  +  R    +D      + +  + +G+       THHH DH     
Sbjct: 5   ALPAFDDNYIWALVANDGR-AVIVDPGQAAPVLEAAQREGFTPVAALLTHHHADHIGGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ F        ++  ++P     ++ GDT         ++  PGHT  H+ Y    D
Sbjct: 64  ELQQHFPALELYGPDD-ERMPSATRHVAHGDTVTALGIDFAVLEVPGHTRSHVAYVG--D 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE +  +MF++L+++ S   +T +  GHEYT  NA FAL  DP
Sbjct: 121 GHLFSGDTLFSLGCGRMFEGTPPQMFDALQRLASLPGETLVCCGHEYTLANAAFALHVDP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASNL 242
            N  LQ+   + ++MR     T P ++  E   NPFLR+    +R     + ++   S++
Sbjct: 181 TNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRLHTPEIRAAAAAHASISITSDV 240

Query: 243 AVFTELRIRKNQSK 256
            VF ELR  K+  +
Sbjct: 241 DVFAELRRWKDAFR 254


>gi|229365944|gb|ACQ57952.1| Hydroxyacylglutathione hydrolase [Anoplopoma fimbria]
          Length = 260

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ +   R  A +D  +   + + +R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALSDNYMYLLIDVDSREAAVVDPVEPIKVVEAVRKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           + K              ++  I   +S       GS  +K + TP HT GH CY+   D 
Sbjct: 66  MVKLMPGLRVY--GGDDRVDAITKKVSHSHNIKVGSLNVKCLFTPCHTTGHTCYYVTKDK 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  +M ++ ++ +     +T +Y GHEYT +N  FA
Sbjct: 124 STEPPAVFTGDTLFVAGCGKFFEGTAEQMHKALIDILGILPPETRVYCGHEYTVSNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R++  S++ ++  +  + 
Sbjct: 184 RHVEPDNEVIQEKLAWAKEKCSDGEPTVPSTLADEFTFNPFMRVKEKSVQDHV--KQTTP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     LR  K+  +
Sbjct: 242 IETMRSLRKEKDGFR 256


>gi|218892233|ref|YP_002441100.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           LESB58]
 gi|226724006|sp|B7VB64|GLO2_PSEA8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218772459|emb|CAW28241.1| probable hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           LESB58]
          Length = 258

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|257453419|ref|ZP_05618714.1| hydroxyacylglutathione hydrolase [Enhydrobacter aerosaccus SK60]
 gi|257449171|gb|EEV24119.1| hydroxyacylglutathione hydrolase [Enhydrobacter aerosaccus SK60]
          Length = 266

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 68/267 (25%), Positives = 115/267 (43%), Gaps = 13/267 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  ++  I  + DN+   I N + +    +DA D   + + +  +   +T I+ THHH D
Sbjct: 1   MLKIH-PIPAFTDNYIWAIINDETQEVIIVDAGDAEPVLEFVNRENLTITQIWVTHHHSD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF--DFGSHPIKIIATPGHTIGH 118
           H      L   F             +      +   +         P+++    GHT  H
Sbjct: 60  HIGGVTALANAFPNAQIFAHANIHPLINATQLIPVAEGRELTAWDSPVQVWQVAGHTENH 119

Query: 119 ICYHFMNDH--FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTH-IYFGHEYTE 175
           + Y    D+   +  GDTLF  GCGR+F  +   +FES ++     D     Y  HEYT 
Sbjct: 120 LAYLVTLDNRLHIFCGDTLFRAGCGRVFTGTIETLFESFDRFAQLHDDETLFYPAHEYTL 179

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT------- 228
           +N  FA   +P+N  + +  +    +R QN+ T P++++ EK +NPF+R           
Sbjct: 180 SNLNFAQFIEPNNPAIAQAIAHDSELRQQNMPTLPTSLADEKAINPFMRAVIEPSDEMIN 239

Query: 229 SLRKNLNMENASNLAVFTELRIRKNQS 255
           +++    +E+ S   +F  LR  KN  
Sbjct: 240 TVQTQTGIEDDSPFEIFKALRQLKNNF 266


>gi|257051016|sp|Q4R6C1|GLO2_MACFA RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|90082751|dbj|BAE90557.1| unnamed protein product [Macaca fascicularis]
          Length = 308

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVLDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 114 LVKLQSGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSRPG 171

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 172 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 231

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 232 RHVEPGNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHA--RETDP 289

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K++ K
Sbjct: 290 VTTMRAVRKEKDEFK 304


>gi|227358000|ref|ZP_03842342.1| hydroxyacylglutathione hydrolase [Proteus mirabilis ATCC 29906]
 gi|227161735|gb|EEI46767.1| hydroxyacylglutathione hydrolase [Proteus mirabilis ATCC 29906]
          Length = 251

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 120/252 (47%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+ N        +D      +   + ++      I  THHH DH    
Sbjct: 4   IRIPALSDNYIWLLSNENS-ECVIVDPSQAKPVIDTISQRSLTPVAILLTHHHEDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +        +E+ +  G +  + D +     S    +I TPGHT+GH+ Y+   
Sbjct: 63  AGLVSKYPNIEVFGPQET-QTKGANKIIHDQEHIIVDSFSFLVIGTPGHTLGHVAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDTLFS GCGR+FE S  +MF SL+K+ +  D T I   HEYT  N  FA    
Sbjct: 120 EPYLFCGDTLFSGGCGRLFEGSAQQMFSSLQKLMALPDNTLICCAHEYTLANLTFAHHIM 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NLA 243
           P N ++  Y +KV  MR     T P T+  EK +N FL+ ++  L++ L + + +   + 
Sbjct: 180 PKNPDITDYLNKVTEMRHHLQPTVPITLKNEKNINLFLKSDDIDLQRILGITSNTYAPIK 239

Query: 244 VFTELRIRKNQS 255
            FT+LR  K+  
Sbjct: 240 TFTKLRELKDNF 251


>gi|257096631|sp|Q6P963|GLO2_DANRE RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
          Length = 303

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D  +   +   +++ G  L  +  THHH DH   N  
Sbjct: 49  LPALTDNYMYLLIDEETKEAAIVDPVEPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEK 108

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              ++  +   ++  +TF  GS  +K + TP HT GHICY    ++
Sbjct: 109 LVKLMPGLTVY--GGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKEN 166

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+++ +E +     +T +Y GHEYT NN  FA
Sbjct: 167 STEAPAVFTGDTLFVAGCGKFFEGTADEMYKALIEVLGRLPPETRVYCGHEYTINNLKFA 226

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  ++   +  K        T PST++ E   NPF+R+   S+ ++     +  
Sbjct: 227 RHVEPNNEVIRTKLAWAKEKYDNGEPTIPSTVAEEFTFNPFMRVREKSVLEHAG--TSDP 284

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  +
Sbjct: 285 IEAMRSIRKEKDGFR 299


>gi|94538322|ref|NP_005317.2| hydroxyacylglutathione hydrolase, mitochondrial isoform 1 precursor
           [Homo sapiens]
 gi|257051015|sp|Q16775|GLO2_HUMAN RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Glyoxalase II; Short=Glx II; Flags:
           Precursor
 gi|112180342|gb|AAH02627.2| Hydroxyacylglutathione hydrolase [Homo sapiens]
 gi|119606017|gb|EAW85611.1| hydroxyacylglutathione hydrolase, isoform CRA_c [Homo sapiens]
          Length = 308

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 114 LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 171

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 172 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 231

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 232 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 289

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 290 VTTMRAVRREKDQFK 304


>gi|299066484|emb|CBJ37672.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum CMR15]
          Length = 275

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 121/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLVLGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L + +            GP +ES           D       +    ++  PGHT GH+
Sbjct: 70  ALVEAYPRDPSGAPLPVIGPADESIPCRTQAVREGDTVILSHPAATFHVLDVPGHTRGHV 129

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 130 AYVGRLQGPGAPASLFCGDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCAHEYT 189

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R        S+
Sbjct: 190 ASNVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSNEPAVAASV 249

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +AVF  LR  KN  +
Sbjct: 250 ARHAGIGADDPVAVFAALREWKNGFR 275


>gi|21241844|ref|NP_641426.1| hydroxyacylglutathione hydrolase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|81804427|sp|Q8PNI0|GLO2_XANAC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|21107225|gb|AAM35962.1| hydroxyacylglutathione hydrolase [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 255

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 122/255 (47%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALVAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +  G+         ++I  PGHT  HI +    
Sbjct: 63  AELQQRWPDLALFGPAD-ERIPTNAHHVGRGERLRLLDVEFQVIKVPGHTRSHIAFLA-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 DGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLR  +  +R  +        +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTSHPEIRAAVAPRAASALSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + +F ELR  K++ +
Sbjct: 240 VDIFAELRRWKDEFR 254


>gi|294666556|ref|ZP_06731797.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603700|gb|EFF47110.1| hydroxyacylglutathione hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 255

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 121/255 (47%), Gaps = 8/255 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +    + +G   + +  THHH DH    
Sbjct: 4   IALPAFDDNYIWALIAADGR-AIIVDPGQAEPVLAAAQRQGLVPSAVLLTHHHGDHIGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +  G+         +++  PGHT  HI +    
Sbjct: 63  AELQQRWPDLELFGPAD-ERIPANAHQVGHGERLRLLDVEFQVLEVPGHTRSHIAFVA-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  D
Sbjct: 120 AGHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
           P N  LQ+   + ++MR     T P ++  E   NPFLRI    +R  +        +S 
Sbjct: 180 PTNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRISRPEIRAAVAPRAAGALSSE 239

Query: 242 LAVFTELRIRKNQSK 256
           + VF ELR  K++ +
Sbjct: 240 VDVFAELRRWKDEFR 254


>gi|217973498|ref|YP_002358249.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS223]
 gi|254798850|sp|B8E5A2|GLO2_SHEB2 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|217498633|gb|ACK46826.1| hydroxyacylglutathione hydrolase [Shewanella baltica OS223]
          Length = 263

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 89/266 (33%), Positives = 134/266 (50%), Gaps = 14/266 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQQPHTQVYVVDPGDASVVIDYLEANQLTLAGILLTHHHND 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD----FGSHPIKIIATPGHTI 116
           HT     L+ +    +     ++ KI GI H L+          + S  ++++  PGHT 
Sbjct: 60  HTGGVAELQAYSQDRLTVYGPDNEKIEGITHPLNATAQPRLTLDYMSGELQVLDVPGHTA 119

Query: 117 GHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           GHI Y   +   L  GDTLFS GCGR+FE + A+M  SL+++      T +Y  HEYT +
Sbjct: 120 GHIAYVIADA--LFCGDTLFSGGCGRLFEGTPAQMLNSLQQLAQLPADTRVYCAHEYTFS 177

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN--- 233
           N  FAL+ +P+N  LQ Y  +  ++R Q+  T PSTI+LE+ +NPFLR  +T +  +   
Sbjct: 178 NLKFALAVNPNNRALQDYNERAIALRRQDKATIPSTIALERAINPFLRASDTEIVDSIKQ 237

Query: 234 ----LNMENASNLAVFTELRIRKNQS 255
               LN  N   L  FT LR  K+  
Sbjct: 238 HFSDLNHANLDELGGFTLLRQWKDNF 263


>gi|207742896|ref|YP_002259288.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           IPO1609]
 gi|206594291|emb|CAQ61218.1| hydroxyacylglutathione hydrolase protein [Ralstonia solanacearum
           IPO1609]
          Length = 275

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 121/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L                GP+ ES           D  T    +    ++  PGHT GH+
Sbjct: 70  ALVDAHPRDPSGAPLPVIGPVGESIPCRTQSVREGDTVTLAHPAAIFHVLDVPGHTRGHV 129

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 130 AYVGRLQGQDAPASLFCGDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCAHEYT 189

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +      S+
Sbjct: 190 ASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTVAASV 249

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +AVF  LR  KN  +
Sbjct: 250 ARHAGIGMDDPVAVFAALREWKNGFR 275


>gi|83747773|ref|ZP_00944807.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum UW551]
 gi|83725545|gb|EAP72689.1| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum UW551]
          Length = 342

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 121/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 79  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 136

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L                GP+ ES           D  T    +    ++  PGHT GH+
Sbjct: 137 ALVDAHPRDPSGAPLPVIGPVGESIPCRTQSVREGDTVTLAHPAAIFHVLDVPGHTRGHV 196

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 197 AYVGRLQGQDAPASLFCGDTLFATGCGRLFEGTPAQMRRSLSKLAALPPDTRVYCAHEYT 256

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
            +N  FA + +P N+ L  +  +V  +R+    T P+T+  E+  NPF+R +      S+
Sbjct: 257 ASNVRFARAVEPGNIALAAWEDEVAVLRTDGRATVPTTVGHERATNPFMRSDEPTVAASV 316

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +AVF  LR  KN  +
Sbjct: 317 ARHAGIGMDDPVAVFAALREWKNGFR 342


>gi|167644350|ref|YP_001682013.1| hydroxyacylglutathione hydrolase [Caulobacter sp. K31]
 gi|167346780|gb|ABZ69515.1| hydroxyacylglutathione hydrolase [Caulobacter sp. K31]
          Length = 248

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 95/256 (37%), Positives = 130/256 (50%), Gaps = 12/256 (4%)

Query: 4   LNIAI---SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           +++ I       DN+  L+ +     TA ID PD   I   L++ GW L  I NTH H D
Sbjct: 1   MSLTIHQFPCLSDNYGFLVRDDATGTTATIDTPDADAILAELKKLGWKLDLILNTHWHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  ++           +E S+I  +D  +   DT   G   + +I T GHT+GHI 
Sbjct: 61  HAGGNAAIQAA-TGATIVGPQEVSRIAPLDRPVVQDDTVMLGETALSVIDTGGHTLGHIA 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH   DH   VGDTLF+LGCGR+FE +  +M+ SL K+ +  D T +Y  HEYT +NA F
Sbjct: 120 YHDAADHIAFVGDTLFALGCGRLFEGTAEQMWGSLSKLTALPDDTTVYCAHEYTASNARF 179

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS    +  L+   + V + R +   T P+TI LEK  NPFLR     LR +L      
Sbjct: 180 ALSV-DQDPALKSRANAVFAARERGEATVPTTIGLEKATNPFLRA--PLLRPHL-----P 231

Query: 241 NLAVFTELRIRKNQSK 256
               F E+R  K+  K
Sbjct: 232 PAEAFGEIRAAKDSFK 247


>gi|330829018|ref|YP_004391970.1| hydroxyacylglutathione hydrolase [Aeromonas veronii B565]
 gi|328804154|gb|AEB49353.1| Hydroxyacylglutathione hydrolase [Aeromonas veronii B565]
          Length = 254

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 121/254 (47%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  ++DN+  LI +        +D  D   + + L   G  L  I  THHH DH    
Sbjct: 5   ITVPAFNDNYIWLIRHE--NHCLVVDPGDAAPVLERLEALGLVLDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L   F        +           L DGD  ++    +++I  PGHT GHI YH   
Sbjct: 63  TDLLAHFPHARLYGPKLDPMPDHHGQWLEDGDQINWHGLALEVIHVPGHTRGHIAYHG-- 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  L  GDTLFS GCGR+FE +  +M+ SL+++ +  D+T IY  HEYT +N  FA + +
Sbjct: 121 NGMLFCGDTLFSAGCGRLFEGTPEQMYHSLQRLAALPDETLIYCAHEYTLSNLRFAYAVE 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SN 241
           P N  +++    +  +R Q L + P+ +  E+  N FLR E  S++ +          + 
Sbjct: 181 PDNPAIRRQIGLISKLRQQGLPSLPTRLGDERTFNIFLRCEQDSVKFSAEKHGLKCVENP 240

Query: 242 LAVFTELRIRKNQS 255
           +  FT LR  K+  
Sbjct: 241 VDTFTILRQWKDVF 254


>gi|332863511|ref|XP_510739.3| PREDICTED: LOW QUALITY PROTEIN: hydroxyacylglutathione hydrolase,
           mitochondrial, partial [Pan troglodytes]
          Length = 319

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 65  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 124

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 125 LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPR 182

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 183 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 242

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 243 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGK--TDP 300

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 301 VTTMQAVRREKDQFK 315


>gi|285017394|ref|YP_003375105.1| hydroxyacylglutathione hydrolase (glyoxalase II) protein
           [Xanthomonas albilineans GPE PC73]
 gi|283472612|emb|CBA15117.1| probable hydroxyacylglutathione hydrolase (glyoxalase II) protein
           [Xanthomonas albilineans]
          Length = 259

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 120/260 (46%), Gaps = 14/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   I     R    +D      + +   + G     I  THHH DH    
Sbjct: 4   IALPAFQDNYIWSIAADDGR-ALLVDPGQAEPVLEAAAQ-GLQPAAILLTHHHDDHIGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+  +         E  +I    H +  GD+          +A PGHT  H+ Y    
Sbjct: 62  PALRARWPELPVY-APEDPRIDCASHRVGHGDSIQALHWQFDTLAVPGHTRSHLAYVGHG 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFSLGCGR+FE + ++M  SL ++ +   +T +  GHEYT  NA FA+  D
Sbjct: 121 --YLFSGDTLFSLGCGRMFEGTPSQMLASLHRLSALPGETLVCCGHEYTLANAAFAVMVD 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-------- 237
           P N+ L++   +V++MR     T P T++ E   NPFLR  + ++R+ +           
Sbjct: 179 PTNVALRQRHQEVQAMRHAAHPTVPVTLASEVATNPFLRTASPAIRRAVGARLGRAADDA 238

Query: 238 -NASNLAVFTELRIRKNQSK 256
               ++ VF ELR  K+  +
Sbjct: 239 TADEDVDVFAELRRWKDDFR 258


>gi|294950453|ref|XP_002786637.1| hydroxyacylglutathione hydrolase, putative [Perkinsus marinus ATCC
           50983]
 gi|239900929|gb|EER18433.1| hydroxyacylglutathione hydrolase, putative [Perkinsus marinus ATCC
           50983]
          Length = 280

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 130/254 (51%), Gaps = 7/254 (2%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDHTRANL 66
           +    DN+  ++   K      +D P+   +   LR+       +I NTHHH DHT  N 
Sbjct: 28  VPCLKDNYGWILRCPKTGTIGLVDTPEAGPLLSELRKNFNGRADYILNTHHHWDHTGGNN 87

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            +K   +C + G     S+I G+D  +  GD F FG   +++   PGHT GH+ YHF   
Sbjct: 88  EIKAATHCKVIG-PGHDSQIDGLDKAVGGGDEFKFGDLTVRVFDLPGHTHGHVGYHFPEA 146

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
           +    GDTLF LGCGR+FE +  + + +L++I+     T ++  HEY+++NA FA   D 
Sbjct: 147 NAFFCGDTLFVLGCGRMFEGTKNQFWSTLQRIRGLPKDTVMFCAHEYSQSNAKFARYIDS 206

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK-NLNMENASN---- 241
            N  L++    + +MRS+   T PS ++ E   NPFLR++  +++K  L +  +      
Sbjct: 207 SNEYLKQASDVITNMRSRGEATVPSMLADELLCNPFLRVDQEAIQKRALELTGSEPTHDL 266

Query: 242 LAVFTELRIRKNQS 255
             VF  +R  K+  
Sbjct: 267 AEVFARVRSLKDNF 280


>gi|225709962|gb|ACO10827.1| Hydroxyacylglutathione hydrolase [Caligus rogercresseyi]
          Length = 269

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 85/261 (32%), Positives = 129/261 (49%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++ + I I   + DN+  +I + K R    +D  D  +++K ++E    LT I  THHH 
Sbjct: 13  LSGMTIEILPAFKDNYMYMIIDEKSRTAGIVDPADPDLVAKRVKECNLNLTSILTTHHHW 72

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH   N  +K               +I G+ H +S GD     S       TP HT GHI
Sbjct: 73  DHAGGN--MKMKEMFPDIKIYGGDDRIDGLTHKVSSGDVIHIDSLQFHCHFTPCHTQGHI 130

Query: 120 CYHFMN-DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENN 177
           CYHF   +  +  GDTLF  GCGR FE +  EM ++ +E + S  ++T +Y GHEY+ NN
Sbjct: 131 CYHFSGLEPAVFTGDTLFLGGCGRFFEGTAPEMHKNLMETLGSLPNETKVYCGHEYSLNN 190

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQN--LYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
             F    +P N  +    +  K  RS +    T PSTI  EK +NPF+R++  S++++  
Sbjct: 191 LRFGAHVEPDNKVISDKIAWCKGKRSGDNPEPTVPSTIGEEKSINPFMRVDVESVQRHT- 249

Query: 236 MENASNLAVFTELRIRKNQSK 256
            + +  +     LR  K+  K
Sbjct: 250 -KTSDPIETMKALRDEKDNFK 269


>gi|73959572|ref|XP_537013.2| PREDICTED: similar to hydroxyacyl glutathione hydrolase [Canis
           familiaris]
          Length = 309

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 114/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  LI + + +    +D      + + +++ G  LT +  THHH DH   N  
Sbjct: 55  LPALTDNYMYLIIDDETKEAGVVDPVQPQKVVEAVKKHGVRLTTVLTTHHHWDHAGGNEK 114

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I  +   ++   T   GS  +K ++TP HT GHICY     +
Sbjct: 115 LVKLEPGLKVC--GGDDRIGALTQKVTHLSTLQVGSLNVKCLSTPCHTSGHICYFVSKPN 172

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ +E +  EM+ + LE +      T +Y GHEYT N   FA
Sbjct: 173 SSEPPAVFTGDTLFVAGCGKFYEGTADEMYRALLEVLGRLPPDTRVYCGHEYTINTFKFA 232

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PSTI+ E   NPF+R+   +++++        
Sbjct: 233 RHVEPSNAAVQEKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAG--ETDP 290

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 291 VTTMRAIRKEKDHFK 305


>gi|296389796|ref|ZP_06879271.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PAb1]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERIEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|296219290|ref|XP_002755810.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           [Callithrix jacchus]
          Length = 331

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      + +  ++ G  LT +  THHH DH   N  
Sbjct: 77  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVEEAKKHGVKLTTVLTTHHHWDHAGGNEK 136

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L K              +I  + H ++   T   GS  +K ++TP HT GHICY      
Sbjct: 137 LVKLEPGLKVY--GGDDRIGALTHKVTHLSTLQVGSLNVKCLSTPCHTSGHICYFVTKPG 194

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 195 GSQPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 254

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 255 RHVEPGNAAVQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 312

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 313 VPTMRAVRREKDQFK 327


>gi|296101377|ref|YP_003611523.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055836|gb|ADF60574.1| beta-lactamase-like protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 252

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 84/253 (33%), Positives = 130/253 (51%), Gaps = 6/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ +   R    +D  +   + + ++E GW    I  THHH DHT   
Sbjct: 4   ISIPAFEDNYIWVLVDDA-RRCVIVDPGEAAPVLQAIKENGWQPEAILLTHHHHDHTGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+  F   +     E ++  GI   + +G           + ATPGHT+GH+C++   
Sbjct: 63  PELRARFPHLVVYGPAE-AQDKGITQVVEEGKNILIREWEFSVFATPGHTLGHLCFYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M++SL+KI +  D T I   HEYT  N  F+ S  
Sbjct: 122 --YLFCGDTLFSGGCGRLFEGTPTQMYQSLQKINALPDDTVICCAHEYTLGNMKFSASIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           P + E+Q Y  KVK +R++N  T P  +  E+K+N FLR ++  L   +N E        
Sbjct: 180 PEDREIQDYYQKVKELRAKNQKTLPVILKNERKINLFLRTDDIDLINKINQETKLQQPEQ 239

Query: 244 VFTELRIRKNQSK 256
            F  LR +K+  +
Sbjct: 240 RFAWLRSKKDNFR 252


>gi|291616380|ref|YP_003519122.1| GloB [Pantoea ananatis LMG 20103]
 gi|291151410|gb|ADD75994.1| GloB [Pantoea ananatis LMG 20103]
          Length = 273

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 79/256 (30%), Positives = 132/256 (51%), Gaps = 7/256 (2%)

Query: 3   SLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           S+N+  I    DN+   + +        +D  +   + + ++  GW    I  THHH DH
Sbjct: 22  SMNLTSIPALQDNYIWTLTD-DNGKCLIVDPGEAQPVLEKIKANGWQPEAILLTHHHNDH 80

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
           T     L + F        +E++        +S+GD F+      ++IATPGHT+GHI Y
Sbjct: 81  TGGVKTLCEHFPDIAVYGPQETADKGATIR-VSEGDKFNVLGLSFEVIATPGHTLGHISY 139

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +     +L  GDTLFS GCGR+FE +  +MFES +K     + T +   HEYT +N  FA
Sbjct: 140 YS--SPYLFCGDTLFSGGCGRLFEGTPEQMFESFQKFNQLPEDTLVCCAHEYTLSNLKFA 197

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            +  PH+ ++     K+K +R++N  T P+ ++ E+ +N FLR ++  L+  L++++   
Sbjct: 198 AAILPHDPQITAEYHKIKDLRAENRITLPTKLAHERVINLFLRTQDPDLQHALSVDSEVE 257

Query: 242 --LAVFTELRIRKNQS 255
                F  LR +K++ 
Sbjct: 258 PVWKTFAVLREKKDRF 273


>gi|160900329|ref|YP_001565911.1| hydroxyacylglutathione hydrolase [Delftia acidovorans SPH-1]
 gi|160365913|gb|ABX37526.1| hydroxyacylglutathione hydrolase [Delftia acidovorans SPH-1]
 gi|222838903|gb|EEE77254.1| predicted protein [Populus trichocarpa]
          Length = 257

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 76/258 (29%), Positives = 119/258 (46%), Gaps = 12/258 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+  L+++        +D  D   +   LR+    L  I  THHH DH    
Sbjct: 4   LPIPAFSDNYIWLLYDA--GQALVVDPGDAAPVLASLRQLDLQLQGILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF-- 123
             L++     ++GP     ++P     +  GDT      P ++I  PGHT GHI ++   
Sbjct: 62  AQLRQATGAQVWGPAY--EQLPEPVQRVQGGDTVQALGGPWQVIDVPGHTSGHIAFYSTA 119

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLFS GCGR+FE +  +M +SL+ + +  D T +   HEYT +N  FA 
Sbjct: 120 AQAQPVLFCGDTLFSGGCGRLFEGTPQQMQQSLDDLAALPDNTLVCCAHEYTMSNLRFAQ 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN-----LNME 237
           + +P+N  L  Y    +++R     T PS +  E+ +NPFLR   +++          + 
Sbjct: 180 AVEPNNQALAHYQRHCQALREAGRPTLPSLMETERSINPFLRTRESAVAAAAAGFDAQVR 239

Query: 238 NASNLAVFTELRIRKNQS 255
                +V   LR  KN  
Sbjct: 240 QQDPASVLAGLRQWKNVF 257


>gi|15597010|ref|NP_250504.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PAO1]
 gi|313110511|ref|ZP_07796396.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           39016]
 gi|81541212|sp|Q9I2T1|GLO2_PSEAE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|9947798|gb|AAG05202.1|AE004608_1 probable hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           PAO1]
 gi|310882898|gb|EFQ41492.1| putative hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa
           39016]
          Length = 258

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|121607585|ref|YP_995392.1| hydroxyacylglutathione hydrolase [Verminephrobacter eiseniae
           EF01-2]
 gi|121552225|gb|ABM56374.1| Hydroxyacylglutathione hydrolase [Verminephrobacter eiseniae
           EF01-2]
          Length = 258

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 81/259 (31%), Positives = 126/259 (48%), Gaps = 12/259 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN+  ++H+        +D      ++  LR  G  L  I  THHH DH    
Sbjct: 4   LALPAFADNYLWMLHD--GHRAIVVDPGQAAPVADALRRLGLQLQAILVTHHHADHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L+     ++ GP      +P     L+ GDT D     +++I  PGHT GHI Y+   
Sbjct: 62  EALRNATGASVHGPAR--ESVPEPLVRLAQGDTVDVLGLRLEVIDVPGHTAGHIAYYCPQ 119

Query: 126 DHFL---CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                    GDTLFS GCGR+FE + A+M  SL+++ +    T +   HEYT +N  FA 
Sbjct: 120 MDGAPLLFCGDTLFSGGCGRLFEGTPAQMLASLDRLAALPGNTLVCCAHEYTLSNLKFAT 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--- 239
           + +P N  L+ Y     ++R+QN  T PS + LE+++NPFLR+   ++ +     +A   
Sbjct: 180 AVEPDNAALRDYSRHCAALRAQNRPTLPSRMELEREINPFLRVRQAAVIRAAQGHDAQVQ 239

Query: 240 --SNLAVFTELRIRKNQSK 256
               + V   LR  KN  +
Sbjct: 240 ADDAVTVLAALRQWKNGFR 258


>gi|297182971|gb|ADI19118.1| Zn-dependent hydrolases, including glyoxylases [uncultured alpha
           proteobacterium HF0070_34E11]
          Length = 257

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 152/257 (59%), Gaps = 2/257 (0%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+ + I       DN+ IL+H+   + T AIDA D    +K L  +GW L+ I+ THHH 
Sbjct: 1   MSRIEIIQFKYLSDNYGILLHDKHTKKTIAIDAGDEASYNKALDAQGWQLSEIWVTHHHW 60

Query: 60  DHTRANLNLKKFFNCTIFGPLEESS-KIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT     L + + C + GP ++S+  I  +  G+++GD+F F +  +K+I TPGHT+  
Sbjct: 61  DHTDGIQGLYERWQCKVIGPAKDSTVPIAHLSKGITEGDSFLFANSTVKVIHTPGHTLDM 120

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           I ++  +++ L   DTLFSLGCGR+FE     M+ S+ KI +  DKT IY  HEYT+ N 
Sbjct: 121 INFYLPSENILFSADTLFSLGCGRVFEGDMNMMYNSINKILALPDKTTIYCSHEYTQANG 180

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FALS D  N  L    ++V+ + + N  T P+ + LEK+ NPFLR  + S+R  L +++
Sbjct: 181 KFALSVDADNKSLITRINQVEKLVAANKPTIPTILELEKQTNPFLRTSSPSIRNKLGLKD 240

Query: 239 ASNLAVFTELRIRKNQS 255
           AS + VF+ LR  K+  
Sbjct: 241 ASEVEVFSALRTAKDNF 257


>gi|34496709|ref|NP_900924.1| hydroxyacylglutathione hydrolase [Chromobacterium violaceum ATCC
           12472]
 gi|34102564|gb|AAQ58929.1| hydroxyacylglutathione hydrolase [Chromobacterium violaceum ATCC
           12472]
          Length = 260

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 122/260 (46%), Gaps = 12/260 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M S+   +  + DN+  ++   +     A+D  +   + + L ++   L  +  THHH D
Sbjct: 9   MFSIA-PVGAFTDNYIWVLR--EGARAVAVDPGEAAPLLRHLEQEQLRLEAVLITHHHAD 65

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H     ++ + +               G+ H + +GD         +++  PGHT+ H+ 
Sbjct: 66  HCGGLADVLRAWPGIPVYGPAGLP---GVSHPVMEGDAVSLSMGRAEVLEVPGHTLDHLA 122

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y    +  L  GDTLF+ GCGR+FE +  +M  SL+K+      T +Y  HEYT +N  F
Sbjct: 123 YLL--EDALFCGDTLFAAGCGRLFEGTPGQMLASLKKLAGLPPNTKVYPAHEYTLSNLRF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           AL+ D HN  L    S+  ++R + L T PSTI+LE   NPFLR    +LR+ L      
Sbjct: 181 ALAADQHNPILAMRHSRDSALRDRGLPTLPSTIALETASNPFLRSGEPALREALRRRGGQ 240

Query: 237 ENASNLAVFTELRIRKNQSK 256
              S    F  LR  KN  +
Sbjct: 241 PGDSEETCFALLREWKNDFR 260


>gi|120554456|ref|YP_958807.1| hydroxyacylglutathione hydrolase [Marinobacter aquaeolei VT8]
 gi|166990461|sp|A1U0V1|GLO2_MARAV RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|120324305|gb|ABM18620.1| Hydroxyacylglutathione hydrolase [Marinobacter aquaeolei VT8]
          Length = 263

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 73/260 (28%), Positives = 117/260 (45%), Gaps = 12/260 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+   + N +   T  +D      +   L + G+    I  THHH DHT    
Sbjct: 5   PVPAFSDNYIWCLTNLESGKTLIVDPGQAKPVLDYLSDSGFSADTILITHHHPDHTGGVK 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ +         + S   G  + +  GD   +      ++A PGHT+ HI Y+    
Sbjct: 65  ELQQQYPDLRIVGPTD-SPFKGATNTVHAGDEVVWEGITFNVLAVPGHTLDHIAYYSDTQ 123

Query: 127 HFL----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                    GDTLF  GCGR+FE +  +M  SL+ ++   D T +Y  HEYT  N  FA 
Sbjct: 124 VNDKPVLFCGDTLFVCGCGRLFEGTPEQMHTSLQTLRDLPDNTAVYCAHEYTLANLRFAR 183

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL-------N 235
              P +  L ++ +  K +R +   T P+TI  EK++NPFLR ++  + +          
Sbjct: 184 HWLPEDKALAEFENACKDLRERGKPTVPTTIGQEKQLNPFLRWDDAMVIEAAENYSTTHR 243

Query: 236 MENASNLAVFTELRIRKNQS 255
           +   S+ AVF  +R  K+  
Sbjct: 244 LATGSDCAVFAAVRHGKDNF 263


>gi|77458411|ref|YP_347916.1| Beta-lactamase-like [Pseudomonas fluorescens Pf0-1]
 gi|123605042|sp|Q3KE79|GLO2_PSEPF RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|77382414|gb|ABA73927.1| putative hydroxyacylglutathione hydrolase [Pseudomonas fluorescens
           Pf0-1]
          Length = 255

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 128/258 (49%), Gaps = 10/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  + DN+  L+ +H  +  A +D  D   +   L    GW L  I  THHH DH
Sbjct: 2   IQISALPAFTDNYIWLLQDHATQRCAVVDPGDAAPVQAWLDAHPGWVLGDILITHHHHDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LKK    T++GP      IPG D  L D DT         + A PGHT+GHI Y
Sbjct: 62  VGGVETLKKATGATVYGPAS--ENIPGRDVALKDNDTVRVLGWDFDVYAVPGHTLGHIAY 119

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +      L  GDTLF+ GCGR+FE +  +M +SL ++ +  + T +Y  HEYT +N  FA
Sbjct: 120 YHHG--LLFCGDTLFAAGCGRLFEGTPQQMHQSLSRLAALPEDTLVYCTHEYTLSNLKFA 177

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NME 237
            + +P N ++     KV   R   + T PST++LEK  NPFLR     + + +      +
Sbjct: 178 AAVEPDNRDIAARLEKVTRQRENGVMTLPSTLALEKLTNPFLRTGEILVTQKVDERNGPQ 237

Query: 238 NASNLAVFTELRIRKNQS 255
           N +   VF  LR  K+  
Sbjct: 238 NRAPSEVFAALRAWKDTF 255


>gi|330952811|gb|EGH53071.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae Cit 7]
          Length = 258

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 87/259 (33%), Positives = 133/259 (51%), Gaps = 10/259 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A+  ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALPAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQSTAARVLGPAA--ETIPARDVALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATPPLLFSGDTLFAAGCGRLFEGTPQQMHDSLSRLADLPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNVDIAERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQ 254
            +N S  AVF  LR  K++
Sbjct: 240 GQNTSQSAVFASLRAWKDK 258


>gi|107101245|ref|ZP_01365163.1| hypothetical protein PaerPA_01002278 [Pseudomonas aeruginosa PACS2]
          Length = 258

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLATHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNASLRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|145589205|ref|YP_001155802.1| hydroxyacylglutathione hydrolase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047611|gb|ABP34238.1| Hydroxyacylglutathione hydrolase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 269

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 85/267 (31%), Positives = 126/267 (47%), Gaps = 15/267 (5%)

Query: 2   TSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           T L +  I  + DN+   IHN K      +D  D   + + L++ G  LT I  THHH D
Sbjct: 5   TLLQVWPIPAFDDNYIWCIHNGKS--ALVVDPGDAVPVLEYLKQSGLRLTGILITHHHAD 62

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPI--KIIATPGHTIGH 118
           HT   L L       I       S IPG        D  +  S  I  ++   PGHT+ H
Sbjct: 63  HTGGILALLDALGKDIPVIGPAGSNIPGRTQIAKADDKIEITSPRISLQVYEVPGHTLSH 122

Query: 119 ICYHFMN-----DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           I Y         +  L  GDTLF+ GCGR+FE +  +M +SL K  S    T +Y  HEY
Sbjct: 123 IAYFANMQANVVEPMLFCGDTLFASGCGRLFEGTPTQMTQSLAKFASLPKNTLVYCTHEY 182

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FAL+ +P+N+ L  +  + +++R Q L T P+T+  E +VNPF+R +   +   
Sbjct: 183 TLSNIRFALAVEPNNVNLISWDEQARALRDQGLPTLPTTVGQELQVNPFMRCDQAEVIAA 242

Query: 234 LNM-----ENASNLAVFTELRIRKNQS 255
                   + ++   V   +R  K++ 
Sbjct: 243 AKEISNHADLSTPAHVLAVIRAWKDRF 269


>gi|254234907|ref|ZP_04928230.1| hypothetical protein PACG_00782 [Pseudomonas aeruginosa C3719]
 gi|126166838|gb|EAZ52349.1| hypothetical protein PACG_00782 [Pseudomonas aeruginosa C3719]
          Length = 258

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLATHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|238921065|ref|YP_002934580.1| hydroxyacylglutathione hydrolase, [Edwardsiella ictaluri 93-146]
 gi|259492010|sp|C5BEP2|GLO2_EDWI9 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|238870634|gb|ACR70345.1| hydroxyacylglutathione hydrolase, putative [Edwardsiella ictaluri
           93-146]
          Length = 251

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 122/252 (48%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+ N +      +D      +   L E       I  THHH DH    
Sbjct: 4   IGLPTLQDNYIWLLINPQ-HQCLIVDPGVAAPVLHYLTENRITPKAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + + +         E+ +  G    ++D DT       I I+A PGHT+GH+ Y+   
Sbjct: 63  AEIVQAYPEMPVYGPAET-QGQGCTQVVADNDTLSLLGCQISIMALPGHTLGHMAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE S  +MF+SL++I    D T +   HEYTE+N  FA    
Sbjct: 120 APYLFCGDTLFSAGCGRLFEGSAQQMFDSLQRIIQLPDNTLVCCAHEYTESNLRFARHVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P N E++ Y   V  +R++   T PST+ +E ++NPFLR  +  L++N+      N    
Sbjct: 180 PKNREIETYQQHVTILRAKQQPTVPSTLRIEMEINPFLRCYDYDLQRNVGFPTQPNEIWR 239

Query: 244 VFTELRIRKNQS 255
           VF  LR  K+  
Sbjct: 240 VFACLRNMKDSF 251


>gi|109127167|ref|XP_001090907.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform
           2 [Macaca mulatta]
          Length = 308

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GH+CY      
Sbjct: 114 LVKLQSGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHVCYFVSRPG 171

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 172 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 231

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 232 RHVEPGNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHA--RETDP 289

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K++ K
Sbjct: 290 VTTMRAVRKEKDEFK 304


>gi|94538320|ref|NP_001035517.1| hydroxyacylglutathione hydrolase, mitochondrial isoform 2 [Homo
           sapiens]
 gi|6137437|pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site
 gi|6137438|pdb|1QH3|B Chain B, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site
 gi|6137439|pdb|1QH5|A Chain A, Human Glyoxalase Ii With S-(N-Hydroxy-N-
           Bromophenylcarbamoyl)glutathione
 gi|6137440|pdb|1QH5|B Chain B, Human Glyoxalase Ii With S-(N-Hydroxy-N-
           Bromophenylcarbamoyl)glutathione
 gi|14336766|gb|AAK61294.1|AE006639_8 hydroxyacylglutathione hydrolase [Homo sapiens]
 gi|1237213|emb|CAA62483.1| glyoxalase II [Homo sapiens]
 gi|12654065|gb|AAH00840.1| Hydroxyacylglutathione hydrolase [Homo sapiens]
 gi|119606015|gb|EAW85609.1| hydroxyacylglutathione hydrolase, isoform CRA_a [Homo sapiens]
 gi|123980634|gb|ABM82146.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gi|123980636|gb|ABM82147.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gi|123995455|gb|ABM85329.1| hydroxyacylglutathione hydrolase [synthetic construct]
 gi|157928850|gb|ABW03710.1| hydroxyacylglutathione hydrolase [synthetic construct]
          Length = 260

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 66  LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 124 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAVRREKDQFK 256


>gi|67970015|dbj|BAE01354.1| unnamed protein product [Macaca fascicularis]
          Length = 260

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVLDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 66  LVKLQSGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSRPG 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTL   GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 124 GSEPPAVFTGDTLSVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHA--RETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K++ K
Sbjct: 242 VTTMRAVRKEKDEFK 256


>gi|319899513|ref|YP_004159610.1| hydroxyacylglutathione hydrolase [Bartonella clarridgeiae 73]
 gi|319403481|emb|CBI77061.1| hydroxyacylglutathione hydrolase [Bartonella clarridgeiae 73]
          Length = 253

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 159/246 (64%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF  LIH+ K   TAAIDAP+   I  ML++  W L  IF THHH DH  A   LK
Sbjct: 8   CRKDNFGTLIHDKKSGYTAAIDAPEGKSIHNMLKQHNWTLQFIFVTHHHHDHVEALAELK 67

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           K +N TI GP  ES KI  +D+ L   + F FG+H +  ++TPGHT+G + Y+F   + L
Sbjct: 68  KVYNATIIGPEAESKKIALLDYTLQPDENFCFGTHTLAALSTPGHTLGALSYYFPQANLL 127

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLFSLGCGR+FE +  +M  SL+K++   D+T +Y GHEYT+ NA FAL+ DP N 
Sbjct: 128 FAGDTLFSLGCGRLFEGTPLQMLTSLKKLRQLPDETILYCGHEYTKTNALFALTIDPQNR 187

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
           +L +   +V  +R+QN  T P+T+  EK +NPFLR ++T LRKNL MENA++  VF E+R
Sbjct: 188 KLHQRVEEVFLLRAQNAMTLPTTLGQEKDINPFLRWDDTILRKNLAMENATDEEVFAEIR 247

Query: 250 IRKNQS 255
            RK+  
Sbjct: 248 KRKDHF 253


>gi|94311144|ref|YP_584354.1| beta-lactamase-like protein [Cupriavidus metallidurans CH34]
 gi|226724012|sp|Q1LL91|GLO2_RALME RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|93354996|gb|ABF09085.1| hydroxyacylglutathione hydrolase [Cupriavidus metallidurans CH34]
          Length = 266

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 76/263 (28%), Positives = 122/263 (46%), Gaps = 15/263 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+   IH+      A +D  +   + + L ++G  L  I  THHH DH     
Sbjct: 6   PIPAFQDNYIWAIHDGHS--AAVVDPGEAAPVEQFLAQRGLALGAIVITHHHGDHQGGVS 63

Query: 67  NLKKFFNCTIFGPL-----EESSKIPGIDHGLSDGDTFDFGSHPIKII--ATPGHTIGHI 119
           +L         G        +  +I      + +GDT       +       PGHT GH+
Sbjct: 64  DLLARHPSGPNGEPLPVIGPQGERIGHRTQAVREGDTVTLRHPAVTFRVLDVPGHTAGHV 123

Query: 120 CYH---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y          +  GDTLF+ GCGR+FE + A+M  SL+K+ +    T +Y  HEYT +
Sbjct: 124 AYVGDLPGAGPVVFCGDTLFASGCGRLFEGTPAQMLASLDKLAALPGDTRVYCAHEYTRS 183

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA + +P N +L  + ++V  +R     T P+T++ E+ VNPFLR   +++R+ +  
Sbjct: 184 NVRFAQAVEPANPDLAAWAARVDILREAGTPTVPTTVAHERAVNPFLRSRESTVRQAVRA 243

Query: 237 ENAS---NLAVFTELRIRKNQSK 256
           +      + A F  LR  K+  +
Sbjct: 244 QGGDVSGDAAAFGALRGWKDGFR 266


>gi|17546234|ref|NP_519636.1| hydroxyacylglutathione hydrolase [Ralstonia solanacearum GMI1000]
 gi|17428531|emb|CAD15217.1| putative hydroxyacylglutathione hydrolase protein [Ralstonia
           solanacearum GMI1000]
          Length = 284

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 121/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 21  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 78

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L + +            GP +ES           D  T    +    ++  PGHT GH+
Sbjct: 79  ALVEAYPRDPSGAPLPVIGPADESIPCRTQAVREGDTVTLSHPAATFHVLDVPGHTRGHV 138

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 139 AYVGRLQGPDAPASLFCGDTLFATGCGRLFEGTPAQMRLSLSKLAALPPDTRVYCAHEYT 198

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SL 230
             N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R        S+
Sbjct: 199 AANVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSNEPAVAASV 258

Query: 231 RKNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +AVF  LR  KN  +
Sbjct: 259 AQHAGIGVDDPVAVFAALREWKNGFR 284


>gi|194390102|dbj|BAG61813.1| unnamed protein product [Homo sapiens]
          Length = 305

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 111/255 (43%), Gaps = 13/255 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L                +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 114 LVS-----GLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 168

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 169 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 228

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 229 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 286

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 287 VTTMRAVRREKDQFK 301


>gi|300691209|ref|YP_003752204.1| hydroxyacylglutathione hydrolase [Ralstonia solanacearum PSI07]
 gi|299078269|emb|CBJ50917.2| Hydroxyacylglutathione hydrolase [Ralstonia solanacearum PSI07]
          Length = 275

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 122/266 (45%), Gaps = 18/266 (6%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ + DN+   +H+   R+ A +D  D   + + L+ +G  L  I  THHH DH     
Sbjct: 12  AIAAFTDNYIWALHD--GRVAAVVDPGDAQPVLRFLQARGLALGAIVITHHHGDHVGGVQ 69

Query: 67  NLKKFFNCTI-------FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
            L + +            GP  ES           D  T    +    ++  PGHT GH+
Sbjct: 70  ALVEAYPRDPSGAPLPVIGPAGESIPCRTQSVREGDTVTLSHPAATFHVLDVPGHTRGHV 129

Query: 120 CYHFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYT 174
            Y               GDTLF+ GCGR+FE + A+M  SL K+ +    T +Y  HEYT
Sbjct: 130 AYVGRLQGPDARASLFCGDTLFATGCGRLFEGTPAQMRLSLSKLAALPPDTRVYCAHEYT 189

Query: 175 ENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR--- 231
            +N  FA + +P N  L  +  +V S+R+    T P+T+  E+  NPF+R +  ++    
Sbjct: 190 ASNVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHERATNPFMRSDEPAVVASV 249

Query: 232 -KNLNMENASNLAVFTELRIRKNQSK 256
            ++  +     +A+F  LR  KN  +
Sbjct: 250 ARHAGIGTDDPVALFAALREWKNGFR 275


>gi|158261333|dbj|BAF82844.1| unnamed protein product [Homo sapiens]
          Length = 260

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 117/255 (45%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 66  LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +  EM E+ LE +      T +Y GHEYT NN  FA
Sbjct: 124 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCEALLEVLGRLPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +++  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VTTMRAVRREKDQFK 256


>gi|149184782|ref|ZP_01863100.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp.
           SD-21]
 gi|148832102|gb|EDL50535.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp.
           SD-21]
          Length = 251

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 126/247 (51%), Gaps = 3/247 (1%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+H+     TAAID PD+    +    K W +T I+NTH H DH   N  +
Sbjct: 8   PCLSDNYGFLLHDPDSGETAAIDTPDSAEYLRQAEAKRWTITQIWNTHWHPDHAGGNKAI 67

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
            +     +     E  K+  ID  + +GDT   G    ++I   GHT GHI YH      
Sbjct: 68  VEATGAKVVA-PHEVEKLSPIDEVVGNGDTVSLGEWKARVIDVSGHTNGHIAYHIAEADT 126

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD++F+LGCGR+FE    + + SLE+I+   D T +Y  HEYT+ NA FAL  DP N
Sbjct: 127 AFVGDSVFALGCGRMFEGKPEQFWHSLERIRQLPDNTLLYCAHEYTQANAKFALHADPDN 186

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
            EL+ Y  +++  R+++  T P+ +S E   NPFLR ++  +R        +    F  L
Sbjct: 187 AELRLYAGRIEEKRAKDEPTVPTLLSRELVTNPFLRADDADIRDRWG--GTTPAETFAAL 244

Query: 249 RIRKNQS 255
           R  K+  
Sbjct: 245 RAAKDNF 251


>gi|330975088|gb|EGH75154.1| hydroxyacylglutathione hydrolase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 259

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 134/260 (51%), Gaps = 10/260 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHIDH 61
           + I A++ ++DN+  L+ +   +  A +D  D   +   L +   + LT I  THHH DH
Sbjct: 2   IQIHALAAFNDNYIWLLQDLSSQQCAVVDPGDAKPVLGWLAQNPDYRLTDILITHHHNDH 61

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                 LK+     + GP      IP  D  L D D          + A PGHT+GHI +
Sbjct: 62  VGGVAELKQLTAARVLGPAA--ETIPARDIALVDNDRLTVLGLEFVVHAVPGHTLGHIAF 119

Query: 122 HFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           +  +        GDTLF+ GCGR+FE +  +M +SL ++    D T IY  HEYT +N  
Sbjct: 120 YHEDATTPLLFSGDTLFAAGCGRLFEGTPQQMHDSLGRLAELPDSTLIYCAHEYTLSNLR 179

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----N 235
           FA + +P N+++ +  ++V   RS+N  + PS ++LEK+ NPFLR   TS+++       
Sbjct: 180 FAQAVEPDNVDIGERLAEVTRWRSENRISLPSNLALEKRTNPFLRTGETSVKEKADERSG 239

Query: 236 MENASNLAVFTELRIRKNQS 255
            +N S  AVF  LR  K++ 
Sbjct: 240 GQNTSQSAVFASLRAWKDKF 259


>gi|114321143|ref|YP_742826.1| hydroxyacylglutathione hydrolase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311280|sp|Q0A751|GLO2_ALHEH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114227537|gb|ABI57336.1| Hydroxyacylglutathione hydrolase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 256

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 121/258 (46%), Gaps = 7/258 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MT + +AI  + DN+  L  +   RL A +D  D   +   LR  G  L+ I  THHH D
Sbjct: 1   MTEI-VAIPAFADNYIWLAVDRNRRLAAVVDPGDAEPVEAALRASGLRLSAILITHHHHD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L       ++GP +ES           D         P++++  PGHT GHI 
Sbjct: 60  HTGGVEELLAAHPVPVYGPADESVPGVSQPLREPDAFEVPGLGLPLRVLDVPGHTAGHIA 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                D  L  GD LF+ GCGR+FE +  +M+ SL K+ +  + T +Y GHEYT  N  F
Sbjct: 120 LV--ADGALFSGDALFAGGCGRLFEGTPEQMYASLGKLAALPEATRVYCGHEYTLANLRF 177

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NM 236
           A   +P N  L +   + ++ R +   T PS ++ E   NPFLR    ++R         
Sbjct: 178 AHQVEPDNPNLTQRLRQAEAARQRGEPTVPSRMADEHATNPFLRAHLPAVRTAAERWSGQ 237

Query: 237 ENASNLAVFTELRIRKNQ 254
                +AVF  LR  K+Q
Sbjct: 238 TLDEPVAVFAALRRWKDQ 255


>gi|206580021|ref|YP_002240305.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae 342]
 gi|226724001|sp|B5Y1G4|GLO2_KLEP3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|206569079|gb|ACI10855.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae 342]
          Length = 251

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 129/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ +        +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVL-SENNGRCIIVDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ F   +     E+ +  G+   L DGD      H   I +TPGHT+GHICY+   
Sbjct: 63  KQLREKFPSIVVYGPAET-QDKGVTQVLGDGDRLSILGHDFSIFSTPGHTLGHICYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS  
Sbjct: 120 EPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++A
Sbjct: 180 PDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINQETNLQHSVA 239

Query: 244 VFTELRIRKNQS 255
            F  LR +K+  
Sbjct: 240 RFAWLRSKKDDF 251


>gi|152968802|ref|YP_001333911.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893205|ref|YP_002917939.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae NTUH-K2044]
 gi|262044053|ref|ZP_06017133.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330005758|ref|ZP_08305370.1| hydroxyacylglutathione hydrolase [Klebsiella sp. MS 92-3]
 gi|166990459|sp|A6T510|GLO2_KLEP7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|150953651|gb|ABR75681.1| probable hydroxyacylglutathione hydrolase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238545521|dbj|BAH61872.1| probable hydroxyacylglutathione hydrolase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259038625|gb|EEW39816.1| hydroxyacylglutathione hydrolase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328536126|gb|EGF62514.1| hydroxyacylglutathione hydrolase [Klebsiella sp. MS 92-3]
          Length = 251

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 129/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ +        +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVL-SENNGRCIIVDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ F   +     E+ +  G+   + DGD      H   I +TPGHT+GHICY+   
Sbjct: 63  KQLREKFPSIVVYGPAET-QDKGVTQVVGDGDRLSILGHDFSIFSTPGHTLGHICYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS  
Sbjct: 120 EPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++A
Sbjct: 180 PDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINKETNLQHSVA 239

Query: 244 VFTELRIRKNQS 255
            F  LR +K+  
Sbjct: 240 RFAWLRSKKDDF 251


>gi|288937010|ref|YP_003441069.1| hydroxyacylglutathione hydrolase [Klebsiella variicola At-22]
 gi|290509926|ref|ZP_06549296.1| hydroxyacylglutathione hydrolase [Klebsiella sp. 1_1_55]
 gi|288891719|gb|ADC60037.1| hydroxyacylglutathione hydrolase [Klebsiella variicola At-22]
 gi|289776642|gb|EFD84640.1| hydroxyacylglutathione hydrolase [Klebsiella sp. 1_1_55]
          Length = 251

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 129/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  ++ +        +D  +   +   + E  W    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWVL-SENNGRCIIVDPGEAAPVLAAIEENQWQPEAILLTHHHQDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ F   +     E+ +  G+   + DGD      H   I +TPGHT+GHICY+   
Sbjct: 63  KQLREKFPSIVVYGPAET-QDKGVTQVVGDGDRLSILGHDFSIFSTPGHTLGHICYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDT+FS GCGR+FE +  +M++S  KI +  ++T I   HEYT  N  FALS  
Sbjct: 120 EPYLFCGDTMFSGGCGRLFEGTAEQMYQSFMKINALPEETLICCAHEYTLANMKFALSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P + ++  Y  KV  +R++   T P T+  E+++N FLR+ +  L   +N E     ++A
Sbjct: 180 PDDRDINDYYHKVNELRAKKQKTLPVTLKNERRINLFLRVNDIDLIDKINQETNLQHSVA 239

Query: 244 VFTELRIRKNQS 255
            F  LR +K+  
Sbjct: 240 RFAWLRSKKDDF 251


>gi|254496528|ref|ZP_05109399.1| hydroxyacylglutathione hydrolase GloB [Legionella drancourtii
           LLAP12]
 gi|254354267|gb|EET12931.1| hydroxyacylglutathione hydrolase GloB [Legionella drancourtii
           LLAP12]
          Length = 254

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/254 (31%), Positives = 127/254 (50%), Gaps = 6/254 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I  + DN+  +I +    +   +D  D   + + ++     L  I  THHH DH    
Sbjct: 4   IPIPAFTDNYIWVILDKDAGVFDCVDPGDAEPVLQFMQAHQLKLRSILLTHHHHDHIGGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K     +        +IP I+H + +  T   G H  +I+  PGHT  HI Y+  +
Sbjct: 64  GTLIKHVPTCLVYGP-HDPRIPYINHPVKEHQTIHVGRHTFQILFNPGHTSSHISYYEPH 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDTLFS GCGR+F+ +  E+ +S++  KS    T ++  HEYT  N  FA + +
Sbjct: 123 EGWLFCGDTLFSAGCGRVFDGTLNELHQSMQLFKSLPPTTKVFCAHEYTLQNLRFARTVE 182

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA---SNL 242
           P+N   Q Y  K+++       T PST+ +E+ +NPFLR +   ++      +A    +L
Sbjct: 183 PNNQFTQNYLKKIQTQ--STSCTLPSTLEIEQLINPFLRTDAPEVQAYAQHHDATAKDSL 240

Query: 243 AVFTELRIRKNQSK 256
            VF  LR +KN+ K
Sbjct: 241 DVFRILREQKNKFK 254


>gi|30248164|ref|NP_840234.1| metallo-beta-lactamase superfamily protein [Nitrosomonas europaea
           ATCC 19718]
 gi|81584870|sp|Q82XW0|GLO2_NITEU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|30180049|emb|CAD84049.1| Metallo-beta-lactamase superfamily [Nitrosomonas europaea ATCC
           19718]
          Length = 262

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 130/258 (50%), Gaps = 9/258 (3%)

Query: 4   LNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           +N+  +  + DN+  ++HN +      ID  D   +   LR++      I  THHH DHT
Sbjct: 2   INVFPVRAFRDNYIWIVHNQQ--FALIIDPGDATPVLTWLRQQKLQPIAILCTHHHHDHT 59

Query: 63  RANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
                L + F   ++GP  E            D   F   S  + I+  PGHT GHI  H
Sbjct: 60  GGISLLVQKFEIPVYGPASEKIPGMTHPLAEGDTLVFPELSLELSILDVPGHTAGHIACH 119

Query: 123 FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
             N   L  GDTLF+ GCGRIFE +  +MF+SL+K+    D+T +Y  HEYT +N  FA 
Sbjct: 120 GQN--RLFCGDTLFACGCGRIFEGNAQQMFDSLQKLTDLPDETQVYCAHEYTLDNIRFAR 177

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNMEN 238
           + DP N EL +  S V+  R QN+ T PS+++ EK  NPFLR    ++ ++       + 
Sbjct: 178 AIDPDNPELIELESNVEEKREQNMPTLPSSLAAEKATNPFLRCNQPAIIQSASRYAGRQL 237

Query: 239 ASNLAVFTELRIRKNQSK 256
              ++VF  +R  KN  +
Sbjct: 238 TDPVSVFAAIRDWKNNFR 255


>gi|317402506|gb|EFV83073.1| hydroxyacylglutathione hydrolase [Achromobacter xylosoxidans C54]
          Length = 266

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 117/247 (47%), Gaps = 9/247 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +  + DN+   I        A +D  +   + + L  +G  L  I  THHH DH    
Sbjct: 18  LPLPAFTDNYIWAIVRD--GQAAVVDPGEAGPVLQWLAREGLRLRAILLTHHHGDHVGGV 75

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
           L L +  + T++GP  E      +     D          + ++  PGHT GHI Y    
Sbjct: 76  LELSRIGDITVYGPAREKLPRCDVPLVEGDRVVLPELDLDLAVLDVPGHTAGHIAYTGRA 135

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
                 L  GDTLF+ GCGR+FE + A+M +SLEK       T ++  HEYT  N  +A+
Sbjct: 136 AGKQPVLFCGDTLFAGGCGRLFEGTPAQMSDSLEKFSVLPPDTQVFCAHEYTLANLRWAM 195

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN----LNMEN 238
           + +P N  LQ++  + + +R++ L T PSTI  E+  NPFLR +   + +        ++
Sbjct: 196 AVEPANRTLQQWYQRARQLRAEGLPTLPSTIGQERATNPFLRTQQADVVRAADNWAGHDH 255

Query: 239 ASNLAVF 245
            + + VF
Sbjct: 256 PTPVEVF 262


>gi|109127169|ref|XP_001090793.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial isoform
           1 [Macaca mulatta]
          Length = 260

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GH+CY      
Sbjct: 66  LVKLQSGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHVCYFVSRPG 123

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +      T +Y GHEYT NN  FA
Sbjct: 124 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHA--RETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K++ K
Sbjct: 242 VTTMRAVRKEKDEFK 256


>gi|104782589|ref|YP_609087.1| hydroxyacylglutathione hydrolase GloB [Pseudomonas entomophila L48]
 gi|122402666|sp|Q1I7T2|GLO2_PSEE4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|95111576|emb|CAK16296.1| hydroxyacylglutathione hydrolase GloB [Pseudomonas entomophila L48]
          Length = 259

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 86/262 (32%), Positives = 131/262 (50%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  + DN+  L+ +   R  A +D  D   +   L +  GW L  I  THHH 
Sbjct: 1   MIQID-ALPAFSDNYIWLLQDTANRRCAVVDPGDDAPVLAWLGKHPGWVLEAILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK      +FGP     +IP  D  L DG           ++A PGHT+GHI
Sbjct: 60  DHVGGVEALKHATGAQVFGPAN--ERIPARDIALEDGAQVHVLGLAFDVLAMPGHTLGHI 117

Query: 120 CYHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            Y+           GDTLF+ GCGR+FE +  +M  SL+++ +  ++T +Y  HEYT +N
Sbjct: 118 AYYTAQSPTPLLFSGDTLFAAGCGRLFEGTPEQMHHSLQRLAALPEQTQVYCAHEYTLSN 177

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +PH+  +Q+    V  +R+ N  + PSTI +E++ NPFLR    S+++     
Sbjct: 178 LRFARAVEPHSEPVQQRFEAVTQLRADNRISLPSTIGIERQTNPFLRTAEISVKQKADEW 237

Query: 235 -NMENASNLAVFTELRIRKNQS 255
               N +  +VF  LR  K+  
Sbjct: 238 KGHSNPTQASVFAALRSWKDVF 259


>gi|295096915|emb|CBK86005.1| hydroxyacylglutathione hydrolase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 252

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 82/253 (32%), Positives = 129/253 (50%), Gaps = 6/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+IS + DN+  ++ +   R    +D  ++  I   ++E GW    I  THHH DH    
Sbjct: 4   ISISAFQDNYIWVLVDDD-RRCIIVDPGESAPILHAIKENGWQPEAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L   +         E+ +  G    + +G++         + ATPGHT GH+C++   
Sbjct: 63  PDLLARYPHLPVYGPAET-QDKGTTQVVEEGESILILGWEFSVFATPGHTSGHLCFYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M++SL+KI +   +T I   HEYT  N  FA S  
Sbjct: 122 --YLFCGDTLFSGGCGRLFEGTPEQMYQSLQKINALPAETVICCAHEYTLGNMKFAASVL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLA 243
           P +  +Q Y  KVK +R++N  T P  +  E+++N FLR ++  L   +N E       A
Sbjct: 180 PEDRAIQDYYQKVKELRAKNQKTLPVILKNERQINLFLRTDDVDLINKINQETNLLQPEA 239

Query: 244 VFTELRIRKNQSK 256
            F  LR +K+  +
Sbjct: 240 RFAWLRSKKDNFR 252


>gi|152989464|ref|YP_001348842.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PA7]
 gi|226724005|sp|A6V707|GLO2_PSEA7 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|150964622|gb|ABR86647.1| hydroxyacylglutathione hydrolase [Pseudomonas aeruginosa PA7]
          Length = 258

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 131/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+  ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALPAFNDNYIWLLQDATSRRCAVVDPGDARPVEAWLAAHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELSGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+      L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHAAQTPLLFCGDTLFAAGCGRLFEGTPAQMHRSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPENQALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSENSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|332240024|ref|XP_003269190.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           [Nomascus leucogenys]
          Length = 260

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 113/255 (44%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF---- 123
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 66  LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 123

Query: 124 -MNDHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +     +T +Y GHEYT NN  FA
Sbjct: 124 GSQPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPETRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVEPGNAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  K
Sbjct: 242 VTTMRAVRREKDGFK 256


>gi|227112972|ref|ZP_03826628.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 251

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 127/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEAPPVLNALVQHSLVPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + L K +        +E++K       + +G+T    +    +I  PGHT GHI Y+   
Sbjct: 63  IELLKHYPNLPVFGPKETAKCGATCL-VEEGNTVSLLNSEFSVIEVPGHTSGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             FL  GDTLFS GCGRI E    +M+ES++KI  F D T +   HEYT +N  F+ +  
Sbjct: 120 APFLFCGDTLFSAGCGRILEGEPRQMYESIQKIAEFPDDTIVCCAHEYTLSNLRFSNTIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS--NLA 243
           P +  ++ Y  ++  +R ++  T P+T+ LE+++N FLR     L+K L+ E A+  N  
Sbjct: 180 PEDPIIEAYLHEISQIREKSQSTLPTTLGLERRINLFLRCHEIDLKKKLSKEPANIENWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 240 VFEILRSKKDCF 251


>gi|304311302|ref|YP_003810900.1| Putative hydroxyacylglutathione hydrolase GloB [gamma
           proteobacterium HdN1]
 gi|301797035|emb|CBL45248.1| Putative hydroxyacylglutathione hydrolase GloB [gamma
           proteobacterium HdN1]
          Length = 288

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 79/263 (30%), Positives = 118/263 (44%), Gaps = 10/263 (3%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           ++S  I A+  + DN+  L+HN +      +D  D   +   L      L+ I+ THHH 
Sbjct: 28  LSSFQIKALPAFQDNYVWLLHNTQS--AVVVDPGDAGPVLSALNASALSLSEIWITHHHA 85

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      L+  F   I      S+            +   FG H +++   PGHTI HI
Sbjct: 86  DHIGGVAELQTAFPSVIIRTPAASTLPGNAISQQDGDEFSLFGQHTVQVWHLPGHTIDHI 145

Query: 120 CYHFM---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
            Y          L  GDTLF  GCGR+F  +  +++ SL++I      T IY  HEYT++
Sbjct: 146 VYLLKAAGEPIHLFCGDTLFGAGCGRLFGGTANQLYTSLQRISQLPSDTKIYCAHEYTQS 205

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SLRK 232
           N  FA + +P N  LQ     V + R++   T P +++ E   NPFLRI       S+ K
Sbjct: 206 NLRFAQAVEPENGALQSRIQTVTAQRARGEKTVPLSLAEELATNPFLRISVPTVTTSILK 265

Query: 233 NLNMENASNLAVFTELRIRKNQS 255
           +  +       +F  LR  K+  
Sbjct: 266 HFIISVTQPTELFAFLRKWKDAF 288


>gi|238784818|ref|ZP_04628819.1| Hydroxyacylglutathione hydrolase [Yersinia bercovieri ATCC 43970]
 gi|238714234|gb|EEQ06245.1| Hydroxyacylglutathione hydrolase [Yersinia bercovieri ATCC 43970]
          Length = 251

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 77/252 (30%), Positives = 135/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLVDPQ-KQCVIVDPGESAPVLAALSQGQFTPQAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L++ F        +E++   G    ++ GD    G     +IA PGHT+GHI Y+   
Sbjct: 63  ADLRRHFPDIPVYGPQETA-NKGATIIVNGGDDLTIGEQNYHVIAVPGHTLGHIAYYSKP 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S++++    D+T I   HEYT  N  FA S  
Sbjct: 122 --YLFCGDTLFSAGCGRLFEGTPEQMYTSIQQLAQLPDETLICSAHEYTLANLKFARSLL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R++NL + P  +  E+K+N FLR  +  L++ + + +  +  ++
Sbjct: 180 PSDQDIATYQQQIMQLRAKNLPSLPVKLQFERKINVFLRCNDVDLQREIGVISPPDTLVS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR RK++ 
Sbjct: 240 VFSELRARKDRF 251


>gi|254240206|ref|ZP_04933528.1| hypothetical protein PA2G_00848 [Pseudomonas aeruginosa 2192]
 gi|126193584|gb|EAZ57647.1| hypothetical protein PA2G_00848 [Pseudomonas aeruginosa 2192]
          Length = 258

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 91/261 (34%), Positives = 133/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  ++ A+S ++DN+  L+ +   R  A +D  D   +   L     W L+ I  THHH 
Sbjct: 1   MIQID-ALSAFNDNYIWLLQDATSRRCAVVDPGDAKPVEAWLAAHPDWRLSDILVTHHHH 59

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK+     + GP     KIP  D  L DG+  +      +I   PGHT+GHI
Sbjct: 60  DHVGGVAALKELTGARVLGPAN--EKIPARDLALEDGERVEVLGLVFEIFHVPGHTLGHI 117

Query: 120 CYHFMNDHFL-CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
            Y+   +  L   GDTLF+ GCGR+FE + A+M  SL ++ +    T +Y  HEYT +N 
Sbjct: 118 AYYHPAETPLLFCGDTLFAAGCGRLFEGTPAQMHHSLARLAALPANTRVYCTHEYTLSNL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+ +P N  L++   +   +R ++  T PS ISLE   NPFLR+   S++K      
Sbjct: 178 RFALAVEPDNAALRERFEEATRLRERDRITLPSEISLELSTNPFLRVSEKSVKKKADQRS 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
             +N +   VF  LR  K+Q 
Sbjct: 238 GQQNRTPEEVFAVLRAWKDQF 258


>gi|253689507|ref|YP_003018697.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259492012|sp|C6DC67|GLO2_PECCP RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|251756085|gb|ACT14161.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 251

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 127/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEASPVLDALAQHALFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K +        +E++K       L +G+T    +    +I  PGHT GHI Y+   
Sbjct: 63  HELLKHYPNLPVFGPKETAKCGATSL-LEEGNTVSLLNSEFSVIEVPGHTSGHIAYYN-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             FL  GDTLFS GCGRIFE +  +M+ES++KI    D T I   HEYT +N  F+ +  
Sbjct: 120 APFLFCGDTLFSAGCGRIFEGTPRQMYESIQKIAVLPDDTVICCAHEYTLSNLRFSNAIW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNLA 243
           P +  ++ Y  ++  +R ++  + P+T+ LE+++N FLR     L++ L+   EN  N  
Sbjct: 180 PEDQSIEAYLHEISQIREKSQSSLPTTLGLERRINLFLRCHELDLKRKLSKEPENIENWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 240 VFEMLRSKKDCF 251


>gi|323181624|gb|EFZ67039.1| hydroxyacylglutathione hydrolase [Escherichia coli 1357]
          Length = 251

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++        +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEA-GCCLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHNDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|238899158|ref|YP_002924840.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|259492011|sp|C4K7Z9|GLO2_HAMD5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|229466918|gb|ACQ68692.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 249

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 128/250 (51%), Gaps = 4/250 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I     N+  L+ +   +    +D  +   +  +L  KG     I  THHH DH    
Sbjct: 4   IHIPALESNYIWLLAD-SNQHCVIVDPGEASPVESVLTYKGLLPQAILLTHHHQDHLGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + F        +E++K       L +GD     S    +I  PGHT+GHI Y+   
Sbjct: 63  PQLLRRFPDIPVYGPKETNKKGATIL-LKEGDQLFICSQTFSVIEVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M++S++K+    D+T I  GHEYT +N  FA S  
Sbjct: 120 APYLFCGDTLFSAGCGRLFEGTADQMYDSIQKLIQLPDETLICAGHEYTLSNLKFARSIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P + ++  Y  + + ++++N  T P+ + LE++VN FLR + + L+K +       L+VF
Sbjct: 180 PDDPQIALYQKQAEQLKAKNQPTLPALLKLERQVNLFLRCKESFLQKKMGTHKHDPLSVF 239

Query: 246 TELRIRKNQS 255
           + LR  K++ 
Sbjct: 240 STLREMKDRF 249


>gi|41053309|ref|NP_956337.1| hydroxyacylglutathione hydrolase, mitochondrial [Danio rerio]
 gi|37681823|gb|AAQ97789.1| hydroxyacyl glutathione hydrolase [Danio rerio]
 gi|38511595|gb|AAH60913.1| Hydroxyacylglutathione hydrolase [Danio rerio]
 gi|42744557|gb|AAH66607.1| Hagh protein [Danio rerio]
          Length = 260

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D  +   +   +++ G  L  +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLLIDEETKEAAIVDPVEPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              ++  +   ++  +TF  GS  +K + TP HT GHICY    ++
Sbjct: 66  LVKLMPGLTVY--GGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKEN 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  EM+++ +E +     +T +Y GHEYT NN  FA
Sbjct: 124 STEAPAVFTGDTLFVAGCGKFFEGTADEMYKALIEVLGRLPPETRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +P+N  ++   +  K        T PST++ E   NPF+R+   S+ ++     +  
Sbjct: 184 RHVEPNNEVIRTKLAWAKEKYDNGEPTIPSTVAEEFTFNPFMRVREKSVLEHAG--TSDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+  +
Sbjct: 242 IEAMRSIRKEKDGFR 256


>gi|114332143|ref|YP_748365.1| hydroxyacylglutathione hydrolase [Nitrosomonas eutropha C91]
 gi|122313177|sp|Q0AE32|GLO2_NITEC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|114309157|gb|ABI60400.1| Hydroxyacylglutathione hydrolase [Nitrosomonas eutropha C91]
          Length = 255

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 85/253 (33%), Positives = 126/253 (49%), Gaps = 8/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            +  + DN+  ++HN +      ID  D   +   + ++      I  THHH DHT    
Sbjct: 6   PVRAFKDNYIWIVHNQQ--FALIIDPGDATPVLAWISQQNLQPIAILCTHHHHDHTGGIP 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
           +L + F   ++GP  E            D  +F   S    ++  PGHT GHI Y+  N 
Sbjct: 64  SLVQEFAIPVYGPANEKIPGMTHPLTGGDTLSFPELSLEFSVLDIPGHTAGHIAYYGQN- 122

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLF+ GCGRIFE S  +M  SL+K+ S  D+T +Y  HEYT  N  FA   DP
Sbjct: 123 -YLFCGDTLFACGCGRIFEGSAQQMLASLQKLASLPDETLVYCAHEYTLANVRFARVLDP 181

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASNL 242
            N +L K  S V+    QN+ T PS++++EK  NPFLR +  ++     +++       +
Sbjct: 182 DNPDLIKLESTVEEKLKQNIPTLPSSLAVEKATNPFLRCDQPAIIHSASQHVGRHLNDPV 241

Query: 243 AVFTELRIRKNQS 255
           +VF  +R  KN  
Sbjct: 242 SVFAAIRDWKNNF 254


>gi|295687841|ref|YP_003591534.1| hydroxyacylglutathione hydrolase [Caulobacter segnis ATCC 21756]
 gi|295429744|gb|ADG08916.1| hydroxyacylglutathione hydrolase [Caulobacter segnis ATCC 21756]
          Length = 249

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 128/256 (50%), Gaps = 11/256 (4%)

Query: 4   LNIAI---SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           + + I       DN+  L+ +      A ID PD+  I   L   GW L  I NTH H D
Sbjct: 1   MPVTIHQFPCLSDNYGFLVRDEASGQVATIDTPDSETILTALDALGWKLDLILNTHWHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  LK      +     E ++I  +D  L+DGDT   G    +++ T GHT+GH+ 
Sbjct: 61  HAGGNEALKAA-TGAMIAGPSEVTRIAPVDRALTDGDTVMLGETRFEVLDTGGHTLGHVS 119

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH   D    VGDTLF+LGCGR+FE +  +M+ SL ++ +  D+T +Y  HEYT +NA F
Sbjct: 120 YHAPADGIAFVGDTLFALGCGRLFEGTPEQMWASLSRLTALPDQTTVYCAHEYTASNARF 179

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS D     L+     V + R +   T P+TI+ EK  NPFLR         L    AS
Sbjct: 180 ALSVDDA-PALKARADAVFAARERGEPTVPTTIAAEKATNPFLRAPL------LRPNAAS 232

Query: 241 NLAVFTELRIRKNQSK 256
               F E+R  K+  K
Sbjct: 233 PAEAFAEIRATKDSFK 248


>gi|99081931|ref|YP_614085.1| hydroxyacylglutathione hydrolase [Ruegeria sp. TM1040]
 gi|99038211|gb|ABF64823.1| Hydroxyacylglutathione hydrolase [Ruegeria sp. TM1040]
          Length = 271

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 88/254 (34%), Positives = 129/254 (50%), Gaps = 6/254 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+        A IDAP+   I   L  + W L  I  THHH DH    
Sbjct: 20  VTVPCLADNYAYLVKGPDG--VALIDAPEAEPILTALEARDWSLGVIMITHHHHDHVGGV 77

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIAT----PGHTIGHICY 121
             L++ F C + GP  E+ KI      L       F              PGHT+GHI +
Sbjct: 78  AALREKFGCPVMGPKAEADKIAAQGVTLDMELEPGFEGGTGAGRCQVLAVPGHTLGHIAF 137

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           ++     L   D+L  +GCGR+FE + A M++++  + +  D+T IY GHEYTE+NA FA
Sbjct: 138 YYPEAPALFSADSLMVMGCGRLFEGTPAMMWQTMTTLSALPDETLIYSGHEYTESNAGFA 197

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           LS +P N  LQK   ++   R     T P+ +SLEK+ NPFLR  + +L+K L +E   +
Sbjct: 198 LSLEPENAALQKRMDEITKTRQNGQPTVPALLSLEKQTNPFLRAGDPNLKKTLGLEGVED 257

Query: 242 LAVFTELRIRKNQS 255
             VF  +R+ K++ 
Sbjct: 258 AEVFAHIRVAKDKF 271


>gi|71279881|ref|YP_268729.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
 gi|71145621|gb|AAZ26094.1| metallo-beta-lactamase family protein [Colwellia psychrerythraea
           34H]
          Length = 265

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 127/258 (49%), Gaps = 11/258 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI+ ++DN+   I +      A +D  D  +  K L+E    L+ I  THHH DH     
Sbjct: 10  AINAFNDNYIWAISSQNNDKIALVDPGDAVVCIKYLQENNLALSAILITHHHSDHVGGIE 69

Query: 67  N-----LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
                   K +  T++GP  E      I    +D            ++  PGHT GHI Y
Sbjct: 70  KLLEYSKDKAWPVTVYGPATEKIAQLDITLKENDTVDLTELDCQFTVLDLPGHTKGHIAY 129

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           +   D  +  GDTLFS GCGR+FE +  +M  SL K+ + +  T IY  HEYT+ N  FA
Sbjct: 130 YN--DKMVFCGDTLFSGGCGRLFEGTPQQMHHSLTKLANLATDTLIYCAHEYTQANLAFA 187

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL----NME 237
           L+ +P+N +L  Y  +VK  R QN  T P+ I+LE ++NPFLR    S++       N  
Sbjct: 188 LAVEPNNTDLHNYAEQVKVKRQQNQATIPTNIALELQINPFLRCHEESIKLAAQTYSNQN 247

Query: 238 NASNLAVFTELRIRKNQS 255
             ++  VF+ +R  K+  
Sbjct: 248 QPNDSEVFSAIRAWKDNF 265


>gi|212709213|ref|ZP_03317341.1| hypothetical protein PROVALCAL_00247 [Providencia alcalifaciens DSM
           30120]
 gi|212688125|gb|EEB47653.1| hypothetical protein PROVALCAL_00247 [Providencia alcalifaciens DSM
           30120]
          Length = 250

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 132/252 (52%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I   +DN+  L+ N   +    +D  ++  +  +L         I  THHH DHT+  
Sbjct: 4   IRIPALNDNYIWLLTN--NQQCIIVDPAESEAVLAILTANHLTPVAILLTHHHNDHTQGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   +        +E+ ++ G    +++GD         ++I  PGHT+GH+ ++   
Sbjct: 62  KGIIAQYPKLPVFGPQET-RVKGATEQVNEGDLVVIDDFKFQVIGLPGHTLGHVGFYQ-- 118

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +M++S++KI +  D+T I   HEYT +N  FA    
Sbjct: 119 APYLFCGDTLFSAGCGRIFEGTPEQMYQSIQKIAALPDETLICCAHEYTLSNLQFAHHIW 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLA 243
           P N  +  Y  KV+++RS    + PST+  E+ +N FL+ +N  L++ LN+   N S  A
Sbjct: 179 PENEIITNYSEKVRTLRSNQQASVPSTLKTERNINIFLQCDNPKLQQKLNINVTNPSLRA 238

Query: 244 VFTELRIRKNQS 255
           VFT LR  K++ 
Sbjct: 239 VFTLLRQLKDEY 250


>gi|113868432|ref|YP_726921.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
 gi|113527208|emb|CAJ93553.1| hydroxyacylglutathione hydrolase [Ralstonia eutropha H16]
          Length = 268

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 81/270 (30%), Positives = 123/270 (45%), Gaps = 16/270 (5%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L +  I  + DN+   IH+      A +D  +   + + L + G  L  I  THHH 
Sbjct: 1   MRMLKVEPIPAFQDNYIWAIHDGHS--AAVVDPGEAAPVERFLAQSGLALGAIVITHHHG 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEES-----SKIPGIDHGLSDGDTFDFGSHPIKII--ATP 112
           DH      L      T  G           +I G    L +GD     +  + +     P
Sbjct: 59  DHQGGVAELLAAHPRTSSGAPMPVLGPAGERIGGRTRALREGDVVTLETPALTLRVLDVP 118

Query: 113 GHTIGHICYHFM---NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYF 169
           GHT GHI Y          +  GDTLF+ GCGR+FE + A+M +SL+K+ +    T +Y 
Sbjct: 119 GHTAGHIAYVGDLGEAGPAVFCGDTLFASGCGRLFEGTPAQMLDSLDKLAALPGDTRVYC 178

Query: 170 GHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
            HEYT +N  FA + +P N  L  +  +V ++R+ +  T P+TI+ E++VNPFLR    +
Sbjct: 179 AHEYTRSNVRFARAVEPANAALAAWEQRVDALRAADQPTLPTTIAHEREVNPFLRSREPA 238

Query: 230 LR---KNLNMENASNLAVFTELRIRKNQSK 256
           +R            +   F  LR  K+  +
Sbjct: 239 VRAAVAAQGGAATGDAQAFGALRGWKDNFR 268


>gi|119386520|ref|YP_917575.1| hydroxyacylglutathione hydrolase [Paracoccus denitrificans PD1222]
 gi|119377115|gb|ABL71879.1| Hydroxyacylglutathione hydrolase [Paracoccus denitrificans PD1222]
          Length = 248

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 132/255 (51%), Gaps = 7/255 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  L+H      TA +DAP+   I   L  +GW L  I  THHH D
Sbjct: 1   MPLELVPVRCLTDNYAWLLH--GNGRTALVDAPEAAPILAELAARGWSLDQIALTHHHAD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H +A   L       + G   +++++P +D  +  G+ F       ++I  PGHTIGH+ 
Sbjct: 59  HIQAVPELVDRTGAWVVGNAGDATRLPPLDQPVRPGERFTLCGEDAEVIDVPGHTIGHVA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +H      +   D+L +LGCGR+FE     M+ SL ++ +   +T +  GH+Y   N  F
Sbjct: 119 FHLPASAMVFTADSLMALGCGRLFEGDADMMWASLSRLNALPAETLVCSGHDYCRGNGAF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           ALS +P N  LQK  ++  + +       PST++ E+  NPFLR+    L  +L ++ AS
Sbjct: 179 ALSVEPGNAALQKRLAETAAGQ---RPCAPSTLAEERVTNPFLRVR--ELADSLGLQGAS 233

Query: 241 NLAVFTELRIRKNQS 255
           + AVF ELR RK++ 
Sbjct: 234 DAAVFAELRARKDRF 248


>gi|261820456|ref|YP_003258562.1| hydroxyacylglutathione hydrolase [Pectobacterium wasabiae WPP163]
 gi|261604469|gb|ACX86955.1| hydroxyacylglutathione hydrolase [Pectobacterium wasabiae WPP163]
          Length = 251

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 130/252 (51%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALKDNYIWLLSNKENR-CVIVDPGEATPVLNTLDQHSLFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K +        +E++K       + +G+T    +    +I  PGHT+GHI Y+   
Sbjct: 63  SELLKHYPNLPVFGPKETAKCGATYL-VEEGNTVSLLNSEFSVIEVPGHTLGHIAYYN-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             FL  GDTLFS GCGRI E +  +M+ES++KI +F D T +   HEYT +N  F+ +  
Sbjct: 120 APFLFCGDTLFSAGCGRILEGNPMQMYESIKKISNFPDDTVVCCAHEYTLSNLTFSNAMW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNLA 243
           P +  ++ Y  K+  +R ++  + P+T+ LE+++N FLR     L++ L++  EN  N  
Sbjct: 180 PEDPNIEAYLHKISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKLSIEPENIENWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 240 VFKLLRSKKDSF 251


>gi|317052652|ref|YP_004113768.1| hydroxyacylglutathione hydrolase [Desulfurispirillum indicum S5]
 gi|316947736|gb|ADU67212.1| hydroxyacylglutathione hydrolase [Desulfurispirillum indicum S5]
          Length = 259

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 125/258 (48%), Gaps = 10/258 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  LI   +   +A +D      + +++R      T +  THHH DH    
Sbjct: 4   IPIPCAQDNYAYLILCEETGESAVVDPCQFAPVDRVIRHHDIRPTALLCTHHHADHVGGV 63

Query: 66  LNLKKFFNCTIFG-PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM 124
             L + +          +  +IPG +   +DGDT   G  P +++ TPGHT G +   + 
Sbjct: 64  EELLQAYPGLRVWAHTSDRGRIPGQNGFANDGDTLTVGKIPGRVLHTPGHTRGSV--VYH 121

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLE-KIKSFSDKTHIYFGHEYTENNAYFALS 183
            D     GD+LFS GCGR+FE S  +M+ SL  ++ S +D   IYFGHEYTE+N  FA  
Sbjct: 122 FDGAAFTGDSLFSAGCGRLFEGSAEQMYHSLNVRLASLTDDVAIYFGHEYTESNLRFARH 181

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN------ME 237
            +P N  L  Y  +V+++R     T PST+  E+ +NPFLR     ++           +
Sbjct: 182 VEPSNPALLGYHDEVQALRRMGKATTPSTMGQERLINPFLRCHTEDVQDYARRFLGEVDQ 241

Query: 238 NASNLAVFTELRIRKNQS 255
           +     VF  LR  K++ 
Sbjct: 242 DLDPAEVFGILRGHKDRF 259


>gi|84622595|ref|YP_449967.1| hydroxyacylglutathione hydrolase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|122879063|ref|YP_199678.6| hydroxyacylglutathione hydrolase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|123522982|sp|Q2P6Y4|GLO2_XANOM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|84366535|dbj|BAE67693.1| hydroxyacylglutathione hydrolase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 255

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 79/254 (31%), Positives = 119/254 (46%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IA+  + DN+   +     R    +D      +      +G   + I  THHH DH    
Sbjct: 4   IALPAFDDNYIWALVAADGR-AIIVDPGQAAPVIATAEREGLVPSAILLTHHHGDHIDGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ +         +  +IP   H +S G+     +   ++I  PGHT  HI +    
Sbjct: 63  AELQQRWPGLELFSPAD-ERIPTTAHHVSHGERLSLLAVDFQVIEVPGHTRTHIAFVT-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  L  GDTLFSLGCGR+FE +  +MF+SL+++     +T +  GHEYT  NA FAL  D
Sbjct: 120 DRHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLACLPGETLVCCGHEYTLANAAFALHVD 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN----ASN 241
             N  LQ+   + ++MR     T P ++  E   NPFLR     +R  +        +S 
Sbjct: 180 STNAALQRRQQEAQAMRHAARPTLPISLKSELATNPFLRTNRPEIRAVVAARAAGALSSE 239

Query: 242 LAVFTELRIRKNQS 255
           + VF ELR  K++ 
Sbjct: 240 VDVFAELRRWKDEF 253


>gi|261346347|ref|ZP_05973991.1| hydroxyacylglutathione hydrolase [Providencia rustigianii DSM 4541]
 gi|282565661|gb|EFB71196.1| hydroxyacylglutathione hydrolase [Providencia rustigianii DSM 4541]
          Length = 250

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 84/252 (33%), Positives = 131/252 (51%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I IS   DN+  L+ +   +    +D  ++  +   L+        I  THHH DHT+  
Sbjct: 4   IRISALSDNYIWLLAD--NQQCIIVDPAESEPVIATLKTNQLNPAAILLTHHHNDHTQGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            ++   +        +E+    G    + DGD+   G+   K++  PGHT+GH+ ++   
Sbjct: 62  KDIIAAYPNIPVFGPQET-LAKGATLLIEDGDSVVIGNFNFKVLGLPGHTLGHVGFYQ-- 118

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGRIFE +  +MF+S++KI +  D T +   HEYT +N  FA    
Sbjct: 119 APYLFCGDTLFSAGCGRIFEGTPEQMFQSIQKIAALPDDTLVCCAHEYTLSNLKFAQHIW 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLA 243
           P N  ++ Y  KV ++R     T PST+  E+ +N FL+  N  L++ LN++  N S  A
Sbjct: 179 PENEAIKNYSEKVTALRENQQATVPSTLKTERNINIFLQCNNVELQQKLNIKMVNPSLRA 238

Query: 244 VFTELRIRKNQS 255
           +FT LR  K+Q 
Sbjct: 239 IFTLLRQLKDQY 250


>gi|227329799|ref|ZP_03833823.1| hydroxyacylglutathione hydrolase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 251

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 80/252 (31%), Positives = 127/252 (50%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N + R    +D  +   +   L +   F   I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKENR-CVIVDPGEAPPVLNALDQHALFPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L + +        +E++K       + +G+T    +    +I  PGHT GHI Y+   
Sbjct: 63  GELLRHYPNLPVFGPKETAKCGATYL-VEEGNTVSLLNSEFSVIEVPGHTSGHIAYYN-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             FL  GDTLFS GCGRIFE +  +M+ES++KI    D T +   HEYT +N  F+ +  
Sbjct: 120 APFLFCGDTLFSAGCGRIFEGTPRQMYESIQKIAKLPDDTVVCCAHEYTLSNLRFSNTIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM--ENASNLA 243
           P +  ++ Y  ++  +R ++  + P+T+ LE+++N FLR     L++ L+   EN  N  
Sbjct: 180 PEDANIEAYLHEISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKLSKEPENIENWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 240 VFEMLRSKKDCF 251


>gi|332374344|gb|AEE62313.1| unknown [Dendroctonus ponderosae]
          Length = 302

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 81/258 (31%), Positives = 130/258 (50%), Gaps = 8/258 (3%)

Query: 4   LNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHT 62
           + + +     DN+  LI +   +  A +D      +   ++ +G  LT I  THHH DH 
Sbjct: 47  MKVTVLPALSDNYMYLITDETTKQAAIVDPVAPDTVLHAVQNEGVNLTQILTTHHHWDHA 106

Query: 63  RANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH 122
             N  L K              +I G+ + +SDGD F  G   ++ + TP HT GHICY+
Sbjct: 107 GGNEELIKK-CPNPLEVYGGDKRIGGLTNKVSDGDRFKIGEIDVECLFTPCHTTGHICYY 165

Query: 123 ---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNA 178
                 +  +  GDTLF  GCGR FE +  +M+ + +EK+    D T ++ GHEYT+ N 
Sbjct: 166 LTDPKGETAVFTGDTLFVAGCGRFFEGTPQQMYTALVEKLSKLPDNTLVFCGHEYTQQNL 225

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FA   +  N ++ K  +     R + + T PSTI  EKK+NPF+R+   S++++ + ++
Sbjct: 226 KFARHVERENRDIMKASADADEKRQKGIPTVPSTILQEKKINPFMRVMMGSVQRHASCDD 285

Query: 239 ASNLAVFTELRIRKNQSK 256
           A  +A    +R  K+  K
Sbjct: 286 A--IATMQAIRKEKDTFK 301


>gi|88857810|ref|ZP_01132452.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
 gi|88819427|gb|EAR29240.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas tunicata D2]
          Length = 261

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 128/261 (49%), Gaps = 6/261 (2%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           MT L +  I  + DN+   I N + +    +D  D   +   + E    L+ I  THHH 
Sbjct: 1   MTMLQVKPIKAFKDNYIWAIINTENQHCVVVDPGDAEPVIAFISEHQLTLSAILITHHHW 60

Query: 60  DHTRANLNLKKFFNC-TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           DHT     L        ++GP              +             I+ATPGHT+ H
Sbjct: 61  DHTNGVEKLCSLQASLPVYGPKNSPFAGITEPLSANTVCQLTDFDLSFHILATPGHTLDH 120

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           ICY+     +L  GDTLFS GCGR+FE +  +MF+S+ K+    DKT +Y  HEYT++N 
Sbjct: 121 ICYYEPQQDWLFCGDTLFSGGCGRLFEGTADQMFQSMVKLSQLPDKTAVYCTHEYTQSNL 180

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN 238
            FAL  +P NL+L ++  KV ++R  N  + PS+I LEKK+NPF+R     + +++ +E+
Sbjct: 181 IFALVIEPQNLDLLQHHKKVDALRLANKASLPSSIGLEKKINPFMRSTEQHITEHVPIEH 240

Query: 239 ----ASNLAVFTELRIRKNQS 255
                        LR  K+  
Sbjct: 241 QQALTEPWHGLAVLRRYKDHF 261


>gi|170589387|ref|XP_001899455.1| Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site. [Brugia malayi]
 gi|158593668|gb|EDP32263.1| Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site., putative [Brugia malayi]
          Length = 271

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 87/254 (34%), Positives = 124/254 (48%), Gaps = 13/254 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +    DN+  L+ + K    A ID  D   I+K ++E G  LT    THHH DH  A 
Sbjct: 25  IPVPALSDNYMYLLVDEKSSDAAIIDPVDLKGINKTVKENGVKLTSSLVTHHHWDHAGAT 84

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +            +I  I + + DGD F  G   +K + TP HT G +CY+  +
Sbjct: 85  NELSDEYRGLSIY--GGDDRIASITNKVRDGDIFKIGELDVKCLYTPCHTTGSVCYYVTD 142

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
              D  +  GDTLF  GCGR FE   A+M  +  +K+ S  + T IY GHEYT  N  FA
Sbjct: 143 GSGDKVVFTGDTLFIGGCGRFFEGDAADMDSALNKKLGSLPNDTKIYCGHEYTVENLKFA 202

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            S +P N E+ K  +  +  R    YT PSTI  EK+ NPF+R+ N +       +++  
Sbjct: 203 HSIEPKNDEITKKLAWAEERRKAGDYTVPSTIEEEKRFNPFMRVRNVT-------KSSDP 255

Query: 242 LAVFTELRIRKNQS 255
           + +  ++R  KN  
Sbjct: 256 ITIMAKIRSMKNNF 269


>gi|226939807|ref|YP_002794880.1| Hydroxyacylglutathione hydrolase [Laribacter hongkongensis HLHK9]
 gi|226714733|gb|ACO73871.1| Hydroxyacylglutathione hydrolase [Laribacter hongkongensis HLHK9]
          Length = 306

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 77/261 (29%), Positives = 118/261 (45%), Gaps = 11/261 (4%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  L I  +    DN+  LI     R    +D  +   +   LR+ G  L  I  THHH 
Sbjct: 48  MPDLTIRPLPALRDNYIWLIS--LGRQAVVVDPGEAEPVLHALRDNGLQLAAILLTHHHA 105

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT     L               S +       +       G    + +ATPGHT+ H+
Sbjct: 106 DHTGGVSALTASAPHVPVFGPRTLSAVTHPVDDHARF-VPAIGFPAFEAMATPGHTLDHL 164

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
           CY+     +L  GDTLF+ GCGR+FE +  +M  SL+++ +  D T I   HEYTE N  
Sbjct: 165 CYYT--PGWLLSGDTLFAGGCGRLFEGTATQMLASLDRLATLPDDTRIACAHEYTEANLA 222

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN- 238
           FA + +  N ++     +++ +R     + P+ +S E+  NPFLRI   ++R+ +     
Sbjct: 223 FANAVESGNPDITARQQRIRQLRQDGKPSLPALLSEERLTNPFLRIRQPAVRQAVIRHAG 282

Query: 239 ----ASNLAVFTELRIRKNQS 255
               A ++ +F  LR  KN  
Sbjct: 283 PPPVADDVGLFAALRNWKNNF 303


>gi|294340667|emb|CAZ89059.1| putative Hydroxyacylglutathione hydrolase [Thiomonas sp. 3As]
          Length = 272

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 76/267 (28%), Positives = 109/267 (40%), Gaps = 17/267 (6%)

Query: 7   AISLYHDNFCILIH-NHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           A++ + DN+  LI  +     T  +D  D   +   L   G  L  I  THHH DH    
Sbjct: 5   ALAAFRDNYIWLIRPDANDPRTLVVDPGDAAPVIGALERGGLELRGILVTHHHSDHVGGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIA-------TPGHTIGH 118
             L +++                                              PGHT+GH
Sbjct: 65  RELLQWWQAKHPADEPPVWGPAAEAIPARTQAMRQGDGFSPTGWPLRLEVLEVPGHTLGH 124

Query: 119 ICYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           I Y            L  GDTLFS GCGR+FE + A+M  SL K+    + T +   HEY
Sbjct: 125 IAYVATALQGEEPPSLFCGDTLFSAGCGRLFEGTPAQMHHSLNKLSQLPENTTVNCAHEY 184

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FA + DP N  +  +  +  ++R++ L T PS I LEK++NPFLR +   + + 
Sbjct: 185 TLSNLQFARAADPLNEAVVAHQKRCLALRAKGLPTLPSHIGLEKQINPFLRTDQPGVLQA 244

Query: 234 L----NMENASNLAVFTELRIRKNQSK 256
           L      +    +     LR  KN  K
Sbjct: 245 LEQHKGQKPGDAVQALAWLREWKNDFK 271


>gi|121998366|ref|YP_001003153.1| hydroxyacylglutathione hydrolase [Halorhodospira halophila SL1]
 gi|226723999|sp|A1WXD9|GLO2_HALHL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|121589771|gb|ABM62351.1| Hydroxyacylglutathione hydrolase [Halorhodospira halophila SL1]
          Length = 255

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 77/257 (29%), Positives = 113/257 (43%), Gaps = 8/257 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           MTS +  ++   DN+  +  +       A+D  D  ++   L +    L  +  THHH D
Sbjct: 1   MTSAD-PLAALADNYIWMARDASGTTAFAVDPGDAAVVEAWLHDHQLRLAAVLVTHHHGD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L +     +FGP  E+                  G    +++  PGHT GHI 
Sbjct: 60  HTGGVAELAERHRVPVFGPATETIPTVDHPIT-GGEHFSLEGFGEFRVLDCPGHTAGHIA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y +  +  L  GD LF+ GCGR+FE +  +M  SL+ + +    T +  GHEYT  N  F
Sbjct: 119 YLW--EGHLFSGDALFAGGCGRVFEGTAGQMHASLQHLAALPADTRVCCGHEYTVKNLEF 176

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   DP N  L +     +  R+    T PST++ E   NPFLR +   LR+        
Sbjct: 177 AHCADPKNDRLAQRLQAARDARAAGQPTVPSTLAEELATNPFLRTDCPELRRAAQDWCGR 236

Query: 241 NL----AVFTELRIRKN 253
           +L     VF  LR  K+
Sbjct: 237 DLDQAYEVFATLRRWKD 253


>gi|326510253|dbj|BAJ87343.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 258

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 112/256 (43%), Gaps = 7/256 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I ++   DN+  LI +   +  AA+D  +   +     E G ++  +  THHH DH   N
Sbjct: 4   IPVACLEDNYAYLIVDESTKAAAAVDPVEPEKVLAAASEVGAYIDCVLTTHHHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             ++              +     D   +           I  + TP HT GHI Y+   
Sbjct: 64  EKMRLLVPGIKVYGGSMDNVKGCTDQVENGTKLSIGKEIEILCLHTPCHTKGHISYYVTS 123

Query: 123 -FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYF 180
               D  +  GDTLF  GCGR FE +  +M++S    + S    T +Y GHEYT  +  F
Sbjct: 124 KKEEDPAVFTGDTLFIAGCGRFFEGTAEQMYQSLCVTLGSLPKSTRVYCGHEYTVKSLQF 183

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
            L+ +P N ++++     +  R  N  T PSTI  E ++N F+R++   ++     ++A 
Sbjct: 184 MLTVEPENEKMKQKLEWAQKQREANQPTVPSTIGDEFEINTFMRVDLPEIQAKFGAKSA- 242

Query: 241 NLAVFTELRIRKNQSK 256
            +     +R  K+  K
Sbjct: 243 -VEALRTVRNIKDTWK 257


>gi|329296919|ref|ZP_08254255.1| hydroxyacylglutathione hydrolase [Plautia stali symbiont]
          Length = 251

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 78/251 (31%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I    DN+   +++ + R    +D  +   + + +R   W    I  THHH DH     
Sbjct: 5   SIPALQDNYIWTLNDEQGR-CLIVDPGEARPVLEKIRANHWQPQAILLTHHHHDHVSGVG 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + +        +E++        LSDGD F       ++IATPGHT+GHI Y   + 
Sbjct: 64  ELLEHYPQLKVYGPQETADKGARTI-LSDGDEFTLLGLNFRVIATPGHTLGHISY--FSS 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDT+FS GCGR+FE +  +MFES + +      T I   HEYT +N  FA +  P
Sbjct: 121 PYLFCGDTMFSGGCGRLFEGTAQKMFESFQSLNQLPADTLICCAHEYTLSNMKFAAAILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LAV 244
            + ++     ++K +R++N  T P+ ++LE+++N FLR ++  L+K+L +  +S      
Sbjct: 181 QDPKILARYQQIKDLRAENRITLPTKLALEREINLFLRTQDPDLQKDLGINVSSTPLWQT 240

Query: 245 FTELRIRKNQS 255
           F +LR +K++ 
Sbjct: 241 FADLREKKDRF 251


>gi|254786146|ref|YP_003073575.1| hydroxyacylglutathione hydrolase [Teredinibacter turnerae T7901]
 gi|237684030|gb|ACR11294.1| hydroxyacylglutathione hydrolase [Teredinibacter turnerae T7901]
          Length = 261

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 80/263 (30%), Positives = 118/263 (44%), Gaps = 10/263 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M      ++  HDN+  +I          ID  +   +  +L+E+G   T I  TH H D
Sbjct: 1   MRVNTFPVATLHDNYVWII--EHRNNALVIDPGEAAPVIAVLKERGLSATAILLTHRHWD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ F C I+GP   +           D   F  G    +I  TPGHT  HI 
Sbjct: 59  HVDGIPELQEHFPCPIYGPESSAMPQVTQTLTEGDHLEFWDGMAKFQIWHTPGHTEEHIA 118

Query: 121 YHFMNDHFL----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
           Y   ++H        GDTLFS GCGR+   +  ++  SLE+ K  +  T +Y  HEYT+ 
Sbjct: 119 YLLADEHNNSTAIFCGDTLFSAGCGRLLGGTAEQLCNSLERYKRLAADTILYCTHEYTQA 178

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----K 232
           N  FA + +P N  +++Y   V+  R     T P+T+  E ++NPFLR +   +      
Sbjct: 179 NLRFAQAVEPSNTLIREYAGVVQEQRLNGATTLPTTVGKELEINPFLRCDQPEVITQIEA 238

Query: 233 NLNMENASNLAVFTELRIRKNQS 255
           +      S L  FT LR  K+  
Sbjct: 239 HTGKTVTSGLQTFTALRQWKDIF 261


>gi|114563378|ref|YP_750891.1| hydroxyacylglutathione hydrolase [Shewanella frigidimarina NCIMB
           400]
 gi|114334671|gb|ABI72053.1| Hydroxyacylglutathione hydrolase [Shewanella frigidimarina NCIMB
           400]
          Length = 259

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 94/256 (36%), Positives = 134/256 (52%), Gaps = 9/256 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  ++DN+  LIH         +D      +   L      L  I  THHH DHT    
Sbjct: 6   AIPAFNDNYLWLIHQTSSLDAYVVDPGCGQSVIDYLATTELNLVGILITHHHSDHTGGIK 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHP---IKIIATPGHTIGHICYHF 123
            L++ FN ++      + +I G+ H L+     +         ++IA PGHT+GHI Y+ 
Sbjct: 66  QLQQHFNNSLIVYGPSNERIDGLTHPLTVTSDINIEIPHLGLTQVIAVPGHTLGHIAYYI 125

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
             D  L  GDTLFS GCGR+FE +  +M +SL  + +  D+T ++  HEYT++N  FAL 
Sbjct: 126 --DDKLFCGDTLFSGGCGRLFEGTPTQMLQSLTVLANLPDQTQVFCAHEYTQSNLNFALH 183

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME----NA 239
             P+NL+L  Y  KV  +RSQN+ T PSTI+ EK +NPFLR      +  ++ E    N 
Sbjct: 184 VTPNNLQLIDYAHKVNQLRSQNIPTIPSTIATEKAINPFLRCHINETQVAISTEYKIVNI 243

Query: 240 SNLAVFTELRIRKNQS 255
            ++  FT LR  KNQ 
Sbjct: 244 DDIQTFTLLREWKNQF 259


>gi|56479132|ref|YP_160721.1| Zn-dependent hydrolase [Aromatoleum aromaticum EbN1]
 gi|56315175|emb|CAI09820.1| Zn-dependent hydrolase [Aromatoleum aromaticum EbN1]
          Length = 263

 Score =  181 bits (459), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 75/254 (29%), Positives = 112/254 (44%), Gaps = 8/254 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +  + DN+  L+   +  L A +D  D  ++   L  +G  L  I  THHH DH    
Sbjct: 14  IPLPAFRDNYLWLLRCGQ--LAAVVDPGDAAVVEDGLAAQGLDLCAILLTHHHADHVGGV 71

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L    +  +FGP     +         D  + D      +++  PGHT  HI Y    
Sbjct: 72  TELIASRDIPVFGPAAADIQGVNNPVAEGDEVSLDRLGIRFRVLEVPGHTASHIAYLA-- 129

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+   + A++  SL ++      T +Y  HEYT  N  FA   D
Sbjct: 130 PGLLFPGDTLFSAGCGRLLGGTAAQLHASLRRLADLPGDTAVYCTHEYTLANLAFARVAD 189

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASN 241
           P N E  ++  + ++ R     T P+TI+ E++VNPFLR    ++         +    +
Sbjct: 190 PGNPERDEWLVECEARRDAGRPTLPTTIARERRVNPFLRTGEPAVMGVIADRTGVRPRDS 249

Query: 242 LAVFTELRIRKNQS 255
           L  F  LR  K+  
Sbjct: 250 LECFAALRAWKDVF 263


>gi|312069728|ref|XP_003137817.1| hydroxyacylglutathione hydrolase [Loa loa]
 gi|307767014|gb|EFO26248.1| hydroxyacylglutathione hydrolase [Loa loa]
          Length = 277

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 87/255 (34%), Positives = 128/255 (50%), Gaps = 7/255 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  L+ + +    A +D  +   I+K ++E G  LT    THHH DH  A 
Sbjct: 25  IPIPALSDNYMYLLIDEETSNAAIVDPVNLKGINKAVKETGVRLTSSLVTHHHWDHAGAT 84

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L   +            +I GI   + DGD F  G   +K + TP HT G +CY+  +
Sbjct: 85  RELSVEYPGLSIY--GGDDRIIGITSKVGDGDIFKIGKVNVKCLYTPCHTTGSVCYYVTD 142

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTENNAYFA 181
              D  +  GDTLF  GCGR FE +  +M  +  EK+ S  + T +Y GHEYT  N  FA
Sbjct: 143 GNGDKVVFTGDTLFIGGCGRFFEGNATDMDSALNEKLGSLPNDTMVYCGHEYTVENLKFA 202

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
            S +P N E+ K  +  +  R    YT PSTI  EK+ NPF+R+  +   +N+  ++A+ 
Sbjct: 203 HSVEPENDEITKKLAWAEEQRKAGNYTVPSTIGEEKRFNPFMRVRISDELRNV-AKSANP 261

Query: 242 LAVFTELRIRKNQSK 256
           + V  ++R  KN  +
Sbjct: 262 IIVMAKIRSMKNNYR 276


>gi|117920812|ref|YP_870004.1| beta-lactamase domain-containing protein [Shewanella sp. ANA-3]
 gi|226724029|sp|A0KXS9|GLO2_SHESA RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|117613144|gb|ABK48598.1| beta-lactamase domain protein [Shewanella sp. ANA-3]
          Length = 267

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 128/270 (47%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI+ ++DN+  ++     +    +D  D  ++   L  +   L  I  THHH D
Sbjct: 1   MLTIT-AINAFNDNYIWVLRQDSQQAVYVVDPGDANVVLDYLHAQRLSLAGILITHHHRD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF--------DFGSHPIKIIATP 112
           HT     L      T    L           G++              F   P++I++ P
Sbjct: 60  HTGGIAALTDHVKQTTGHDLAVYGPQSEDIQGINQPIEPTLSDSLTLPFIDAPVRILSVP 119

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    D  L  GDTLFS GCGR+FE + ++M++SL  + +  D+T +Y  HE
Sbjct: 120 GHTAGHIAYLV--DDALFCGDTLFSAGCGRLFEGTPSQMWQSLSLLAALPDETRVYCAHE 177

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT +N  FA + D  N  L  Y  +  ++R+Q   T PSTI LE+ +NPFLR  + ++  
Sbjct: 178 YTLSNLKFAQTVDTDNEALNAYVEEASTLRAQGKATIPSTIGLERAINPFLRPLSPTIVN 237

Query: 233 NLN-------MENASNLAVFTELRIRKNQS 255
           ++        +  A  L  FT LR  K+  
Sbjct: 238 SIKNQFCDQDLTKADELTCFTLLRQWKDIF 267


>gi|157375126|ref|YP_001473726.1| hydroxyacylglutathione hydrolase [Shewanella sediminis HAW-EB3]
 gi|157317500|gb|ABV36598.1| Hydroxyacylglutathione hydrolase [Shewanella sediminis HAW-EB3]
          Length = 272

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 120/255 (47%), Gaps = 8/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            IS + DN+  +I    +     +D  D  ++   L E    L  +  THHH DHT    
Sbjct: 20  PISAFDDNYIWVISQASHSFVYVVDPGDAEVVISHLEEHKQVLAGVLITHHHEDHTGGLE 79

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFD--FGSHPIKIIATPGHTIGHICYHFM 124
            L ++ +        ++  I  +   +S          +   KII+ PGHT+GHI Y   
Sbjct: 80  RLIEYTDHEFDIFGPKNENIAHVTTPISTQTEVTLSKLTSKAKIISVPGHTLGHIAYL-- 137

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSC 184
            +  L  GDTLFS GCGRIFE +  +M  SL+        T +Y  HEYT +N  FAL+ 
Sbjct: 138 IESHLFCGDTLFSGGCGRIFEGTAEQMHHSLQAFAKLPLNTQVYCAHEYTLSNLKFALAV 197

Query: 185 DPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----MENAS 240
           D  N  L  + +   + R     T PS+I  E  +NPFLR    +++++++    + ++ 
Sbjct: 198 DTENEALAAHNTDCIAQRELGKPTLPSSIGQELSINPFLRCHTQAIQRSVSNHFEVNHSD 257

Query: 241 NLAVFTELRIRKNQS 255
           N+ VF  LR  K+  
Sbjct: 258 NVTVFGLLRQWKDNF 272


>gi|296136539|ref|YP_003643781.1| hydroxyacylglutathione hydrolase [Thiomonas intermedia K12]
 gi|295796661|gb|ADG31451.1| hydroxyacylglutathione hydrolase [Thiomonas intermedia K12]
          Length = 272

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 79/267 (29%), Positives = 116/267 (43%), Gaps = 17/267 (6%)

Query: 7   AISLYHDNFCILIH-NHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTR-- 63
           A++ + DN+  LI  +     T  +D  D   +   L   G  L  I  THHH DH    
Sbjct: 5   ALAAFRDNYIWLIRPDANDPRTLVVDPGDAAPVIGALERGGLELRGILVTHHHSDHVGGI 64

Query: 64  -----ANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
                            ++GP  E+           D  +        +++  PGHT+GH
Sbjct: 65  RELLQWWQTKHPADEPPVWGPAAEAIPARTQAIRQGDVFSPTGWPLRFEVLEVPGHTLGH 124

Query: 119 ICYHFM-----NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEY 173
           I Y            L  GDTLFS GCGR+FE + A+M  SL K+    + T +   HEY
Sbjct: 125 IAYVATALQGEEPPSLFCGDTLFSAGCGRLFEGTPAQMHHSLNKLSQLPENTTVNCAHEY 184

Query: 174 TENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKN 233
           T +N  FA + DP N  +  +  +  ++R++ L T PS I LEK++NPFLR +   + + 
Sbjct: 185 TLSNLQFARAADPLNEAVVTHQKRCLALRAKGLPTLPSHIGLEKQINPFLRTDQPGVLQA 244

Query: 234 L----NMENASNLAVFTELRIRKNQSK 256
           L      +    +     LR  KN  K
Sbjct: 245 LEQHKGQKPGDAVQALAWLREWKNDFK 271


>gi|261856166|ref|YP_003263449.1| hydroxyacylglutathione hydrolase [Halothiobacillus neapolitanus c2]
 gi|261836635|gb|ACX96402.1| hydroxyacylglutathione hydrolase [Halothiobacillus neapolitanus c2]
          Length = 266

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 85/253 (33%), Positives = 126/253 (49%), Gaps = 8/253 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI +  DN+  LI   +    A +D  +   +   +  +   L  I  THHH DH +   
Sbjct: 5   AIPVLSDNYVWLIEGDQ-GQCAVVDPGEAAPVLAEIERRDLTLKAILLTHHHADHCQGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+  F   ++GP  E +K        +            +   TPGHT+GHI      +
Sbjct: 64  GLRARFPVPVYGPALE-AKTWVTHPLANLETFDLPHIGRFQAWHTPGHTLGHISLIS--N 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
               VGDTLFS GCGR+FE S  +M  SL+++ S  D T IY GHEYT ++  FA   +P
Sbjct: 121 GAAFVGDTLFSAGCGRLFEGSPEQMLASLDRLSSLPDATMIYCGHEYTADSLRFAHFAEP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR----KNLNMENASNL 242
           +N  + +   +V   R+  L + P+++SLEK++NPFLRI   SLR    K+   E+ S+ 
Sbjct: 181 NNESIIQRIREVNEARAAGLPSVPTSMSLEKQINPFLRIREPSLRAAILKHARSESLSDA 240

Query: 243 AVFTELRIRKNQS 255
             F  LR  K++ 
Sbjct: 241 DAFWTLRCWKDEF 253


>gi|27479699|gb|AAO17226.1| GloB [Photorhabdus luminescens]
          Length = 250

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 89/252 (35%), Positives = 130/252 (51%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I +  DN+  L+   + R    +D  ++  +   L+  GW    I  THHH DH    
Sbjct: 4   ISIPVLSDNYIWLL-CDENRHVVIVDPTESQPVLDTLKSHGWIPDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   F        +E+    G    +  GD+  FG    +II  PGHT+GHI ++   
Sbjct: 63  PGIIDRFPELPVYGPKETE-SKGATMIVCGGDSIHFGHFSFQIIDVPGHTLGHIAFYQ-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ SL KI    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTLFSGGCGRLFEGTAEQMYASLSKIAELPDDTLICCAHEYTVSNMKFAHAV- 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNL-A 243
             N  + +Y  KV  MR  N  T P+T+  EKK+N FL+ ++  L++N+ +  N+  L A
Sbjct: 179 LPNQTISEYQQKVTQMRESNQPTVPTTLQTEKKINIFLKCDDVDLQRNIGIVPNSQPLSA 238

Query: 244 VFTELRIRKNQS 255
           VF +LR RK+Q 
Sbjct: 239 VFCQLRRRKDQF 250


>gi|85708922|ref|ZP_01039988.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp. NAP1]
 gi|85690456|gb|EAQ30459.1| hydroxyacylglutathione hydrolase, putative [Erythrobacter sp. NAP1]
          Length = 251

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 91/247 (36%), Positives = 128/247 (51%), Gaps = 3/247 (1%)

Query: 9   SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
               DN+  L+HN     TAAID PD     +    KGW +THI+NTH H DH   N   
Sbjct: 8   PCLSDNYGFLLHNSVTDETAAIDTPDAKEYLRQAEAKGWTITHIWNTHWHPDHAGGN-VE 66

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHF 128
                       +E  K+  ID  ++ GDT + G H   +I   GHT GHI YH + +  
Sbjct: 67  IVEKTGARVLAPKEVEKLSPIDRVVAHGDTVNLGEHRADVIDVSGHTNGHIAYHVVEEGM 126

Query: 129 LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHN 188
             VGD++F+LGCGR+FE    + + SLE+IK  S  T +Y  HEYT+ NA FAL  DP N
Sbjct: 127 AFVGDSVFALGCGRMFEGEPEQFWRSLERIKRLSTGTVLYCAHEYTQANAKFALHADPDN 186

Query: 189 LELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTEL 248
             LQ+Y  ++   R++  +T P+ +  E + NPFLR ++ +L +       +    F  L
Sbjct: 187 EALQEYAREIDEKRARGEWTIPTVLKRELETNPFLRADDPALMERWG--GNAPHETFAAL 244

Query: 249 RIRKNQS 255
           R  K+  
Sbjct: 245 RAAKDNF 251


>gi|259415874|ref|ZP_05739794.1| hydroxyacylglutathione hydrolase [Silicibacter sp. TrichCH4B]
 gi|259347313|gb|EEW59090.1| hydroxyacylglutathione hydrolase [Silicibacter sp. TrichCH4B]
          Length = 271

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 135/254 (53%), Gaps = 6/254 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L++       A IDAP+   I   L  +GW L  I  THHH DH  A 
Sbjct: 20  VTVPCLADNYAYLVNGPDG--VAVIDAPEAAPIIAALEARGWSLGVIMITHHHHDHVGAI 77

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSH----PIKIIATPGHTIGHICY 121
             L+  + C + GP  E+ KI      L  G    F         ++IA PGHT+GHI +
Sbjct: 78  NALRDKYGCPVMGPKAEADKIAAQGAPLDMGLEPGFEGGTGAGRCQVIAVPGHTLGHIAF 137

Query: 122 HFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
           ++     L   D+L  +GCGR+FE + A M++++  + + SD T ++ GHEYTE+NA FA
Sbjct: 138 YYPEGPALFSADSLMVMGCGRLFEGTPAMMWQTMTTLAALSDDTLVFSGHEYTESNARFA 197

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           LS DP N  LQK   ++   R  +L T P+ + LEK  NPFLR  +  L+K+L +E   +
Sbjct: 198 LSIDPDNAALQKRAREISQARKSDLPTVPARLELEKATNPFLRAGDADLKKSLGLEGVED 257

Query: 242 LAVFTELRIRKNQS 255
             VF  +R  K++ 
Sbjct: 258 AEVFAHIRAAKDRF 271


>gi|124266127|ref|YP_001020131.1| hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
 gi|124258902|gb|ABM93896.1| Hydroxyacylglutathione hydrolase [Methylibium petroleiphilum PM1]
          Length = 259

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 131/263 (49%), Gaps = 13/263 (4%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L ++I  + DN+  L           +D  ++  +   L +    L  I  THHH D
Sbjct: 1   MPAL-VSIKAFADNYIWLFR--VGNRAWVVDPGESAGVLGYLDKHHLILEGILLTHHHDD 57

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT    +L+   N  ++GP     ++P     L  GD  D      ++I  PGHT GHI 
Sbjct: 58  HTGGVEHLRSVRNARVYGPAR--ERLPEPVIRLLHGDEVDALGVRFRVIDVPGHTAGHIA 115

Query: 121 YH---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
           Y+   F     L  GDTLFS GCGR+FE + A+MF SL+++      T +   HEYT  N
Sbjct: 116 YYAEDFDGRPLLFCGDTLFSGGCGRLFEGTPAQMFASLDRLAGLPGDTLVCCAHEYTVGN 175

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA + +P N ++ ++  +  ++R+++  T PS+I  E+ +NPFLR ++ ++       
Sbjct: 176 LRFANAVEPGNRDVVEHLDRCLALRARDEPTLPSSIKQERLINPFLRCQDPAVANAARRR 235

Query: 238 NA-----SNLAVFTELRIRKNQS 255
            A      ++AVF  LR  K++ 
Sbjct: 236 AAVGHAMDDVAVFAALRAWKDRF 258


>gi|329894917|ref|ZP_08270716.1| Hydroxyacylglutathione hydrolase [gamma proteobacterium IMCC3088]
 gi|328922646|gb|EGG29981.1| Hydroxyacylglutathione hydrolase [gamma proteobacterium IMCC3088]
          Length = 252

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 118/252 (46%), Gaps = 5/252 (1%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I  + DN+   +H    R    +D  D   +   L + G  L  I  THHH DHT   
Sbjct: 4   VPIPAFTDNYIWCLH-LDSRRAIVVDPGDADAVHTYLSDNGLELAGILVTHHHFDHTGGI 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L    +  + GP    S   G+   + D       S  I ++A PGHT+ HI Y+   
Sbjct: 63  EALTNARSIPVIGPQN--SPFDGLTQRVGDHSQLILESLDIHVLAVPGHTLDHIAYYLPE 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              L  GDTLFS GCGR+FE ++ +M  SL  ++     T +Y  HEYT  N  FAL+ D
Sbjct: 121 HKALFCGDTLFSGGCGRVFEGTFEQMRNSLASLRELPASTRVYCAHEYTAANLRFALAVD 180

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLA 243
           P N  LQ   ++V  +R  N  T P+T+  E + NPFLR +  ++  +   +    +   
Sbjct: 181 PANPALQARVAEVSRLRGLNEPTLPTTLEEECRSNPFLRWDAPAIIHSAQNKEPVHNADD 240

Query: 244 VFTELRIRKNQS 255
           VF  +R  K+  
Sbjct: 241 VFRVIRQWKDAF 252


>gi|256087936|ref|XP_002580117.1| hydroxyacylglutathione hydrolase (Glyoxalase II) (Glx II)
           [Schistosoma mansoni]
 gi|238665626|emb|CAZ36356.1| Probable hydroxyacylglutathione hydrolase (Glyoxalase II) (Glx II),
           putative [Schistosoma mansoni]
          Length = 261

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 114/260 (43%), Gaps = 12/260 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I I    DN+  ++ +    + A +D  +   I   + ++G  L  I  THHH+DH   N
Sbjct: 4   ITIPALSDNYMYVVIDRASNICAVVDPVEPDKILSAVTQRGLRLESILTTHHHLDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGI----DHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
           L+L           L+       I    D            +  +  +ATP HT GHICY
Sbjct: 64  LDLVTKCRKQGLEGLKVYGGDDRIGGLTDTVSHGYKIKIGSNLNVYCLATPCHTTGHICY 123

Query: 122 HFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSF-SDKTHIYFGHEYTE 175
               ++         GDTLF  GCGR FE +  +MF++L ++ S     T +Y GHEYT 
Sbjct: 124 LVTEENSTKEGAVFTGDTLFLGGCGRFFEGTAEQMFKALIEVLSKLPTTTKVYCGHEYTV 183

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  F L+ +P N  L+     VK +R+ N  + P TI  E   NPF+R+    +  +  
Sbjct: 184 KNLEFGLTVEPKNEALKHRLEAVKRLRASNQASVPGTIGEELATNPFMRVSEPDVLAHA- 242

Query: 236 MENASNLAVFTELRIRKNQS 255
            +    +     +R  K++ 
Sbjct: 243 -KTTDPIKAMKTIREEKDRF 261


>gi|87118165|ref|ZP_01074064.1| putative hydroxyacylglutathione hydrolase
           withmetallo-hydrolase/oxidoreductase domain [Marinomonas
           sp. MED121]
 gi|86165799|gb|EAQ67065.1| putative hydroxyacylglutathione hydrolase
           withmetallo-hydrolase/oxidoreductase domain [Marinomonas
           sp. MED121]
          Length = 261

 Score =  180 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 86/257 (33%), Positives = 130/257 (50%), Gaps = 11/257 (4%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            I  + DN+  ++ +    L   +D  D   +   L E    L  I  THHH DHT    
Sbjct: 8   PIPAFSDNYIWILTDKDSSLAWVVDPGDANPVLDYLAENQLTLAGILITHHHFDHTAGVK 67

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            LK+ F+C        S     +D GL DGDT    ++   +IATPGHT+ H+CY   N+
Sbjct: 68  KLKQAFDC---HVAGPSHLDKLVDQGLEDGDTISIFNYVFHVIATPGHTLDHLCYFAKNE 124

Query: 127 HFL---CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
           +       GDTLF  GCGR+FE +  +M +SL+K+    ++T +Y  HEYT  N  FA+S
Sbjct: 125 NKSPILFSGDTLFRGGCGRLFEGTAEQMHQSLQKLSDLPEETLVYCTHEYTLANYSFAVS 184

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            D +N +LQ+   K + +R  N  T P+ IS+E++VNPFLR     +  +   +    ++
Sbjct: 185 LDKNNQKLQENLQKCQDLRDNNQPTLPTKISIEQEVNPFLRPHIEQISNSAARQLDQEIS 244

Query: 244 -----VFTELRIRKNQS 255
                 F ++R  K+  
Sbjct: 245 NSLVGRFAQIRAAKDSF 261


>gi|327480859|gb|AEA84169.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri DSM 4166]
          Length = 270

 Score =  180 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 93/262 (35%), Positives = 136/262 (51%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  +  A+  + DN+  L+ +   R   A+D  D   +   L    GW L+ I  THHH 
Sbjct: 12  MFKIE-ALPAFTDNYIWLLQDDAARRCVAVDPGDAAPVLDWLSAHPGWQLSDILVTHHHH 70

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK      ++GP     KIP  D  LSDG   +     ++IIA PGHT+GHI
Sbjct: 71  DHVGGVERLKAQTGARVYGPAA--EKIPARDEALSDGQRIEVLGKRLQIIAVPGHTLGHI 128

Query: 120 CYHFMNDHFLC--VGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            Y   +        GDTLF+ GCGR+FE +  +MFESL ++ S  D T +Y  HEYT +N
Sbjct: 129 AYFHADPDQPWLLSGDTLFAAGCGRLFEGTPEQMFESLTRLASAPDHTLVYCTHEYTLSN 188

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
             FA + +PHN ++     +V  +R    ++ PS + +E+K NPFLR E  ++R+  +  
Sbjct: 189 LRFAQAVEPHNADIAARIGEVTQLREAGRFSLPSRLDIERKTNPFLRSEVEAVRQAASQH 248

Query: 238 NASN----LAVFTELRIRKNQS 255
            +S     +AVF  LR  K++ 
Sbjct: 249 CSSPLATNVAVFAALRAWKDRF 270


>gi|77360891|ref|YP_340466.1| hydroxyacylglutathione hydrolase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123588755|sp|Q3IIR9|GLO2_PSEHT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|76875802|emb|CAI87023.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 257

 Score =  180 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 115/255 (45%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D      +   L +    L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTSNNTQAWVVDPGQAEPVLDYLAQHNLTLAGILITHHHYDHTDGVA 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L               S   GI   L+DG +    +    IIATPGHT+ HICY    +
Sbjct: 66  KLVSENPNIAVYGPTN-SPFKGITQQLTDGQSITVLNTAFNIIATPGHTLDHICYVN--E 122

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
                GDTLFS GCGR+FE S  +M+ S  K++       +Y  HEYT+ N  FA + +P
Sbjct: 123 QLAFTGDTLFSGGCGRLFEGSAEQMWHSFNKLRELPADCKVYCTHEYTQANLAFATAIEP 182

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME------NAS 240
            N EL  Y  +V  +RS+N  T PSTI  E K+NPF+R +  ++ + L  E      N  
Sbjct: 183 RNPELLAYSKRVDELRSKNEITLPSTIGQELKINPFMRSDLPNITELLPKEFCSVTKNNE 242

Query: 241 NLAVFTELRIRKNQS 255
               F  LR  K+  
Sbjct: 243 PWENFAGLRKFKDHF 257


>gi|308185773|ref|YP_003929904.1| hydroxyacylglutathione hydrolase [Pantoea vagans C9-1]
 gi|308056283|gb|ADO08455.1| probable hydroxyacylglutathione hydrolase [Pantoea vagans C9-1]
          Length = 252

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/257 (29%), Positives = 129/257 (50%), Gaps = 7/257 (2%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M +L  +I    DN+   +++ + +    +D  +   + + +   GW    I  THHH D
Sbjct: 1   MMNLT-SIPALQDNYIWTLNDDEGK-CLIVDPGEAQPVLEKMASNGWQPVAILLTHHHND 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           HT     L + F        +E+         +S+GD         ++I TPGHT+GHI 
Sbjct: 59  HTGGVKTLCEHFPHLEVYGPQETEAKGARTI-VSEGDKVTVLGLTFEVIHTPGHTLGHIS 117

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           Y+     +L  GDTLFS GCGR+FE +  +M++S +K+     +T +   HEYT +N  F
Sbjct: 118 YYS--SPYLFCGDTLFSGGCGRLFEGTPEQMYDSFQKLNQHPGETLVCCAHEYTLSNLKF 175

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A +  PH+ ++     K+K +R++N  + P+ ++ E+ +N FLR ++  L++ LN+    
Sbjct: 176 AAAILPHDPQITAEYQKIKDLRAENGISLPTKLAHERSINLFLRTQDIDLQRALNVNVTD 235

Query: 241 N--LAVFTELRIRKNQS 255
                 F  LR +K+  
Sbjct: 236 EPVWRTFAILREKKDAF 252


>gi|163914993|ref|NP_001106490.1| paroxysmal nonkinesigenic dyskinesia [Xenopus (Silurana)
           tropicalis]
 gi|159155173|gb|AAI54687.1| pnkd protein [Xenopus (Silurana) tropicalis]
          Length = 312

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 88/263 (33%), Positives = 119/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI +    L A +D  D   +   L  +G  L  I  TH H DH+  N
Sbjct: 49  VPIPVLSDNYSYLIIDTASSLAAVVDPSDPLTVQAYLEREGVTLEAILCTHKHWDHSGGN 108

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             LK+ +             IP + H LSD +    G    +   TPGHT+GH+ Y    
Sbjct: 109 KALKRLYKSCRVYGS-SYDDIPELTHALSDREQLSVGRLQFQAYFTPGHTVGHMIYVLDG 167

Query: 123 --FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                   L  GD LF  GCGR+FE S   M  SL+   S +D T ++ GHEY  +N  F
Sbjct: 168 KSGDGPDCLFSGDLLFLAGCGRMFEGSAETMLASLDTAASLNDSTLLWPGHEYAADNLTF 227

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   +P N    K C  V   R +   T PSTI  EK+ NPFLR     L + L+++  +
Sbjct: 228 AAVVEPENSVRDKKCQWVLHRRLEKKSTCPSTIGEEKEYNPFLRTHCRDLHQALDLQRGA 287

Query: 241 NLA-------VFTELRIRKNQSK 256
           N         V  E+R RK+  K
Sbjct: 288 NEDWNHFRARVLEEVRKRKDLFK 310


>gi|148653213|ref|YP_001280306.1| hydroxyacylglutathione hydrolase [Psychrobacter sp. PRwf-1]
 gi|148572297|gb|ABQ94356.1| Hydroxyacylglutathione hydrolase [Psychrobacter sp. PRwf-1]
          Length = 259

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 124/261 (47%), Gaps = 8/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+ +   I  + DN+   + N   +    ID      ++  L + G  LT I+ THHH D
Sbjct: 1   MSLIITPIPAFTDNYIWALVNDTNKQAIVIDPGQAQPVADYLEQYGLELTAIWITHHHHD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ +  T      E       D  + +G +     +  ++ A PGHT  H+ 
Sbjct: 61  HVGGVAELRELYPMTHVVASAEHG--VKPDQVVKEGSSVSAWGYTAQVWAVPGHTQSHLA 118

Query: 121 YHFMNDHF--LCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           Y    +    +  GDTLFS GCGR+F  +  ++ +S ++     D T  Y  HEYT  N 
Sbjct: 119 YVLDKEGHKQVFCGDTLFSAGCGRVFTGTIEQLHDSFKRFNKLPDNTLFYPAHEYTAANL 178

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS----LRKNL 234
            F LS +P N  +Q+  ++V+SM +    + P T++ EK+VN FLR +  S    ++  +
Sbjct: 179 KFGLSIEPDNAAMQQCLTEVESMTALGQSSLPVTLAHEKQVNVFLRTQELSVIDGVQNQV 238

Query: 235 NMENASNLAVFTELRIRKNQS 255
            + +  +L VF  LR  K++ 
Sbjct: 239 TLADTKSLTVFAALRALKDEF 259


>gi|238755081|ref|ZP_04616428.1| Hydroxyacylglutathione hydrolase [Yersinia ruckeri ATCC 29473]
 gi|238706641|gb|EEP99011.1| Hydroxyacylglutathione hydrolase [Yersinia ruckeri ATCC 29473]
          Length = 271

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 85/252 (33%), Positives = 133/252 (52%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ N + R    +D  +   +   L+EK W    I  THHH DH    
Sbjct: 24  ISIPAFQDNYIWLLVNRQQR-CLIVDPGEASPVLAELKEKKWTPEAILLTHHHHDHVGGV 82

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
           + L   +        +E++   G    ++DGD          IIA PGHT+GHI Y+   
Sbjct: 83  VELLNHYPNLPVYGPQETA-HKGATIIVNDGDQLSLCGLDFTIIAVPGHTLGHIAYYS-- 139

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S++++ +  D T I   HEYT +N  FA +  
Sbjct: 140 APYLFCGDTLFSGGCGRLFEGTPQQMYASIQQLTALPDDTLICCAHEYTLSNLNFARTVL 199

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P +  ++ Y  +++ +R++N  + PST+ LE+++N FLR  +  L++ L     SN    
Sbjct: 200 PEDRRIETYQQQIRILRAKNQSSLPSTLQLEREINVFLRCNDVDLQRKLGFHPLSNDYSL 259

Query: 244 VFTELRIRKNQS 255
           VF ELR RK+  
Sbjct: 260 VFAELRARKDSF 271


>gi|146282602|ref|YP_001172755.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri A1501]
 gi|145570807|gb|ABP79913.1| hydroxyacylglutathione hydrolase [Pseudomonas stutzeri A1501]
          Length = 292

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 136/262 (51%), Gaps = 10/262 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREK-GWFLTHIFNTHHHI 59
           M  +  A+  + DN+  L+ +   R   A+D  D   +   L    GW L+ I  THHH 
Sbjct: 34  MFKIE-ALPAFTDNYIWLLQDDAARRCVAVDPGDAAPVLNWLSAHPGWQLSDILVTHHHH 92

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH      LK      ++GP     KIP  D  LSDG   +     ++IIA PGHT+GHI
Sbjct: 93  DHVGGVERLKAQTGARVYGPAA--EKIPARDEALSDGQRIEVLGKRLQIIAVPGHTLGHI 150

Query: 120 CYHFMNDHFLC--VGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            Y   +        GDTLF+ GCGR+FE +  +MFESL ++ S  D T +Y  HEYT +N
Sbjct: 151 AYFHADPDQPWLLSGDTLFAAGCGRLFEGTPEQMFESLTRLASAPDHTLVYCTHEYTLSN 210

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL--- 234
             FA + +PHN ++     +V  +R    ++ PS + +E+K NPFLR E  ++R+     
Sbjct: 211 LRFAQAVEPHNADIAARIGEVTQLREAGRFSLPSRLDIERKTNPFLRSEVEAVRQAASQH 270

Query: 235 -NMENASNLAVFTELRIRKNQS 255
                A+N+AVF  LR  K++ 
Sbjct: 271 CGSPLATNVAVFAALRAWKDRF 292


>gi|119606016|gb|EAW85610.1| hydroxyacylglutathione hydrolase, isoform CRA_b [Homo sapiens]
          Length = 317

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 73/264 (27%), Positives = 117/264 (44%), Gaps = 19/264 (7%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 54  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 113

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN-- 125
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 114 LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPG 171

Query: 126 ---DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKI----------KSFSDKTHIYFGHE 172
                 +  GDTLF  GCG+ +E +  EM ++L ++           +      +Y GHE
Sbjct: 172 GSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTVGSASLRAGRVYCGHE 231

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT NN  FA   +P N  +++  +  K   S    T PST++ E   NPF+R+   ++++
Sbjct: 232 YTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQ 291

Query: 233 NLNMENASNLAVFTELRIRKNQSK 256
           +        +     +R  K+Q K
Sbjct: 292 HAG--ETDPVTTMRAVRREKDQFK 313


>gi|85713816|ref|ZP_01044806.1| beta-lactamase-like protein [Nitrobacter sp. Nb-311A]
 gi|85699720|gb|EAQ37587.1| beta-lactamase-like protein [Nitrobacter sp. Nb-311A]
          Length = 255

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 146/245 (59%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     TAAIDAP+   I + L  +GW LT I  THHH DH      LK
Sbjct: 10  CLTDNFGVLIHDPAANATAAIDAPEAEPIIQALDREGWALTDILVTHHHSDHVGGVAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + +NC +  P ++ + I  +D  +  GD    G+   +++ TPGHT+ H+ Y F ++  +
Sbjct: 70  QKYNCRVVAPHDKGAGIANVDLRVGQGDIVKVGTLLGRVLETPGHTLDHVSYVFDDEKVV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+FE ++  M++SL K+++  D   +Y GHEYT +N  FAL+ +P+N 
Sbjct: 130 FAADTLFSIGCGRVFEGTHPMMWDSLLKLRALPDSFRLYCGHEYTASNVKFALTIEPNNP 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L+    +V  +R++   T P+ +  EKK N FLR ++ ++   ++M+ AS   VF ELR
Sbjct: 190 ALKARAEEVARLRAEGKPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGAEVFAELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|148555708|ref|YP_001263290.1| hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
 gi|148500898|gb|ABQ69152.1| Hydroxyacylglutathione hydrolase [Sphingomonas wittichii RW1]
          Length = 272

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 76/256 (29%), Positives = 130/256 (50%), Gaps = 14/256 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   + I +  DN+  L+H      T  +D      +      +GW +  I+NTH H D
Sbjct: 30  MSVEIVRIPVLDDNYVWLLHEPVSGETVVVDPAVAGPVLAEAERRGWTIGQIWNTHWHGD 89

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H   N  +K      +  P  E++KIP +D  L +GD+   G+    ++  P HT GHI 
Sbjct: 90  HIGGNDAIKAATGARVSAPAAEAAKIPSLDVPLREGDSVRIGAVEGMVMEVPAHTAGHIA 149

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
            H  ++  + VGDTLF++GCGR+FE + A+M  +++++ +  D T +Y  HEYT++N  +
Sbjct: 150 IHLPDEQAVFVGDTLFAMGCGRLFEGTPAQMHANMDRLAALPDATRVYCAHEYTQSNGRY 209

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           AL+ +P N  ++    +V + R++   T P+TI LE++ NPF+R  +             
Sbjct: 210 ALAAEPGNGAIRARMERVDAARARGEATVPTTIGLERETNPFMRAGS------------- 256

Query: 241 NLAVFTELRIRKNQSK 256
            +      R  K+  +
Sbjct: 257 -VEELARRRAAKDVFR 271


>gi|304395364|ref|ZP_07377247.1| hydroxyacylglutathione hydrolase [Pantoea sp. aB]
 gi|304356658|gb|EFM21022.1| hydroxyacylglutathione hydrolase [Pantoea sp. aB]
          Length = 251

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 73/251 (29%), Positives = 124/251 (49%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I    DN+   + + + +    +D  +   + + +   GW    I  THHH DHT    
Sbjct: 5   SIPALQDNYIWALTDDQGK-CLIVDPGEAQPVLEKMASNGWEPVAILLTHHHNDHTGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F        +E+         +S+GD          +I TPGHT+GHI Y+    
Sbjct: 64  TLCEHFPQLEVYGPQETEAKGARTI-VSEGDKVTVLGLTFDVIHTPGHTLGHISYYS--A 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE +  +M++S +K+     +T +   HEYT +N  FA +  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTAEQMYDSFQKLNQLPGETLVCCAHEYTLSNLKFAAAILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LAV 244
           H+ ++     K+K +R++N  + P  ++ E+ +N FLR ++  L++ LN+  +       
Sbjct: 181 HDPQIMAEYQKIKDLRAENGISLPVKLAHERSINLFLRSQDVDLQRALNVNVSDEPLWHT 240

Query: 245 FTELRIRKNQS 255
           F  LR +K+  
Sbjct: 241 FAVLREKKDAF 251


>gi|37524932|ref|NP_928276.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81420168|sp|Q7N809|GLO2_PHOLL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|36784358|emb|CAE13235.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 250

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 129/252 (51%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+   + R    +D  ++  +   L  +GW    I  THHH DH    
Sbjct: 4   ISIPALSDNYIWLL-CDENRHVVIVDPAESQPVLDTLESRGWIPDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   F   +     E+ +  G    +  GD+ +FG    +II  PGHT+GHI ++   
Sbjct: 63  PGIIDRFPELLVYGPAET-QSKGATIIVCGGDSINFGHFSFQIIDVPGHTLGHIAFYQ-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S+ KI    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTLFSGGCGRLFEGTAEQMYTSIGKIAELPDDTLICCAHEYTISNMKFAHAV- 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
             N  + +Y  KV  MR  N  T P+T+  EKK+N FL+ ++  L++N+ +   S    A
Sbjct: 179 LPNQTISEYQQKVIRMRENNQPTIPTTLQTEKKINIFLKCDDIDLQRNIGITPNSQPLSA 238

Query: 244 VFTELRIRKNQS 255
           VF +LR +K+Q 
Sbjct: 239 VFHQLRRQKDQF 250


>gi|50122264|ref|YP_051431.1| hydroxyacylglutathione hydrolase [Pectobacterium atrosepticum
           SCRI1043]
 gi|81644255|sp|Q6D1V5|GLO2_ERWCT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|49612790|emb|CAG76240.1| probable hydroxyacylglutathione hydrolase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 251

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 78/252 (30%), Positives = 124/252 (49%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+ N   R    +D  +   +   L +       I  THHH DH    
Sbjct: 4   ISIPALQDNYIWLLSNKANR-CVIVDPGEASPVLNALDQNALLPEAILLTHHHNDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   +        +E++K       + +G+T    +    +I  PGHT GHI Y+   
Sbjct: 63  SEILNHYPNLPVFGPKETAKCGATYL-VEEGNTVSLLNSEFSVIEVPGHTSGHIAYYN-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             FL  GDTLFS GCGRIFE +  +M+ES++KI    D T +   HEYT +N  F+    
Sbjct: 120 APFLFCGDTLFSAGCGRIFEGTPKQMYESIQKIAELPDDTVVCCAHEYTLSNLRFSNDIW 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLA 243
           P + +++ Y  K+  +R ++  + P+T+ LE+++N FLR     L++ ++   EN  N  
Sbjct: 180 PEDPDIESYLHKISQIREKSQSSLPTTLGLERRINLFLRCHEIDLKRKISNEPENIENWQ 239

Query: 244 VFTELRIRKNQS 255
           VF  LR +K+  
Sbjct: 240 VFKMLRSKKDCF 251


>gi|238762657|ref|ZP_04623626.1| Hydroxyacylglutathione hydrolase [Yersinia kristensenii ATCC 33638]
 gi|238698962|gb|EEP91710.1| Hydroxyacylglutathione hydrolase [Yersinia kristensenii ATCC 33638]
          Length = 251

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 137/252 (54%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 4   ISIPAFQDNYIWLLADEQ-KHCVIVDPGESAPVLAALSQGQYLPQAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L++ +        +E++   G    ++ GD         +IIA PGHT+GHI Y+   
Sbjct: 63  ADLRRHYPDIPVYGPQETA-NKGATIIVNGGDNLTINGQNYQIIAVPGHTLGHIAYYS-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           + +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 120 EPYLFCGDTLFSAGCGRLFEGTPAQMYASIQQLAQLPDETLICSAHEYTLANLKFARFIL 179

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R+++L + P  + +E+K+N FLR  +  L++ + + +  +  ++
Sbjct: 180 PSDQDIATYQQEIMQLRAKHLPSLPVKLQIERKINVFLRCNDIDLQRKIGVMSPPDSLVS 239

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 240 VFSELRAQKDRF 251


>gi|307294742|ref|ZP_07574584.1| hydroxyacylglutathione hydrolase [Sphingobium chlorophenolicum L-1]
 gi|306879216|gb|EFN10434.1| hydroxyacylglutathione hydrolase [Sphingobium chlorophenolicum L-1]
          Length = 240

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 135/248 (54%), Gaps = 14/248 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I + +DN+  L+H+     T A+D      + +  R++GW +  I+NTH H DH   N
Sbjct: 5   VRIPVLNDNYVWLLHDDASGETVAVDPAVAEPVLEAARQRGWTIGQIWNTHWHGDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K    C I GP  E+ KI  +D  +++GD+   G H   ++  P HT GHI YH  +
Sbjct: 65  AAIKAATGCIITGPAAEAEKIGTLDRMVAEGDSVRIGDHQATVLEVPAHTAGHIAYHLAD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  + VGDTLF++GCGR+FE + A+MF ++++  +  D T +Y  HEYT++N  FAL+ +
Sbjct: 125 DRLIFVGDTLFAMGCGRLFEGTAAQMFANMQRFAALPDDTTVYCAHEYTQSNGRFALTVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+    +V + R++   T P++I LE+  N F+R  +              +A  
Sbjct: 185 PDNAALRTRMDQVDAARARGEPTVPTSIGLERATNIFMRARD--------------IAQL 230

Query: 246 TELRIRKN 253
            E R  K+
Sbjct: 231 AERRAAKD 238


>gi|198282701|ref|YP_002219022.1| hydroxyacylglutathione hydrolase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667304|ref|YP_002424893.1| hydroxyacylglutathione hydrolase, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247222|gb|ACH82815.1| hydroxyacylglutathione hydrolase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519517|gb|ACK80103.1| hydroxyacylglutathione hydrolase, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 250

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 116/252 (46%), Gaps = 12/252 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  +    K      ID      +     E     + I  THHH DHT     
Sbjct: 6   IPAFTDNYIYVAETPKG--AWIIDPGCAEPVLDWCAEHTLRPSAILCTHHHADHTGGVEA 63

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L ++F   ++G     ++                 +  + ++  PGHT  HI Y    ++
Sbjct: 64  LAQYFGIPVYGA----NRRIPGLTHAVAEGRLTLDAETLTVLEVPGHTRDHIAY--WWEN 117

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF+ GCGR+FE + A+MF SL+++ +  D T +Y  HEYT  N  FA   DP 
Sbjct: 118 VLFCGDTLFAAGCGRLFEGTAAQMFHSLQRLAALPDHTAVYCAHEYTLTNLRFAAQADPD 177

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA----SNLA 243
           N  + +   +  + R++N  T PS ++LE+  NPFLR    +L ++ N  +       + 
Sbjct: 178 NPVIVQRQKEAIAQRARNEPTLPSDMALERASNPFLRCREPALIRSANAFDPATGDDPVR 237

Query: 244 VFTELRIRKNQS 255
           VF+ LR  K+  
Sbjct: 238 VFSALRRWKDHF 249


>gi|188581690|ref|YP_001925135.1| hydroxyacylglutathione hydrolase [Methylobacterium populi BJ001]
 gi|179345188|gb|ACB80600.1| hydroxyacylglutathione hydrolase [Methylobacterium populi BJ001]
          Length = 259

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 128/247 (51%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN  +LI +      AAID P+   +   L  +GW LT I  TH H DH      + 
Sbjct: 13  CRSDNIGVLIRDPASGACAAIDVPEAGPVLAALDAEGWTLTDILVTHRHGDHIEGIPEVV 72

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +     +  P +  + +PG    + +GDT   G    ++  TPGH   H+ YHF +    
Sbjct: 73  ERTGARVTAPEKARAAVPGAARYVKEGDTVTVGGLSAQVWETPGHCADHVTYHFADAGVA 132

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+ E   A ++ SL++  +  D T +Y GH+Y  +N  FAL+ DP N 
Sbjct: 133 FAGDTLFTLGCGRVMEAEPATLWRSLKRFLALPDATAVYSGHDYVLSNGRFALAADPDNA 192

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NASNLAVFTEL 248
           +L++  ++ + +  +  +  PSTI  EK  NPFLR+   +L ++  +E  +   AVFT L
Sbjct: 193 DLKERVAQAERLAQEGRFLIPSTIGEEKATNPFLRVSEPALARSAGLEPGSDPEAVFTAL 252

Query: 249 RIRKNQS 255
           R  KN+ 
Sbjct: 253 RAWKNRF 259


>gi|56460798|ref|YP_156079.1| hydroxyacylglutathione hydrolase GloB [Idiomarina loihiensis L2TR]
 gi|81363283|sp|Q5QZL0|GLO2_IDILO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|56179808|gb|AAV82530.1| Probable hydroxyacylglutathione hydrolase GloB [Idiomarina
           loihiensis L2TR]
          Length = 253

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 122/252 (48%), Gaps = 8/252 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   I  +       +D  +   + + L +    +  I  THHH DHT    
Sbjct: 5   AIEAFDDNYIWAIETNDKDKVIIVDPGEAQPVQQWLEQNSKSIETILVTHHHYDHTGGIA 64

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L +   C + GP     K       +++GD    G    +++ TPGHT+ HI ++    
Sbjct: 65  ELIEQSPCPVIGPENPEIKTLTKT--VTEGDELTVGGIQWQVLTTPGHTLDHISFYT--P 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            FL  GDTLFS GCGR+FE +  +  +SL K++    +T ++  HEYT+ N  FAL  +P
Sbjct: 121 GFLFCGDTLFSGGCGRMFEGTPEQFTQSLLKLRKLPGETRVFCAHEYTQANVNFALKVEP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME----NASNL 242
            N  LQ Y  KV+ +R Q   T PST+ LE  +NPFLR +  S+    N        S  
Sbjct: 181 ENAVLQSYAEKVRMLREQEQITLPSTLQLELAINPFLRFDQKSVIAAANKHAESVKNSPE 240

Query: 243 AVFTELRIRKNQ 254
            VF  +R  K+ 
Sbjct: 241 DVFYTIRQWKDN 252


>gi|270157084|ref|ZP_06185741.1| hydroxyacylglutathione hydrolase [Legionella longbeachae D-4968]
 gi|289164504|ref|YP_003454642.1| hydroxyacylglutathione hydrolase (glyoxalase II) [Legionella
           longbeachae NSW150]
 gi|269989109|gb|EEZ95363.1| hydroxyacylglutathione hydrolase [Legionella longbeachae D-4968]
 gi|288857677|emb|CBJ11520.1| putative hydroxyacylglutathione hydrolase (glyoxalase II)
           [Legionella longbeachae NSW150]
          Length = 254

 Score =  178 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 124/254 (48%), Gaps = 6/254 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I IS + DN+   I + +  +   +D  D   + +        L  I  THHH DH    
Sbjct: 4   IPISAFFDNYIWAIIDEESGVFDCVDPGDAKPVLQFAHSNHLNLRTILLTHHHHDHIGGV 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L K +         +  +IP +++ + +  T   G     I+  PGHT  HI Y+   
Sbjct: 64  DELIKAYPSCTVYGP-KDPRIPYVNNPIEEHQTIQVGQCLFNILFNPGHTSTHISYYESQ 122

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+F+ +  ++ +SL+  +     T I+  HEYT+ N  FA + +
Sbjct: 123 HQWLFCGDTLFSAGCGRVFDGTLEQLQQSLQLFQELPKTTKIFCAHEYTQQNLRFAQTVE 182

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---NMENASNL 242
           P NL ++K+  K+    S    T PST+ LEK +NPFLR +   +++       ++ ++L
Sbjct: 183 PGNLSVKKHLQKIHD--SPCSCTLPSTLELEKSINPFLRTDKPEVQQFALKHGAKSLNSL 240

Query: 243 AVFTELRIRKNQSK 256
            +F  LR  KN  K
Sbjct: 241 EIFRILREEKNSFK 254


>gi|241570292|ref|XP_002402678.1| hydroxyacylglutathione hydrolase, putative [Ixodes scapularis]
 gi|215502060|gb|EEC11554.1| hydroxyacylglutathione hydrolase, putative [Ixodes scapularis]
          Length = 262

 Score =  178 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 72/260 (27%), Positives = 126/260 (48%), Gaps = 15/260 (5%)

Query: 3   SLNIAI-SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDH 61
           ++ I + +   DN+  L+ +   +  A +D      + + +++    LT +  THHH DH
Sbjct: 11  NMQIKVLNALQDNYMYLVVDSSTKEAAVVDP-----VLEEVKKLNVKLTTVLTTHHHWDH 65

Query: 62  TRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
           +  N  L +              ++P I   + DG+    G   +K + TP HT GHICY
Sbjct: 66  SGGNDKLVELSPGLAVYG--GDDRVPKITRHVQDGEQLQVGQLTVKCLHTPCHTSGHICY 123

Query: 122 HFMNDHFL----CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDK-THIYFGHEYTEN 176
            F   +        GDT+F  GCG+ FE +  +M+++L +  +     T ++ GHEYT N
Sbjct: 124 FFPASNGDAPAVFTGDTMFIAGCGKFFEGTADQMYKALVEKLAKLPDATRVFCGHEYTIN 183

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA   +P N  +    +  +  R++N  T PSTI+ EK  NPF+R+  +++ K+ ++
Sbjct: 184 NLKFAAKVEPGNQAIVDKMAWAEKKRAKNEPTVPSTIAEEKTFNPFMRVNESAVHKHAHL 243

Query: 237 ENASNLAVFTELRIRKNQSK 256
                ++    LR  K+  +
Sbjct: 244 N--DPISTMAYLRKEKDHFR 261


>gi|257051014|sp|Q28333|GLO2_CALJA RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial;
           AltName: Full=Germ cell-specific protein; AltName:
           Full=Glyoxalase II; Short=Glx II; Flags: Precursor
          Length = 280

 Score =  178 bits (450), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      + +  ++ G  LT +  THHH DH   N  
Sbjct: 26  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVEEAKKHGVMLTTVLTTHHHWDHAGGNEK 85

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L K              +I G+ H  +   T   GS  +K ++TP HT GHICY      
Sbjct: 86  LVKLEPGLKVY--GGDDRIGGLTHKGTHLSTLQVGSLNVKCLSTPCHTSGHICYFVTKPG 143

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +  F   T +Y GHEYT NN  FA
Sbjct: 144 GSQPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRFPPDTRVYCGHEYTINNLKFA 203

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +  N  +Q+  +  K   S      PST++ E   NPF+R+   +++++        
Sbjct: 204 RHVESGNAAVQEKLAWAKEKYSIGEPAVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 261

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 262 VPTMRAVRREKDQFK 276


>gi|1167481|emb|CAA64612.1| ORF [Callithrix jacchus]
          Length = 260

 Score =  178 bits (450), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 112/255 (43%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      + +  ++ G  LT +  THHH DH   N  
Sbjct: 6   LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVEEAKKHGVMLTTVLTTHHHWDHAGGNEK 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM--- 124
           L K              +I G+ H  +   T   GS  +K ++TP HT GHICY      
Sbjct: 66  LVKLEPGLKVY--GGDDRIGGLTHKGTHLSTLQVGSLNVKCLSTPCHTSGHICYFVTKPG 123

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDS-YAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFA 181
                 +  GDTLF  GCG+ +E +        LE +  F   T +Y GHEYT NN  FA
Sbjct: 124 GSQPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRFPPDTRVYCGHEYTINNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
              +  N  +Q+  +  K   S      PST++ E   NPF+R+   +++++        
Sbjct: 184 RHVESGNAAVQEKLAWAKEKYSIGEPAVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDP 241

Query: 242 LAVFTELRIRKNQSK 256
           +     +R  K+Q K
Sbjct: 242 VPTMRAVRREKDQFK 256


>gi|71907227|ref|YP_284814.1| Beta-lactamase-like [Dechloromonas aromatica RCB]
 gi|123627642|sp|Q47FN7|GLO2_DECAR RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|71846848|gb|AAZ46344.1| Beta-lactamase-like protein [Dechloromonas aromatica RCB]
          Length = 265

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 83/265 (31%), Positives = 127/265 (47%), Gaps = 23/265 (8%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I  + DN+  L+   + +    +D  D   +   L   G  L  I  THHH DH      
Sbjct: 7   IPAFKDNYIWLL--TRGKRAFVVDPGDAAPVLARLEAGGLMLEGILITHHHADHQGGVAE 64

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LK  +   ++     +  I G    LS G++ D     + ++A PGHT+GH+ Y+     
Sbjct: 65  LKARWQAEVY--APGNESITGCSCPLSGGESIDVLGQKVTVMAVPGHTLGHLAYYAPGA- 121

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF  GCGR+FE + A+M  SL+ I +    T IY  HEYTE N  FAL+ +P+
Sbjct: 122 -LLCGDTLFGAGCGRLFEGTPAQMSASLDSIAALPGDTLIYCAHEYTEMNLRFALAVEPN 180

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSL----------------- 230
           N  LQ   +KV ++R+  L + P  ++ EK  NPFLR    ++                 
Sbjct: 181 NQALQARVAKVAALRAAGLPSVPLILAEEKATNPFLRCHEAAVVEAGLQHAASCLLGHAA 240

Query: 231 RKNLNMENASNLAVFTELRIRKNQS 255
           ++  ++E+ S  A+F  +R  +N  
Sbjct: 241 QQGADIEDRSKTAIFAAIRSWRNTF 265


>gi|312382356|gb|EFR27844.1| hypothetical protein AND_04981 [Anopheles darlingi]
          Length = 263

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/265 (27%), Positives = 126/265 (47%), Gaps = 12/265 (4%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S+ +  I    DNF  L+  ++ R  A +D  +   + ++++E G  L  +  THHH 
Sbjct: 1   MASMTVKKIPALKDNFMYLVVCNETRKAAVVDPVEPDRVLEVVKEDGVQLNQLLTTHHHW 60

Query: 60  DHTRANLNLKKFFNCTIFG-----PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGH 114
           DH   N  L + F                 +I  + + +   DTF+ G   ++ ++TP H
Sbjct: 61  DHAGGNEALYQKFRENPEWGELLVYGGNDDRIDRLTNRVGQDDTFEIGKLRVRCLSTPCH 120

Query: 115 TIGHICYHFMNDHFL--CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGH 171
           T  HICY+   D       GDTLF  GCGR FE +  +M+++ + K+ +  D T +Y GH
Sbjct: 121 TTSHICYYIETDQDRAVFTGDTLFLAGCGRFFEGTPEQMYDALINKLSALPDDTKVYCGH 180

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT-NPSTISLEKKVNPFLRIENTSL 230
           EY+  N  F  + +P N + +    K ++   +      PSTI  EK+ N F+R+   S+
Sbjct: 181 EYSVQNLRFGNTVEPDNADTKALLEKAQAADLEGRRALVPSTIGQEKRTNVFMRVGEPSV 240

Query: 231 RKNLNMENASNLAVFTELRIRKNQS 255
           +  +    ++ L     +R  K++ 
Sbjct: 241 QAFVGK--STPLETMQAVRAAKDKF 263


>gi|209545180|ref|YP_002277409.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532857|gb|ACI52794.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 242

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 89/250 (35%), Positives = 128/250 (51%), Gaps = 14/250 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            + +  DN+   + +     TA +D  +   +   + E G  L  IF THHH DH  A  
Sbjct: 7   PVPILTDNYAWFLRDEDSGATALVDPAEEAPLVTAVEEAGGRLDQIFLTHHHADHVAATD 66

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+K F   + G   ++ ++P +D  +++GD    G     ++ TPGHT GHI +HF   
Sbjct: 67  ALRKRFGAIVTGAAADAYRLPMLDQAVAEGDDIALGGAIGTVMETPGHTRGHIAFHFPLV 126

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE S  EMF SL +I +  D T I  GHEYT +NA FA   +P
Sbjct: 127 PALFCGDTLFSLGCGRLFEGSAEEMFHSLRRIAALPDATLICCGHEYTLSNARFAQEVEP 186

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  L    +++  +R++   T P  + LEK+ NPFLR              A ++A F 
Sbjct: 187 ENAALHARVAEIDILRAEARPTVPVRLGLEKQTNPFLR--------------APDVATFA 232

Query: 247 ELRIRKNQSK 256
            LR  K+  +
Sbjct: 233 RLRREKDAFR 242


>gi|162149076|ref|YP_001603537.1| hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787653|emb|CAP57249.1| Hydroxyacylglutathione hydrolase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 254

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 89/250 (35%), Positives = 128/250 (51%), Gaps = 14/250 (5%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
            + +  DN+   + +     TA +D  +   +   + E G  L  IF THHH DH  A  
Sbjct: 19  PVPILTDNYAWFLRDEDSGATALVDPAEEAPLVTAVEEAGGRLDQIFLTHHHADHVAATD 78

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L+K F   + G   ++ ++P +D  +++GD    G     ++ TPGHT GHI +HF   
Sbjct: 79  ALRKRFGAIVTGAAADAYRLPMLDQAVAEGDDIALGGAIGTVMETPGHTRGHIAFHFPLV 138

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE S  EMF SL +I +  D T I  GHEYT +NA FA   +P
Sbjct: 139 PALFCGDTLFSLGCGRLFEGSAEEMFHSLRRIAALPDATLICCGHEYTLSNARFAQEVEP 198

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFT 246
            N  L    +++  +R++   T P  + LEK+ NPFLR              A ++A F 
Sbjct: 199 ENAALHARVAEIDILRAEARPTVPVRLGLEKQTNPFLR--------------APDVATFA 244

Query: 247 ELRIRKNQSK 256
            LR  K+  +
Sbjct: 245 RLRREKDAFR 254


>gi|120538690|gb|AAI29447.1| Im:7147352 protein [Danio rerio]
          Length = 343

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/263 (28%), Positives = 116/263 (44%), Gaps = 12/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  ++ +        +D  D   +   L  +G  L  +  TH H DH+  N
Sbjct: 79  IPVPILLDNYSYVVIDTASNTAVVVDPADPQPVQACLEAEGVALQAVLCTHKHWDHSGGN 138

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             LK+ ++          +        L             +   TPGHT+GH+ Y    
Sbjct: 139 RALKRRYSSCRVYGNAMDNIPGLTHPLLDKDTIDFGTQLHFRAFYTPGHTVGHMIYLLDG 198

Query: 123 --FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                   L  GD +F  GCGR+FE + + M  SL+ + S +D T ++ GHEY E+N  F
Sbjct: 199 RAIGGPSSLFSGDLVFLSGCGRMFEGNASTMLSSLDTVGSLNDDTLLWPGHEYAEDNLLF 258

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   +P N+  ++    V   RSQ L T PST+  EK+ NPFLR  +  L + L ++   
Sbjct: 259 AADVEPGNVVREQKLQWVLQQRSQRLCTCPSTLLEEKQYNPFLRSHSQDLHQALGLQQKQ 318

Query: 241 NLA-------VFTELRIRKNQSK 256
           +         V  ELR RK+  K
Sbjct: 319 DEDWTSYRARVLEELRRRKDIYK 341


>gi|92116087|ref|YP_575816.1| hydroxyacylglutathione hydrolase [Nitrobacter hamburgensis X14]
 gi|122418732|sp|Q1QQZ1|GLO2_NITHX RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91798981|gb|ABE61356.1| Hydroxyacylglutathione hydrolase [Nitrobacter hamburgensis X14]
          Length = 255

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 144/245 (58%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DNF +LIH+     TAAIDAP+   I + L  +GW LT I  THHH DH      LK
Sbjct: 10  CLTDNFGVLIHDPATDATAAIDAPEAGPIIEALDREGWTLTDILVTHHHADHIGGIAELK 69

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           + + C +  P ++ + I  +D  +  GD    G+   +++ TPGHT+ HI Y F ++  +
Sbjct: 70  QKYKCRVVAPHDKKAPIANVDLRVGQGDIVKVGTLLGRVLETPGHTLDHISYVFDDEKVV 129

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
              DTLFS+GCGR+ E +Y  M++SL K+++  D   +Y GHEYT +N  FAL+ +P+N 
Sbjct: 130 FAADTLFSIGCGRVIEGTYPMMWDSLLKLRALPDDFRLYCGHEYTASNVKFALTVEPNNA 189

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L+     V  +R++N  T P+ +  EKK N FLR ++ ++   ++M+ AS   VF ELR
Sbjct: 190 ALKARAEDVARLRAENKPTVPTLMGEEKKANVFLRADDPAVAAGVHMKGASGADVFGELR 249

Query: 250 IRKNQ 254
            RKN+
Sbjct: 250 ERKNK 254


>gi|238750481|ref|ZP_04611982.1| Hydroxyacylglutathione hydrolase [Yersinia rohdei ATCC 43380]
 gi|238711412|gb|EEQ03629.1| Hydroxyacylglutathione hydrolase [Yersinia rohdei ATCC 43380]
          Length = 268

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 136/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 21  ISIPAFQDNYIWLLVDAQ-KRCVIVDPGESAPVLAALNQGQYLPQAILLTHHHHDHVGGV 79

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L++ +        +E++   G    ++ GD    G    +I A PGHT+GHI Y+   
Sbjct: 80  ADLRQHYPDIPVYGPQETA-NKGATIIVNGGDNLTIGDQNYRIFAVPGHTLGHIAYYS-- 136

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE + A+M+ S++++    D+T I   HEYT  N  FA    
Sbjct: 137 APYLFCGDTLFSAGCGRLFEGTPAQMYSSIQQLAQLPDETLICSAHEYTLANLKFARFIL 196

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R++NL + P  + +E+K+N FLR  +  L++ + + +  +  ++
Sbjct: 197 PSDQDIATYQQQIMQLRAKNLPSLPVKLHIERKINVFLRCNDIDLQRKIGVISPPDSLVS 256

Query: 244 VFTELRIRKNQS 255
           VF+ELR +K++ 
Sbjct: 257 VFSELRAQKDRF 268


>gi|120599053|ref|YP_963627.1| hydroxyacylglutathione hydrolase [Shewanella sp. W3-18-1]
 gi|226724030|sp|A1RK78|GLO2_SHESW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|120559146|gb|ABM25073.1| Hydroxyacylglutathione hydrolase [Shewanella sp. W3-18-1]
          Length = 267

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 126/270 (46%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLVSHQLALAGILLTHHHQD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--------SHPIKIIATP 112
           HT     LK++   T    L+           ++     +          +  I+++  P
Sbjct: 60  HTGGVGELKRYVEQTSSQTLQVYGPQKENIAHVNVPLNPEMRTELTLPFLNAQIQVLNVP 119

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    +  L  GDTLFS GCGR+FE +  +M  SL  +      T ++  HE
Sbjct: 120 GHTAGHIAYVI--EDALFCGDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHE 177

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT +N  FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  
Sbjct: 178 YTLSNLKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIID 237

Query: 233 NLNMENASN-------LAVFTELRIRKNQS 255
           ++              L  FT LR  K+  
Sbjct: 238 SIKQHFDDPDPIKLDELTCFTRLRQWKDIF 267


>gi|318844050|ref|NP_001188161.1| hydroxyacylglutathione hydrolase-like protein [Ictalurus punctatus]
 gi|308323581|gb|ADO28926.1| hydroxyacylglutathione hydrolase-like protein [Ictalurus punctatus]
          Length = 280

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 124/255 (48%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           IS+  DN+  L+ + + +   A+D    + + +++  +G  LT +  THHH DH R N  
Sbjct: 6   ISILEDNYMYLVIDEQSKEAIAVDPAVPHRLLEIVNREGVRLTAVLTTHHHWDHARGNDA 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K              +I G+ H +++G    F +  ++ + TP HT GH+CY    D 
Sbjct: 66  LLKDLPDLRVY--GGDDRITGLTHKVTNGQELKFNTINVRCLFTPCHTSGHMCYFLWEDG 123

Query: 128 FL-----CVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYFA 181
                    GDTLF  GCG+ FE +  +M+ +L K+  +    T ++ GHEYT  N  FA
Sbjct: 124 CPDSPAVFTGDTLFVGGCGKFFEGTAEQMYHNLTKVLGTLPQDTKVFCGHEYTIKNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           +  +P N  +++  S  ++    +  T PST+  E + NPFLR+    ++K      +  
Sbjct: 184 MLVEPENERVKEKLSWARARDEDDKPTVPSTLLEEFEYNPFLRLSEEDVQKFTG--KSDP 241

Query: 242 LAVFTELRIRKNQSK 256
           + V   LR  K+  K
Sbjct: 242 IEVLRVLRKEKDNFK 256


>gi|158288855|ref|XP_310681.3| AGAP000416-PA [Anopheles gambiae str. PEST]
 gi|157018772|gb|EAA06259.3| AGAP000416-PA [Anopheles gambiae str. PEST]
          Length = 265

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/267 (28%), Positives = 126/267 (47%), Gaps = 14/267 (5%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M S+ +  I    DNF  L+  +  R  A ID  +   + ++ RE+G  L  +  THHH 
Sbjct: 1   MASMTVTKIPALKDNFMYLVVCNATRQAAVIDPVEPARVLEVAREQGCKLNQLLTTHHHW 60

Query: 60  DHTRANLNLKKFFNCTIFG-----PLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGH 114
           DH   N  L + +              +  +IPG+ + +   DTF  G   ++ +ATP H
Sbjct: 61  DHAGGNEALCEQYRQHADWGQLTVYGGDDERIPGLTNRVGQDDTFAIGQLRVRCLATPCH 120

Query: 115 TIGHICYH----FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYF 169
           T  H+CY+       +  +  GDTLF  GCGR FE +  +M+++ + K+ +  D T +Y 
Sbjct: 121 TTSHVCYYVEGGDRGERAVFTGDTLFLAGCGRFFEGTPDQMYDALIGKLSALPDDTRVYC 180

Query: 170 GHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT-NPSTISLEKKVNPFLRIENT 228
           GHEY   N  F    +P N + +    + ++   +      PSTI  EK++N F+R+   
Sbjct: 181 GHEYALQNLRFGHQVEPDNADTRALLERAQAADLEGRRALVPSTIGQEKRINVFMRVHQP 240

Query: 229 SLRKNLNMENASNLAVFTELRIRKNQS 255
           +++  +     + L     LR  K++ 
Sbjct: 241 AVQAYVGK--GTPLETMQALRAAKDKF 265


>gi|94677028|ref|YP_588913.1| hydroxyacylglutathione hydrolase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|160386159|sp|Q1LT01|GLO2_BAUCH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|94220178|gb|ABF14337.1| hydroxyacylglutathione hydrolase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 257

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 83/253 (32%), Positives = 126/253 (49%), Gaps = 7/253 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           IAI    DN+  L+HN K      +D  D   +  +L      LT I  THHH DH +  
Sbjct: 4   IAIPALIDNYIWLLHNKK-GECLIVDPGDATPVLHILSNYQLKLTSILLTHHHPDHVKGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L ++F  TI+GP E   +   I   +  GD          +++ PGHT+GHI ++   
Sbjct: 63  KLLSQYFPVTIYGPQETFKQCANII--VKKGDFLVLLEKKFAVLSFPGHTLGHIGFYSYP 120

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDT+FS GCGRIFE +  +M+ES +++   S  T I   HEYT  N  FA S  
Sbjct: 121 --WLFCGDTVFSAGCGRIFEGTTKQMYESFQEVNQLSSHTLICCAHEYTLTNLAFASSLL 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA-- 243
           P +  +  Y   V  +R++   + P+ +SLE+ +NPF R  + +L + +N          
Sbjct: 179 PKDRIISSYQRHVTILRNKKKPSLPTKLSLERLINPFFRCHDINLHQAINFSPLLGCEWL 238

Query: 244 VFTELRIRKNQSK 256
           VF  LR +++  +
Sbjct: 239 VFDYLRQKRDNFR 251


>gi|319426194|gb|ADV54268.1| hydroxyacylglutathione hydrolase [Shewanella putrefaciens 200]
          Length = 267

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 126/270 (46%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLISHQLALAGILLTHHHQD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--------SHPIKIIATP 112
           HT     LK++   T    L+           ++     +          +  I+++  P
Sbjct: 60  HTGGVGELKRYVEQTSSQTLQVYGPQKENIAHVNVPLNPEMRTELTLPFLNAQIQVLNVP 119

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    +  L  GDTLFS GCGR+FE +  +M  SL  +      T ++  HE
Sbjct: 120 GHTAGHIAYVI--EDALFCGDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHE 177

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT +N  FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  
Sbjct: 178 YTLSNLKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIID 237

Query: 233 NLNMENASN-------LAVFTELRIRKNQS 255
           ++              L  FT LR  K+  
Sbjct: 238 SIKQHFDDPDPIKLDELTCFTRLRQWKDIF 267


>gi|189520161|ref|XP_001923240.1| PREDICTED: probable hydrolase PNKD [Danio rerio]
          Length = 361

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/263 (28%), Positives = 116/263 (44%), Gaps = 12/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + +  DN+  ++ +        +D  D   +   L  +G  L  +  TH H DH+  N
Sbjct: 97  IPVPILLDNYSYVVIDTASNTAVVVDPADPQPVQACLEAEGVALQAVLCTHKHWDHSGGN 156

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
             LK+ ++          +        L             +   TPGHT+GH+ Y    
Sbjct: 157 RALKRRYSSCRVYGNAMDNIPGLTHPLLDKDTIDFGTQLHFRAFYTPGHTVGHMIYLLDG 216

Query: 123 --FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
                   L  GD +F  GCGR+FE + + M  SL+ + S +D T ++ GHEY E+N  F
Sbjct: 217 RAIGGPSSLFSGDLVFLSGCGRMFEGNASTMLSSLDTVGSLNDDTLLWPGHEYAEDNLLF 276

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A   +P N+  ++    V   RSQ L T PST+  EK+ NPFLR  +  L + L ++   
Sbjct: 277 AADVEPGNVVREQKLQWVLQQRSQRLCTCPSTLLEEKQYNPFLRSHSQDLHQALGLQQKQ 336

Query: 241 NLA-------VFTELRIRKNQSK 256
           +         V  ELR RK+  K
Sbjct: 337 DEDWTSYRARVLEELRRRKDIYK 359


>gi|238799155|ref|ZP_04642608.1| Hydroxyacylglutathione hydrolase [Yersinia mollaretii ATCC 43969]
 gi|238716996|gb|EEQ08859.1| Hydroxyacylglutathione hydrolase [Yersinia mollaretii ATCC 43969]
          Length = 267

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 134/252 (53%), Gaps = 6/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  + DN+  L+ + + +    +D  ++  +   L +  +    I  THHH DH    
Sbjct: 20  ISIPAFQDNYIWLLADPQ-KQCVIVDPGESAPVLAALSQGQYTPQAILLTHHHHDHVGGV 78

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L++ F        +E++   G    ++ G+         ++IA PGHT+GHI Y+   
Sbjct: 79  ADLRRHFPDIPVYGPQETA-NKGATIIVNGGNELTISGQNYRVIAVPGHTLGHIAYYSKP 137

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S++++    D T I   HEYT  N  FA S  
Sbjct: 138 --YLFCGDTLFSGGCGRLFEGTPEQMYMSIQQLAQLPDDTLICSAHEYTLANLKFARSLL 195

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN--LA 243
           P + ++  Y  ++  +R+++L + P  +  E+K+N FLR  +  L++ + + +  +  ++
Sbjct: 196 PLDQDIATYQQQIMQLRAKDLPSLPVKLQFERKINVFLRCNDVDLQREIGVISPPSSLVS 255

Query: 244 VFTELRIRKNQS 255
           VF+ELR RK++ 
Sbjct: 256 VFSELRSRKDRF 267


>gi|170740305|ref|YP_001768960.1| hydroxyacylglutathione hydrolase [Methylobacterium sp. 4-46]
 gi|254798848|sp|B0UBD0|GLO2_METS4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|168194579|gb|ACA16526.1| hydroxyacylglutathione hydrolase [Methylobacterium sp. 4-46]
          Length = 255

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 122/247 (49%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN  +LI +      AAID P+   + ++L E GW LT I  TH H DH      +K
Sbjct: 9   CRSDNIGVLIRDPATGACAAIDVPEAGAVLRVLGETGWSLTDILVTHRHFDHVEGTPEVK 68

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
                 +  P +    +P +D  + +GD    GS    +  TPGH   H+ Y F  +   
Sbjct: 69  ARTGARVTAPAKAGDAVPEVDATVREGDAVRLGSLVAAVWETPGHCADHVTYWFERERIA 128

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+ E     ++ SL +  +  D+T IY GH+Y  +NA FAL+ DP N 
Sbjct: 129 FAGDTLFTLGCGRVMESPPEVLWRSLSRFLALPDETAIYSGHDYVLSNARFALAADPDNP 188

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFTEL 248
            L+      + ++    +  P+T+  EK  NPFLR    +L + + M   +   AVFT L
Sbjct: 189 NLKARAELAERVKRDGRFLIPTTLGEEKATNPFLRATEPALARAVGMAPGSDPAAVFTAL 248

Query: 249 RIRKNQS 255
           R  KN+ 
Sbjct: 249 REWKNRF 255


>gi|297697778|ref|XP_002826024.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           [Pongo abelii]
          Length = 297

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 100/249 (40%), Gaps = 10/249 (4%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DN+  L+ + + +  A +D      +    R+ G  LT +  THHH DH   N  
Sbjct: 55  LPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEK 114

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           L K  +           +I  + H ++   T   GS  +K +ATP HT GHICY      
Sbjct: 115 LVKLESGLKVY--GGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSK-- 170

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
                                      LE +      T +Y GHEYT NN  FA   +P 
Sbjct: 171 ----PGGSEPPAVFTXXXXXXXXXKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPG 226

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N  +Q+  +  K   S    T PST++ E   NPF+R+   +++++        +     
Sbjct: 227 NAAIQEKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAG--ETDPVTTMRA 284

Query: 248 LRIRKNQSK 256
           +R  K+Q K
Sbjct: 285 VRREKDQFK 293


>gi|239833061|ref|ZP_04681390.1| hydroxyacylglutathione hydrolase [Ochrobactrum intermedium LMG
           3301]
 gi|239825328|gb|EEQ96896.1| hydroxyacylglutathione hydrolase [Ochrobactrum intermedium LMG
           3301]
          Length = 260

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 111/246 (45%), Positives = 154/246 (62%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA+IDAPD   +   L+ +GW L  IF THHH+DH   N  LK
Sbjct: 15  CRSDNYGVLIHDPQSALTASIDAPDAAAVEAALKRRGWTLDFIFTTHHHLDHVEGNEALK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             +   I GP  E +KIPGID  + DGD F FG   +K IATPGHT G I Y+  +   +
Sbjct: 75  AKYGVGIIGPKAEETKIPGIDRTVKDGDEFTFGLFRVKAIATPGHTAGEISYYIPDAKAV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE +   MF+SL K+ +    T +Y GHEYTE+NA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPLTMFQSLLKLIALPGDTAVYCGHEYTESNARFALTIDPANS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  +++  +R+ +  T PS+I+LE   NPFLR  +  +R  L +++A + AVF E+R
Sbjct: 195 ALKERAAEIARLRAADRMTLPSSIALEMATNPFLRWHDAGIRSRLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|146292876|ref|YP_001183300.1| hydroxyacylglutathione hydrolase [Shewanella putrefaciens CN-32]
 gi|226724028|sp|A4Y6B8|GLO2_SHEPC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|145564566|gb|ABP75501.1| Hydroxyacylglutathione hydrolase [Shewanella putrefaciens CN-32]
          Length = 267

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 84/270 (31%), Positives = 126/270 (46%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++    +     +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AIKAFNDNYIWVLQQTPHSQVYVVDPGDAKVVIAYLVSHQLALAGILLTHHHQD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFG--------SHPIKIIATP 112
           HT     LK++   T    L+           ++     +          +  I+++  P
Sbjct: 60  HTGGVGELKRYVEQTSSQTLQVYGPQKENIAHVNVPLNPEMRTELTLPFLNAQIQVLNVP 119

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    +  L  GDTLFS GCGR+FE +  +M  SL  +      T ++  HE
Sbjct: 120 GHTAGHIAY--FIEDALFCGDTLFSAGCGRLFEGTAEQMLSSLTLLAKLPANTRVFCAHE 177

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT +N  FAL+ +P+NL LQ Y  K   MR+QN  T PS+I+LE+ +NPFLR+   S+  
Sbjct: 178 YTLSNLKFALTVEPNNLNLQAYMQKATEMRAQNSATIPSSIALERAINPFLRVGEQSIID 237

Query: 233 NLNMENASN-------LAVFTELRIRKNQS 255
           ++              L  FT LR  K+  
Sbjct: 238 SIKQHFDDPDPIKLDELTCFTRLRQWKDIF 267


>gi|114776985|ref|ZP_01452005.1| Hydroxyacylglutathione hydrolase [Mariprofundus ferrooxydans PV-1]
 gi|114552506|gb|EAU54966.1| Hydroxyacylglutathione hydrolase [Mariprofundus ferrooxydans PV-1]
          Length = 262

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 96/251 (38%), Positives = 132/251 (52%), Gaps = 5/251 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           + +  DN+  LI  H       ID  +   + +  RE G  LTHIFNTHHH DHT  N +
Sbjct: 14  LPVLKDNYIYLIEAHASSALIVIDPAEAVSVRRACRELGKPLTHIFNTHHHWDHTDGNQS 73

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           LKK F   + G   ++ +IPGI+  +S+          I+++   GHT GHI Y    D 
Sbjct: 74  LKKDFGAVVIGAAHDAERIPGINLKVSEASPPLVDGLNIRVLDVAGHTRGHIAYLL--DD 131

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
            L  GDTLF  GCGR+FE + A+M++SL+KI      T IY  HEYT  N  FA+  DP 
Sbjct: 132 ALFCGDTLFGAGCGRLFEGTPAQMWQSLQKIAQLDGNTRIYCAHEYTLANLAFAVMVDPE 191

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLR---KNLNMENASNLAV 244
           N  L++  ++    R Q++ T PSTI +EK  NPFLR  + +               LAV
Sbjct: 192 NSTLKERLARDSEKRQQDIPTIPSTIEIEKATNPFLRPLDAAFLSAYAAGKAVKPEALAV 251

Query: 245 FTELRIRKNQS 255
           FT +R +K+  
Sbjct: 252 FTHIRQQKDHF 262


>gi|301755764|ref|XP_002913715.1| PREDICTED: probable hydrolase PNKD-like [Ailuropoda melanoleuca]
          Length = 385

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/260 (31%), Positives = 118/260 (45%), Gaps = 13/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L ++              IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRWHQDCRVYG-NPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKN 253
              +  S   +  +LR  K+
Sbjct: 361 TGDDGYSRAQLLEKLRQLKD 380


>gi|281340234|gb|EFB15818.1| hypothetical protein PANDA_001557 [Ailuropoda melanoleuca]
          Length = 332

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/260 (31%), Positives = 118/260 (45%), Gaps = 13/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 69  LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 128

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L ++              IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 129 RDLSRWHQDCRVYG-NPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 187

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 188 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 247

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 248 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALGPGPGP 307

Query: 235 -NMENASNLAVFTELRIRKN 253
              +  S   +  +LR  K+
Sbjct: 308 TGDDGYSRAQLLEKLRQLKD 327


>gi|153008258|ref|YP_001369473.1| hydroxyacylglutathione hydrolase [Ochrobactrum anthropi ATCC 49188]
 gi|160395511|sp|A6WXE0|GLO2_OCHA4 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|151560146|gb|ABS13644.1| Hydroxyacylglutathione hydrolase [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 111/246 (45%), Positives = 157/246 (63%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN+ +LIH+ +  LTA+IDAPD   I   L+ +GW L  IF THHH+DH   N  LK
Sbjct: 15  CRSDNYGVLIHDPQSALTASIDAPDAAAIEAALKRRGWTLDFIFTTHHHLDHVEGNEALK 74

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
             +  +I GP  E +KIPGID  + DGD F FG   +K+IATPGHT G + Y+  +   +
Sbjct: 75  AKYGVSIIGPKAEETKIPGIDRTVKDGDEFTFGLFRVKVIATPGHTAGEVSYYLPDAKAV 134

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+FE +   MF+SL+K+ +    T +Y GHEYTE+NA FAL+ DP N 
Sbjct: 135 FTGDTLFALGCGRLFEGTPLTMFQSLQKLVALPGDTAVYCGHEYTESNARFALTIDPANS 194

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTELR 249
            L++  +++  +R+ +  T PS+I+LE   NPFLR  +  +R  L +++A + AVF E+R
Sbjct: 195 ALKERAAEIARLRAADRMTLPSSIALEMATNPFLRWHDAGIRSRLGLQDAPDEAVFAEIR 254

Query: 250 IRKNQS 255
            RK+  
Sbjct: 255 KRKDMF 260


>gi|126728273|ref|ZP_01744089.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sagittula stellata E-37]
 gi|126711238|gb|EBA10288.1| putative hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II)
           protein [Sagittula stellata E-37]
          Length = 253

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 131/255 (51%), Gaps = 2/255 (0%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M    + +    DN+  ++        A IDAP+   +  +L  +GW    I  THHH D
Sbjct: 1   MPLDIVTVPCLKDNYAYIVKGPDG--IALIDAPEAKPLINVLEHRGWTPDVIMITHHHHD 58

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      L++ + C + GP  E  K+P +D  L  G +        ++I  PGHT+GH+ 
Sbjct: 59  HVGGVDELREKYGCKVMGPAAEKDKLPELDMALEPGFSGGTDDGLCEVIPVPGHTLGHVA 118

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           YH+     L   D+L  +GCGR+FE +   M+ESL  + +   +T +  GHEY E+NA F
Sbjct: 119 YHYPEAKCLFSADSLMVMGCGRVFEGTPEMMWESLSTLAALDPQTIVCSGHEYGESNAAF 178

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A + +P N  L      +   R +   T    + +E + NPFLR    S++K L ME+AS
Sbjct: 179 AKTIEPDNPGLISRAQMITVARGRGQPTAQVPLYIELQTNPFLRAGQASVKKALGMEDAS 238

Query: 241 NLAVFTELRIRKNQS 255
           +L VFTE+R RK++ 
Sbjct: 239 DLEVFTEIRARKDKF 253


>gi|220920492|ref|YP_002495793.1| hydroxyacylglutathione hydrolase [Methylobacterium nodulans ORS
           2060]
 gi|254798847|sp|B8ICA2|GLO2_METNO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|219945098|gb|ACL55490.1| hydroxyacylglutathione hydrolase [Methylobacterium nodulans ORS
           2060]
          Length = 255

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 124/247 (50%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN  +L+H+      AAID P+   + + L+E GW LT I  TH H DH      +K
Sbjct: 9   CRSDNIGVLLHDPVTSACAAIDVPEAGAVLRALKETGWRLTDILVTHRHFDHVEGIPEVK 68

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
                 +  P +    +P +D  + +GD    GS    +  TPGH   H+ Y F  +   
Sbjct: 69  ARTGARVTAPAKAGDAVPEVDATVREGDVVKVGSLVGTVWETPGHCADHVTYWFERERLA 128

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
             GDTLF+LGCGR+ E     ++ SL +  +  D+T IY GH+Y  +NA FAL+ DP N 
Sbjct: 129 FAGDTLFTLGCGRVMESPPEVLWRSLSRFLALPDETAIYSGHDYVLSNARFALAADPDNS 188

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFTEL 248
            L+      + ++    +  P+T+  EK  NPFLR    +L ++++M   +   AVF  L
Sbjct: 189 NLKARAELAERVKRDGRFLIPTTLGEEKATNPFLRAGEPALARSVDMAPGSDPAAVFAAL 248

Query: 249 RIRKNQS 255
           R  KN+ 
Sbjct: 249 REWKNRF 255


>gi|50510835|dbj|BAD32403.1| mKIAA1184 protein [Mus musculus]
          Length = 388

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 125 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 184

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 185 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 243

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 244 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 303

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 304 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGP 363

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 364 TSDDGCSRAQLLEELRRLKDMHK 386


>gi|37747507|gb|AAH58945.1| Pnkd protein [Mus musculus]
          Length = 424

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 161 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 220

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 221 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 279

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 280 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 339

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 340 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGP 399

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 400 TSDDGCSRAQLLEELRRLKDMHK 422


>gi|26334311|dbj|BAC30873.1| unnamed protein product [Mus musculus]
          Length = 345

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 82  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 141

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 142 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 200

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 201 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 260

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 261 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGP 320

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 321 TSDDGCSRAQLLEELRRLKDMHK 343


>gi|87239984|ref|NP_001034598.1| probable hydrolase PNKD isoform 3 [Mus musculus]
 gi|158564323|sp|Q69ZP3|PNKD_MOUSE RecName: Full=Probable hydrolase PNKD; AltName:
           Full=Myofibrillogenesis regulator 1; Short=MR-1;
           AltName: Full=Paroxysmal nonkinesiogenic dyskinesia
           protein
          Length = 385

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGP 360

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 361 TSDDGCSRAQLLEELRRLKDMHK 383


>gi|327260342|ref|XP_003214993.1| PREDICTED: probable hydrolase PNKD-like [Anolis carolinensis]
          Length = 361

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 124/268 (46%), Gaps = 15/268 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  L   I +  +N+  L+ +       A+D  D   +  ++ ++G  L  I  TH H D
Sbjct: 95  MKIL--PIPVLSNNYSYLVIDIDSNCAVAVDPSDPLAVQSVIEKEGVTLEAILCTHKHWD 152

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H+  N  LK+  +            IP +   LSD +T   G    K + TPGHT+GH+ 
Sbjct: 153 HSGGNAALKRRHSSCRVYGSSY-DDIPELTDPLSDKETITIGRLNFKALFTPGHTVGHMV 211

Query: 121 YH-----FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTE 175
           Y      F     L  GD LF  GCGRIFE +   M  SL+   + ++ T ++ GHEY  
Sbjct: 212 YLLDGKPFEGPASLFSGDLLFLSGCGRIFEGTPETMLASLDLAANLAEDTLLWPGHEYAL 271

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
               FA   +P N  L +    V   R++   T PSTI  EK+ NPFLR    +++  + 
Sbjct: 272 ECLMFANLLEPENPFLLQKLQWVNQQRTEKRSTCPSTIGEEKQYNPFLRTHCQAIQDAMG 331

Query: 236 M--ENASNLAVF-----TELRIRKNQSK 256
           +  ++  +  VF      E+R+RK+  K
Sbjct: 332 LQRQSGEDWDVFRARVLKEVRLRKDVYK 359


>gi|94496106|ref|ZP_01302684.1| Zn-dependent hydrolase [Sphingomonas sp. SKA58]
 gi|94424285|gb|EAT09308.1| Zn-dependent hydrolase [Sphingomonas sp. SKA58]
          Length = 243

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 129/246 (52%), Gaps = 14/246 (5%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           I    DN+  L+H+     T  ID      + +  + +GW +  I+NTH H DHT  N  
Sbjct: 10  IPALSDNYIWLMHDSASGDTVVIDPAVADPVLEAAQARGWRIGQIWNTHWHGDHTGGNAA 69

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDH 127
           +K    CT+ GP  E+ +I  +D  + +GD    G H  +++A P HT GHI YH  +D 
Sbjct: 70  IKAATGCTVTGPAAEAERIDMLDRLVGEGDNVRIGDHIAQVMAMPAHTAGHITYHLSDDR 129

Query: 128 FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPH 187
              VGDTLF++GCGR+FE + A+MF +++++ +  D T IY  HEYT  N  FAL  +P 
Sbjct: 130 MAFVGDTLFAMGCGRLFEGTAAQMFANMQRLAALPDDTQIYCAHEYTLANGRFALGVEPD 189

Query: 188 NLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVFTE 247
           N+ L++    V++ R++   T P++I  E++ N F+R  +                   E
Sbjct: 190 NVALKQRMEAVEAARARGEPTVPTSIGAERETNIFMRARD--------------ADQLAE 235

Query: 248 LRIRKN 253
            R  K+
Sbjct: 236 RRAAKD 241


>gi|149908877|ref|ZP_01897537.1| hydroxyacylglutathione hydrolase [Moritella sp. PE36]
 gi|149808151|gb|EDM68092.1| hydroxyacylglutathione hydrolase [Moritella sp. PE36]
          Length = 258

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 117/256 (45%), Gaps = 8/256 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I  ++DN+  LI N +      +D      + +++ ++   L  I  THHH DH    
Sbjct: 5   ISIPTFNDNYVWLIKNTENNHCCIVDPGQADPVLQVINQQNLILEAILITHHHYDHIDGI 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI--CYHF 123
            ++       +      +  +      ++  +          +  T   T GH      +
Sbjct: 65  SDILNASTNPVQVYSSIAIDVDAPVTLVT--ENSQLNLLNNSLALTVMATPGHKREHVVY 122

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
            N   L  GDTLFS GCGR+ + S AE+F SL++IK+  +   +Y  HEYT+ N  F  +
Sbjct: 123 YNQTMLFSGDTLFSGGCGRLLDGSAAELFSSLQRIKALDENILVYPAHEYTQANLMFCYA 182

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME----NA 239
            +P N  L+K+      +R Q L T P+++  EK++N FLR    ++   +  +      
Sbjct: 183 VEPQNSALKKHIEHTAKLRQQGLPTVPNSLKNEKEINVFLRTNEATVSMAMEHKLLDILT 242

Query: 240 SNLAVFTELRIRKNQS 255
           S  AVFT LR+ K+  
Sbjct: 243 SEQAVFTALRVWKDHF 258


>gi|197927180|ref|NP_001128222.1| myofibrillogenesis regulator 1 isoform 1 [Rattus norvegicus]
          Length = 385

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/263 (30%), Positives = 117/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P N+  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 301 AGVVEPENVARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLALQEALGPGPGP 360

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 361 TSDDGCSRAQLLEELRRLKDMHK 383


>gi|9910442|ref|NP_064383.1| probable hydrolase PNKD isoform 1 [Mus musculus]
 gi|7670482|dbj|BAA95092.1| unnamed protein product [Mus musculus]
          Length = 360

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 116/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 97  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 156

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 157 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 215

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 216 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 275

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 276 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQEALGPGPGP 335

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 336 TSDDGCSRAQLLEELRRLKDMHK 358


>gi|71894757|ref|NP_001025808.1| hydroxyacylglutathione hydrolase-like protein [Gallus gallus]
 gi|75571430|sp|Q5ZLY2|HAGHL_CHICK RecName: Full=Hydroxyacylglutathione hydrolase-like protein
 gi|53127977|emb|CAG31261.1| hypothetical protein RCJMB04_4h5 [Gallus gallus]
 gi|60099059|emb|CAH65360.1| hypothetical protein RCJMB04_21j14 [Gallus gallus]
          Length = 282

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 121/255 (47%), Gaps = 10/255 (3%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           IS+  DN+  L+     R   A+DA     + +++R++   L  +  THHH DH R N  
Sbjct: 6   ISVLEDNYMYLVIEESTRDAVAVDAAVPKRLLEIVRKEDVVLRAVLITHHHWDHARGNEE 65

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND- 126
           L +              +I  + H ++  +   FG+  ++ + TP HT GH+CY    D 
Sbjct: 66  LVRLCPGLRVYGA--DERIGALTHRVAPDEELTFGAIRVRCLFTPCHTKGHMCYFMWEDG 123

Query: 127 ----HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKI-KSFSDKTHIYFGHEYTENNAYFA 181
                 L  GDTLF  GCG+  E +  +M+ +L ++      +T ++ GHE T  N  FA
Sbjct: 124 SLDAPALFSGDTLFVGGCGQFLEGTAEQMYTNLTQVLGDLPKETKVFCGHECTVRNLKFA 183

Query: 182 LSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASN 241
           L  +P N  ++K  +  +    ++L T PST+  E   NPFLR+   +++K    +    
Sbjct: 184 LKVEPENEAVKKKLAWARQRDDEDLPTVPSTLQEEFLYNPFLRVTEEAVQKFTGRK--EP 241

Query: 242 LAVFTELRIRKNQSK 256
           + V   LR  K+  K
Sbjct: 242 VEVLRALRTEKDNFK 256


>gi|300936083|ref|ZP_07151025.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 21-1]
 gi|300458758|gb|EFK22251.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 21-1]
          Length = 251

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 133/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI  ++ + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--YYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|55725426|emb|CAH89577.1| hypothetical protein [Pongo abelii]
          Length = 350

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/263 (30%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 87  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 146

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 147 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 205

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 206 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 265

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    ++  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 266 AGVVEPDNLARERKMQWMQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 325

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 326 TGDDDCSRAQLLEELRRLKDMHK 348


>gi|296532382|ref|ZP_06895113.1| hydroxyacylglutathione hydrolase [Roseomonas cervicalis ATCC 49957]
 gi|296267293|gb|EFH13187.1| hydroxyacylglutathione hydrolase [Roseomonas cervicalis ATCC 49957]
          Length = 243

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/256 (31%), Positives = 128/256 (50%), Gaps = 14/256 (5%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M     A+    DN+  ++ +      A  D  +   + + L   G     I  THHH D
Sbjct: 1   MAVTVQAVPCLSDNYAWMLRDQATGTVAICDPGEAGPVIEALEAAGGRCDIILLTHHHPD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHIC 120
           H      ++  F   + G   ++ ++P +D  ++ GDT   G+    +I +PGHTIGH+ 
Sbjct: 61  HVDGVEEVRARFGARVIGAAADAHRLPKLDQAVAPGDTVAIGATTGTVIDSPGHTIGHVA 120

Query: 121 YHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +HF     L  GDTLFSLGCGR+ E +  +MF +L  +K   D+T +  GHEYTE+NA F
Sbjct: 121 FHFPEGAVLLCGDTLFSLGCGRLLEGTAEDMFRALSLLKPLPDETLVCCGHEYTESNARF 180

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENAS 240
           A++ +P N  L++  ++V++ R+    T P T+  EK+ NPFLR              AS
Sbjct: 181 AVTVEPDNAALRERAAEVQAARAAGQPTLPVTLGREKETNPFLR--------------AS 226

Query: 241 NLAVFTELRIRKNQSK 256
             +    +R  K+  +
Sbjct: 227 TASELGRIRTAKDNFR 242


>gi|197927184|ref|NP_001128223.1| myofibrillogenesis regulator 1 isoform 2 [Rattus norvegicus]
          Length = 360

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/263 (30%), Positives = 117/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + +  L  A+D  D   +   + ++   L  I  TH H DH+  N
Sbjct: 97  LPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGN 156

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 157 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 215

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 216 EPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGF 275

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN----- 235
           A   +P N+  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 276 AGVVEPENVARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLALQEALGPGPGP 335

Query: 236 --MENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 336 TSDDGCSRAQLLEELRRLKDMHK 358


>gi|170070856|ref|XP_001869735.1| hydroxyacylglutathione hydrolase [Culex quinquefasciatus]
 gi|167866767|gb|EDS30150.1| hydroxyacylglutathione hydrolase [Culex quinquefasciatus]
          Length = 302

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/265 (28%), Positives = 128/265 (48%), Gaps = 12/265 (4%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  + +  I    DNF  L+  ++ +  A +D  +   + ++ +E G  LT +  THHH 
Sbjct: 40  MARMTVKKIPALKDNFMYLVVCNETKSAAIVDPVEPDRVLQVAKEAGVSLTKVLTTHHHW 99

Query: 60  DHTRANLNLKKFFNCTI-----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGH 114
           DH   N +L K +                 +I  + + +   DT + G+  ++ I+TP H
Sbjct: 100 DHAGGNADLWKRYQADPSLGKLSIYGGNDERIDNLTNPVGQDDTLEIGNLKVRCISTPCH 159

Query: 115 TIGHICYHF--MNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGH 171
           T  HICY+     D  +  GDTLF  GCGR FE +  +M+++ + K+ +  D T +Y GH
Sbjct: 160 TTSHICYYIETPEDKVVFTGDTLFLAGCGRFFEGTAQQMYDALITKLSALPDDTKVYCGH 219

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT-NPSTISLEKKVNPFLRIENTSL 230
           EY  NN  FA + +P N+++ +     K    +      PSTI  EK+ N F+R+    +
Sbjct: 220 EYALNNLRFASTVEPDNVDITQLLGIAKEADLEGRRAMVPSTIGQEKRTNVFMRVGEGVV 279

Query: 231 RKNLNMENASNLAVFTELRIRKNQS 255
           +K +    ++ L     LR  K++ 
Sbjct: 280 QKFVGK--STPLETMQALRAAKDKF 302


>gi|323975921|gb|EGB71016.1| hydroxyacylglutathione hydrolase [Escherichia coli TW10509]
          Length = 251

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRAEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|156935274|ref|YP_001439190.1| hydroxyacylglutathione hydrolase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166990457|sp|A7MI37|GLO2_ENTS8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|156533528|gb|ABU78354.1| hypothetical protein ESA_03127 [Cronobacter sakazakii ATCC BAA-894]
          Length = 251

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 129/251 (51%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++ + +    +D  +   + + L E  W    I  THHH DHT    
Sbjct: 5   SIPAFEDNYIWVLNDDEGK-CLLVDPGEAEPVFRALEENQWQPVAILLTHHHHDHTGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L   F        EE+ +  G    ++DG+ F+         +TPGHT+GH  Y     
Sbjct: 64  ALVARFPDITVYGPEET-RSKGAQVVVNDGEKFNILGCEFLAFSTPGHTLGHFSYFSFP- 121

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDT+FS GCGR+FE + A+M++S +KI +  + T I   HEYT +N  F ++  P
Sbjct: 122 -YLFCGDTMFSAGCGRLFEGTPAQMYQSFQKINALPEDTLICCAHEYTLSNLKFLVAILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLAV 244
            +  L +Y  +V  +R++N  T PS +  E+++N +LR+E+  L   +N  +  ++    
Sbjct: 181 DDPALTQYYREVNELRAKNQKTLPSILKNERQINLYLRLEDDDLIDKINPDLRLSTPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K+  
Sbjct: 241 FAWLRSKKDNF 251


>gi|167623801|ref|YP_001674095.1| hydroxyacylglutathione hydrolase [Shewanella halifaxensis HAW-EB4]
 gi|226724025|sp|B0TRL8|GLO2_SHEHH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|167353823|gb|ABZ76436.1| Hydroxyacylglutathione hydrolase [Shewanella halifaxensis HAW-EB4]
          Length = 258

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 82/261 (31%), Positives = 132/261 (50%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M  +   +  ++DN+  +  + +      +D  D  +++  L +    L  I  THHH D
Sbjct: 1   MLQIT-PLPAFNDNYIWVFQSQQSSGVYVVDPGDGQVVTDYLTQTNLPLLGILITHHHHD 59

Query: 61  HTRANLNLKKFF--NCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           HT     L K F  +  ++GP  E+          +   T +       +I  PGHT GH
Sbjct: 60  HTGGIEQLLKLFGEDTPVYGPQVENIAGVNRPISTNGNITLENIGLNTTVIQVPGHTSGH 119

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
           ICY    +  L  GDTLFS GCGR+FE +  +M++SL ++    D T ++  HEYT  N 
Sbjct: 120 ICYLI--EDALFCGDTLFSGGCGRLFEGTAEQMYQSLTQLSLLPDNTRVFCAHEYTLANL 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
           +FA + + +N  L +Y  K  ++R++N  T PS+I+LEK +NPFLR+++  ++K+L    
Sbjct: 178 HFAKAVEANNPALIEYTVKAHALRAENKPTLPSSIALEKAINPFLRLDSLEIQKSLAVQF 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
               A  +  F  LR  K+  
Sbjct: 238 QQPIADPVQSFALLRQWKDNF 258


>gi|114762056|ref|ZP_01441524.1| hydroxyacylglutathione hydrolase, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114545080|gb|EAU48083.1| hydroxyacylglutathione hydrolase, putative [Roseovarius sp.
           HTCC2601]
          Length = 251

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 89/250 (35%), Positives = 134/250 (53%), Gaps = 2/250 (0%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  L+          IDAP+   I + L  +GW L  +  THHH DH    
Sbjct: 4   VTVPCLSDNYAYLVKAPDG--VCLIDAPEAGPIIEALESRGWELDTLLITHHHHDHVGGV 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             L++ + CT+ GP  E +K+P +D  +  GDT      P+++I  PGHT+GH+ +HF +
Sbjct: 62  AELRERYGCTVVGPKAEEAKLPPLDTAVDGGDTLQVAGTPVEVIFVPGHTLGHVAFHFPD 121

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
              +   D+L +LGCGRIFE +   M+ESL K+ +   +T +  GHEYT  NA FAL+ +
Sbjct: 122 AQAVFTADSLMALGCGRIFEGTPDMMWESLSKLIALPPETLVCSGHEYTSANARFALTIE 181

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+     +   R++   T    +S E   NPFLR  +  +R  L M +A + AVF
Sbjct: 182 PGNEALKLRSDAIAKARTEGRATATCKLSEELATNPFLRPASPEIRDRLGMNDAPDAAVF 241

Query: 246 TELRIRKNQS 255
            E+R RK+  
Sbjct: 242 AEVRARKDSF 251


>gi|301021448|ref|ZP_07185472.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 69-1]
 gi|300398084|gb|EFJ81622.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 69-1]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQVVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|119471757|ref|ZP_01614117.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Alteromonadales
           bacterium TW-7]
 gi|119445380|gb|EAW26668.1| putative hydroxyacylglutathione hydrolase with
           metallo-hydrolase/oxidoreductase domain [Alteromonadales
           bacterium TW-7]
          Length = 257

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 118/255 (46%), Gaps = 9/255 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           AI  + DN+   +          +D      +   L  +   L  I  THHH DHT    
Sbjct: 6   AIKAFSDNYIWCLTTEGNAKAWVVDPGQAEPVLAHLAAENLTLGGILITHHHYDHTDGVA 65

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K          +  S   G+ H L D D+ D      K++ TPGHT+ HIC+    D
Sbjct: 66  QLVKDDPTIKVYGPKN-SPFKGVTHPLVDSDSIDVLGINFKVLTTPGHTLDHICFVN--D 122

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
           +    GDTLFS GCGR+FE +  +M+ SL K+K+      ++  HEYT+ N  FA + +P
Sbjct: 123 NMAFTGDTLFSGGCGRLFEGTSEQMWHSLNKLKTLPAGCKVFCTHEYTQANLTFAKAVEP 182

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME------NAS 240
            N  L  +   V  +R ++  + P+TIS E K+NPF+R +  ++ + +  E      N  
Sbjct: 183 RNPSLLAHSELVDELRKEDKISLPTTISQELKINPFMRSDIPTIIEEVPKEFISVTKNNE 242

Query: 241 NLAVFTELRIRKNQS 255
               F  LR  K+  
Sbjct: 243 PWHNFAALRKFKDNF 257


>gi|91793376|ref|YP_563027.1| hydroxyacylglutathione hydrolase [Shewanella denitrificans OS217]
 gi|123166083|sp|Q12MM2|GLO2_SHEDO RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91715378|gb|ABE55304.1| Hydroxyacylglutathione hydrolase [Shewanella denitrificans OS217]
          Length = 258

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/261 (31%), Positives = 119/261 (45%), Gaps = 9/261 (3%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI  ++DN+  ++          +D      +   +      L  +  TH H D
Sbjct: 1   MLTIT-AIPAFNDNYFWIVRQADSNFAYVVDPGVAQPVIDYILAHDLILAGVLITHKHAD 59

Query: 61  HTRANLNLKKFFNC--TIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGH 118
           H      L+ F+     ++GP  E       +               ++II  PGHT+GH
Sbjct: 60  HVGGIQGLQDFYQNSLPVYGPKAEGIAGITHEIIDERTLCLPHLEANVEIIPVPGHTLGH 119

Query: 119 ICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNA 178
             Y    +  +  GDTLFS+GCGRIFE S A+M  SL K+ S      IY  HEYT++N 
Sbjct: 120 HAYL--IEDAIFCGDTLFSVGCGRIFEGSAAQMLASLTKLASLPAHCKIYCAHEYTQSNI 177

Query: 179 YFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---- 234
            FAL+  P+N  L +Y S V   R+ N+ + PS +S E  VNPFLR     ++  +    
Sbjct: 178 NFALTVTPNNPNLLQYASWVAKARADNIPSLPSFLSTELAVNPFLRCHTYEVKTAVASQF 237

Query: 235 NMENASNLAVFTELRIRKNQS 255
           N E    L  FT LR  K+  
Sbjct: 238 NTEINDELQTFTLLRKWKDNF 258


>gi|304394183|ref|ZP_07376106.1| hydroxyacylglutathione hydrolase [Ahrensia sp. R2A130]
 gi|303293623|gb|EFL88000.1| hydroxyacylglutathione hydrolase [Ahrensia sp. R2A130]
          Length = 258

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 151/258 (58%), Gaps = 3/258 (1%)

Query: 1   MTSLNIAI---SLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHH 57
           MT   + I       DN+ I++     +    IDAP+   I  +L +KG  L  +  THH
Sbjct: 1   MTDSTLQIFQFPCRSDNYGIIMRERGAKEAICIDAPEVEPIEDVLEDKGLHLHTLLTTHH 60

Query: 58  HIDHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIG 117
           H DH   N +LK    CTI GP EE  +IPGID  ++ GD  +     +++I TPGHT+G
Sbjct: 61  HQDHVEGNKSLKASQKCTIIGPAEEEDRIPGIDQSVNHGDEIEVLGRRVQVIGTPGHTLG 120

Query: 118 HICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENN 177
            + Y+F +D  +   D LF++GCGRIFE     M  +L+++    D+T +Y GHEYT +N
Sbjct: 121 QVAYYFPDDGVVFAADALFAMGCGRIFEGDAEMMHTALQRLARLPDETKVYAGHEYTLSN 180

Query: 178 AYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME 237
           A FA+S D  N  L +   +V+ +R +   T P+TI+ EK  NPFLR+++ ++R  L ME
Sbjct: 181 AKFAVSVDGTNKRLLERAREVELLRDEGAPTLPTTIAEEKATNPFLRVKDPAIRAYLGME 240

Query: 238 NASNLAVFTELRIRKNQS 255
           +A ++ VF ELR+RK++ 
Sbjct: 241 DADDVDVFAELRVRKDRF 258


>gi|114047733|ref|YP_738283.1| hydroxyacylglutathione hydrolase [Shewanella sp. MR-7]
 gi|113889175|gb|ABI43226.1| Hydroxyacylglutathione hydrolase [Shewanella sp. MR-7]
          Length = 295

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 124/270 (45%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI+ ++DN+  ++     +    +D  D  ++   L +    L  I  THHH D
Sbjct: 29  MLTIT-AINAFNDNYIWVLRQDSQQNVYVVDPGDANVVLDYLHKHQLTLAGILITHHHRD 87

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF--------DFGSHPIKIIATP 112
           HT     L      T    L           G++              F   P+ I++ P
Sbjct: 88  HTGGIAALAAHVEQTTGHTLAVYGPQSEAIQGINLPIDPKPSDTLTLPFIDAPVHILSVP 147

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    D  L  GDTLFS GCGR+FE S A+M++SL  + +  D T +Y  HE
Sbjct: 148 GHTAGHIAYLV--DGALFCGDTLFSAGCGRLFEGSPAQMWQSLSLLAALPDTTRVYCAHE 205

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT  N  FA + D  N  L+ Y  +   +R+QN  T PSTI LE+ +NPFLR    ++  
Sbjct: 206 YTLANLKFAQAVDTDNEALKAYVKRANDLRAQNKATIPSTIELERAINPFLRPLAPTIVN 265

Query: 233 NLN-------MENASNLAVFTELRIRKNQS 255
           ++        +     L  FT LR  K+  
Sbjct: 266 SIKNQFCDQDLTKTDELTCFTLLRQWKDIF 295


>gi|24374106|ref|NP_718149.1| metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
 gi|81589197|sp|Q8EE27|GLO2_SHEON RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24348596|gb|AAN55593.1|AE015698_1 metallo-beta-lactamase family protein [Shewanella oneidensis MR-1]
          Length = 267

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/270 (30%), Positives = 119/270 (44%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI+ ++DN+  ++     +    +D  D  ++   L      L  I  THHH D
Sbjct: 1   MLTIT-AINAFNDNYIWVLQQDTQQAVYVVDPGDVNVVLDYLNAHQLTLAGILITHHHRD 59

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIAT--------P 112
           HT     L  +   T    L           G++                         P
Sbjct: 60  HTGGIAALVAYVEQTTGHTLAVYGPQSEAIQGVNIAIEPQITQILHLPFLNSPVQVLSVP 119

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    D  L  GDTLFS GCGR+FE + A+M  SL  + +   +T +Y  HE
Sbjct: 120 GHTAGHIAYLV--DGALFCGDTLFSGGCGRLFEGTPAQMCHSLRLLAALPAETRVYCAHE 177

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT  N  FA + DP N +L+ Y  +  ++R+Q   T PSTI LE+ +NPFLR    ++  
Sbjct: 178 YTLANLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSINPFLRGLTPTIVD 237

Query: 233 NLN-------MENASNLAVFTELRIRKNQS 255
           ++        + N   L  FT LR  K+  
Sbjct: 238 SIKQQFCDQDLSNVDELTYFTLLRQWKDIF 267


>gi|297669417|ref|XP_002812893.1| PREDICTED: probable hydrolase PNKD isoform 1 [Pongo abelii]
          Length = 385

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 301 AGVVEPDNLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 361 TGDDDCSRAQLLEELRRLKDMHK 383


>gi|16759247|ref|NP_454864.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29142978|ref|NP_806320.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213021400|ref|ZP_03335847.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213162309|ref|ZP_03348019.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213419853|ref|ZP_03352919.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213428414|ref|ZP_03361164.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580945|ref|ZP_03362771.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612765|ref|ZP_03370591.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213852641|ref|ZP_03382173.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289804967|ref|ZP_06535596.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289828781|ref|ZP_06546540.1| hydroxyacylglutathione hydrolase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|81515710|sp|Q8Z983|GLO2_SALTI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|25311012|pir||AC0534 probable hydroxyacylglutathione hydrolase (EC 3.1.2.6) [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16501538|emb|CAD08715.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138610|gb|AAO70180.1| probable hydroxyacylglutathione hydrolase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 88/251 (35%), Positives = 126/251 (50%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++ N + R    +D  +   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFQDNYIWVLTNDEGR-CVIVDPGEAAPVLKAIAAHKWMPEAIFLTHHHYDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F         E+ +  G  H + DGDT         + ATPGHT+GH+   + + 
Sbjct: 64  ELLQHFPQMTVYGPAET-QDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHV--CYFSH 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL KI S  D T I   HEYT  N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICSAHEYTLANIKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMEN--ASNLAV 244
           H+  + +Y  KVK +R +   T P  +  E+K+N FLR E+  L   +N E       A 
Sbjct: 181 HDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEAR 240

Query: 245 FTELRIRKNQS 255
           F  LR +K+  
Sbjct: 241 FAWLRSKKDTF 251


>gi|156085952|ref|XP_001610385.1| hydroxyacylglutathione hydrolase [Babesia bovis T2Bo]
 gi|154797638|gb|EDO06817.1| hydroxyacylglutathione hydrolase, putative [Babesia bovis]
          Length = 319

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 117/256 (45%), Gaps = 12/256 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I + L+ DN+  ++ +   +    +D  +   I  ++ E+   L  +F TH H DH+  N
Sbjct: 70  ITVPLFQDNYGYIVVDPDGKHAFCVDPAEPRKILSVIDERKLTLKAVFCTHKHHDHSGGN 129

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYH--- 122
           L + +               + G+ +G+ DGD    G   IK +  P HT+GH+ Y+   
Sbjct: 130 LEMARIIPGIPVYGSNNED-MAGMTNGIMDGDVVRLGGLEIKGVRVPCHTLGHMLYYVTN 188

Query: 123 ---FMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
                    +  GDT+F  GCGR FE +   M   +  ++ +   + IY GHEYT  N  
Sbjct: 189 PSDPTMQPLMFTGDTIFIGGCGRFFEGTADMMLNIMNTVRQYRKDSLIYCGHEYTVKNLK 248

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
           FA S    +  +++     +S R QNL T PST+  E + NPF+R    +L   +     
Sbjct: 249 FA-STVDDSPAVKRKMEWAESARQQNLPTVPSTLGEELEYNPFMRT--ATLMDKVG--ET 303

Query: 240 SNLAVFTELRIRKNQS 255
           + +    +LR  K++ 
Sbjct: 304 TEVGAMRKLRQMKDRF 319


>gi|109100966|ref|XP_001089254.1| PREDICTED: probable hydrolase PNKD [Macaca mulatta]
 gi|90080856|dbj|BAE89909.1| unnamed protein product [Macaca fascicularis]
          Length = 385

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 361 TGDDDCSRAQLLEELRRLKDMHK 383


>gi|256020178|ref|ZP_05434043.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
 gi|293418306|ref|ZP_06660741.1| hydroxyacylglutathione hydrolase [Escherichia coli B088]
 gi|300819826|ref|ZP_07100012.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 107-1]
 gi|307314698|ref|ZP_07594296.1| hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|332281341|ref|ZP_08393754.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
 gi|291324834|gb|EFE64249.1| hydroxyacylglutathione hydrolase [Escherichia coli B088]
 gi|300527584|gb|EFK48646.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 107-1]
 gi|306905817|gb|EFN36342.1| hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|315059425|gb|ADT73752.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli W]
 gi|323380016|gb|ADX52284.1| hydroxyacylglutathione hydrolase [Escherichia coli KO11]
 gi|323945580|gb|EGB41630.1| hydroxyacylglutathione hydrolase [Escherichia coli H120]
 gi|332103693|gb|EGJ07039.1| hydroxyacylglutathione hydrolase [Shigella sp. D9]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   + K +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLKAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +     E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPPET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|218547662|ref|YP_002381453.1| hydroxyacylglutathione hydrolase [Escherichia fergusonii ATCC
           35469]
 gi|331671741|ref|ZP_08372537.1| hydroxyacylglutathione hydrolase [Escherichia coli TA280]
 gi|226723997|sp|B7LW87|GLO2_ESCF3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218355203|emb|CAQ87810.1| putative hydroxyacylglutathione hydrolase [Escherichia fergusonii
           ATCC 35469]
 gi|331070730|gb|EGI42089.1| hydroxyacylglutathione hydrolase [Escherichia coli TA280]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|113970498|ref|YP_734291.1| hydroxyacylglutathione hydrolase [Shewanella sp. MR-4]
 gi|113885182|gb|ABI39234.1| Hydroxyacylglutathione hydrolase [Shewanella sp. MR-4]
          Length = 295

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 124/270 (45%), Gaps = 18/270 (6%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M ++  AI+ ++DN+  ++     +    +D  D  ++   L +    L  I  THHH D
Sbjct: 29  MLTIT-AINAFNDNYIWVLRQDSQQNVYVVDPGDANVVLDYLHKHQLTLAGILITHHHRD 87

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTF--------DFGSHPIKIIATP 112
           HT     L      T    L           G++              F   P+ I++ P
Sbjct: 88  HTGGIAALAAHVEQTTGHTLAVYGPQSEAIQGINLPIDPKPSDTLTLPFIDAPVHILSVP 147

Query: 113 GHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHE 172
           GHT GHI Y    D  L  GDTLFS GCGR+FE S A+M++SL  + +  D T +Y  HE
Sbjct: 148 GHTAGHIAYLV--DGALFCGDTLFSAGCGRLFEGSPAQMWQSLSLLAALPDTTRVYCAHE 205

Query: 173 YTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRK 232
           YT  N  FA + D  N  L+ Y  +   +R+QN  T PSTI LE+ +NPFLR    ++  
Sbjct: 206 YTLANLKFAQAVDTDNEALKAYVKRTNDLRAQNKATIPSTIELERAINPFLRPLAPTIVN 265

Query: 233 NLN-------MENASNLAVFTELRIRKNQS 255
           ++        +     L  FT LR  K+  
Sbjct: 266 SIKNQFCDQDLTKTDELTCFTLLRQWKDIF 295


>gi|325920990|ref|ZP_08182876.1| hydroxyacylglutathione hydrolase [Xanthomonas gardneri ATCC 19865]
 gi|325548524|gb|EGD19492.1| hydroxyacylglutathione hydrolase [Xanthomonas gardneri ATCC 19865]
          Length = 255

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 120/254 (47%), Gaps = 8/254 (3%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           A+  + DN+   +     R    +D      +    + +G+  + +  THHH DH     
Sbjct: 5   ALPAFEDNYIWALVAADGR-AVIVDPGQAEPVFAAAKREGFTPSAVLLTHHHADHIGGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L++ +         +  + P     +  G+         +++  PGHT+ HI +    D
Sbjct: 64  ALQQRWPDLELFGPAD-ERSPADARQVGQGERLTLLGMGFEVLEVPGHTLSHIAFVT--D 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
             L  GDTLFSLGCGR+FE +  +MF+SL+++ S   +T +  GHEYT  NA FAL  DP
Sbjct: 121 EHLFSGDTLFSLGCGRMFEGTAPQMFDSLQRLASLPGETLVCCGHEYTLANASFALHVDP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRI----ENTSLRKNLNMENASNL 242
            N  LQ+   + ++MR     T P ++  E   NPFLR        +     +   +S++
Sbjct: 181 TNAALQRRQQEAQAMRQAARPTLPISLKSELATNPFLRTSSSEIRAAAAARASCALSSDV 240

Query: 243 AVFTELRIRKNQSK 256
            VF ELR  K++ +
Sbjct: 241 DVFAELRRWKDEFR 254


>gi|320660195|gb|EFX27705.1| hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str. USDA
           5905]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  +VK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRQVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|300919148|ref|ZP_07135681.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 115-1]
 gi|300413746|gb|EFJ97056.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 115-1]
 gi|309700414|emb|CBI99703.1| probable hydroxyacylglutathione hydrolase [Escherichia coli ETEC
           H10407]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|170747350|ref|YP_001753610.1| hydroxyacylglutathione hydrolase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653872|gb|ACB22927.1| hydroxyacylglutathione hydrolase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 258

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 128/247 (51%), Gaps = 1/247 (0%)

Query: 10  LYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLK 69
              DN  +LI + +    AAID P+   + + L E GW LT I  TH H DH      +K
Sbjct: 12  CRSDNIGVLIRDPQTGACAAIDVPEAGPVLRALNETGWRLTDILVTHRHGDHVEGIPEVK 71

Query: 70  KFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFL 129
           +     +  P +    +P +D  + +GDT   G    ++  TPGH   H+ Y F     +
Sbjct: 72  RATGARVVAPAKAGDAVPQVDVTVREGDTVTVGRLEAQVWETPGHCADHVTYWFAQAGLV 131

Query: 130 CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNL 189
           C GDTLF+LGCGR+ E     ++ SL +     D T ++ GH+Y  +NA FAL+ DP N 
Sbjct: 132 CAGDTLFTLGCGRVMESPPQTLYRSLRRFDDLPDATQVFSGHDYVLSNARFALAADPDNP 191

Query: 190 ELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLAVFTEL 248
           +L+   ++ +  +++  +  PST+  E+  NPFLR    +L K++++   +   AVF  L
Sbjct: 192 DLRARLAEAERAQAEGRFLIPSTMGAERATNPFLRSGQPALAKSVDLPPQSDPEAVFVAL 251

Query: 249 RIRKNQS 255
           R  KN+ 
Sbjct: 252 RAWKNRF 258


>gi|227884791|ref|ZP_04002596.1| hydroxyacylglutathione hydrolase [Escherichia coli 83972]
 gi|300988190|ref|ZP_07178591.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 45-1]
 gi|301050547|ref|ZP_07197420.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 185-1]
 gi|331656202|ref|ZP_08357164.1| hydroxyacylglutathione hydrolase [Escherichia coli TA206]
 gi|331681593|ref|ZP_08382229.1| hydroxyacylglutathione hydrolase [Escherichia coli H299]
 gi|227838232|gb|EEJ48698.1| hydroxyacylglutathione hydrolase [Escherichia coli 83972]
 gi|300297755|gb|EFJ54140.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 185-1]
 gi|300407504|gb|EFJ91042.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 45-1]
 gi|307552059|gb|ADN44834.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli ABU
           83972]
 gi|315292138|gb|EFU51490.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 153-1]
 gi|315300181|gb|EFU59418.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 16-3]
 gi|331054450|gb|EGI26459.1| hydroxyacylglutathione hydrolase [Escherichia coli TA206]
 gi|331081167|gb|EGI52329.1| hydroxyacylglutathione hydrolase [Escherichia coli H299]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + D +T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDSETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|15799888|ref|NP_285900.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 EDL933]
 gi|15829462|ref|NP_308235.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128199|ref|NP_414748.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89107087|ref|AP_000867.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K-12 substr. W3110]
 gi|168750160|ref|ZP_02775182.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757205|ref|ZP_02782212.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168769975|ref|ZP_02794982.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776184|ref|ZP_02801191.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168782937|ref|ZP_02807944.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789655|ref|ZP_02814662.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC869]
 gi|168800386|ref|ZP_02825393.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC508]
 gi|170079843|ref|YP_001729163.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. DH10B]
 gi|195938584|ref|ZP_03083966.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806395|ref|ZP_03248732.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814459|ref|ZP_03255788.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821120|ref|ZP_03261440.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396752|ref|YP_002268815.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217324780|ref|ZP_03440864.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14588]
 gi|238899605|ref|YP_002925401.1| putative hydroxyacylglutathione hydrolase [Escherichia coli BW2952]
 gi|254791339|ref|YP_003076176.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256024149|ref|ZP_05438014.1| hydroxyacylglutathione hydrolase [Escherichia sp. 4_1_40B]
 gi|261223757|ref|ZP_05938038.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255833|ref|ZP_05948366.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281029|ref|YP_003497847.1| Hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           CB9615]
 gi|300949356|ref|ZP_07163368.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 116-1]
 gi|300958301|ref|ZP_07170444.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 175-1]
 gi|301029639|ref|ZP_07192701.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 196-1]
 gi|301645473|ref|ZP_07245410.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 146-1]
 gi|307136807|ref|ZP_07496163.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|331640662|ref|ZP_08341809.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|81175337|sp|P0AC85|GLO2_ECO57 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|81175338|sp|P0AC84|GLO2_ECOLI RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723989|sp|B5Z0I6|GLO2_ECO5E RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723992|sp|B1XD76|GLO2_ECODH RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|259492009|sp|C4ZRU9|GLO2_ECOBW RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|12512940|gb|AAG54508.1|AE005196_6 probable hydroxyacylglutathione hydrolase [Escherichia coli O157:H7
           str. EDL933]
 gi|1552782|gb|AAB08634.1| hypothetical protein [Escherichia coli]
 gi|1786406|gb|AAC73317.1| hydroxyacylglutathione hydrolase [Escherichia coli str. K-12
           substr. MG1655]
 gi|4902949|dbj|BAA77883.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K12 substr. W3110]
 gi|13359664|dbj|BAB33631.1| probable hydroxyacylglutathione hydrolase [Escherichia coli O157:H7
           str. Sakai]
 gi|169887678|gb|ACB01385.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli str.
           K-12 substr. DH10B]
 gi|187768448|gb|EDU32292.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015572|gb|EDU53694.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999617|gb|EDU68603.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355703|gb|EDU74122.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361052|gb|EDU79471.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189370765|gb|EDU89181.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC869]
 gi|189377313|gb|EDU95729.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726196|gb|EDZ75797.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735736|gb|EDZ84423.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741243|gb|EDZ88925.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158152|gb|ACI35585.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209745504|gb|ACI71059.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745506|gb|ACI71060.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745508|gb|ACI71061.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745510|gb|ACI71062.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|209745512|gb|ACI71063.1| probable hydroxyacylglutathione hydrolase [Escherichia coli]
 gi|217321001|gb|EEC29425.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           TW14588]
 gi|238862490|gb|ACR64488.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           BW2952]
 gi|254590739|gb|ACT70100.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O157:H7 str. TW14359]
 gi|260450591|gb|ACX41013.1| hydroxyacylglutathione hydrolase [Escherichia coli DH1]
 gi|290760902|gb|ADD54863.1| Hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           CB9615]
 gi|299877466|gb|EFI85677.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 196-1]
 gi|300315007|gb|EFJ64791.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 175-1]
 gi|300451239|gb|EFK14859.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 116-1]
 gi|301076262|gb|EFK91068.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 146-1]
 gi|315134897|dbj|BAJ42056.1| hydroxyacylglutathione hydrolase [Escherichia coli DH1]
 gi|315616890|gb|EFU97507.1| hydroxyacylglutathione hydrolase [Escherichia coli 3431]
 gi|320190267|gb|EFW64917.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320638232|gb|EFX07960.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           G5101]
 gi|320643616|gb|EFX12760.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H- str.
           493-89]
 gi|320650352|gb|EFX18829.1| hydroxyacylglutathione hydrolase [Escherichia coli O157:H- str. H
           2687]
 gi|320654627|gb|EFX22628.1| hydroxyacylglutathione hydrolase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|326338812|gb|EGD62631.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           1044]
 gi|326342397|gb|EGD66177.1| Hydroxyacylglutathione hydrolase [Escherichia coli O157:H7 str.
           1125]
 gi|331040036|gb|EGI12244.1| hydroxyacylglutathione hydrolase [Escherichia coli H736]
 gi|332341540|gb|AEE54874.1| hydroxyacylglutathione hydrolase GloB [Escherichia coli UMNK88]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|170681858|ref|YP_001742335.1| hydroxyacylglutathione hydrolase [Escherichia coli SMS-3-5]
 gi|218698841|ref|YP_002406470.1| hydroxyacylglutathione hydrolase [Escherichia coli IAI39]
 gi|226723990|sp|B7NKW6|GLO2_ECO7I RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723995|sp|B1LHM1|GLO2_ECOSM RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|170519576|gb|ACB17754.1| hydroxyacylglutathione hydrolase [Escherichia coli SMS-3-5]
 gi|218368827|emb|CAR16575.1| putative hydroxyacylglutathione hydrolase [Escherichia coli IAI39]
          Length = 251

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|297669419|ref|XP_002812894.1| PREDICTED: probable hydrolase PNKD isoform 2 [Pongo abelii]
          Length = 361

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 98  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 157

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 158 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 216

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 217 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 276

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 277 AGVVEPDNLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 336

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 337 TGDDDCSRAQLLEELRRLKDMHK 359


>gi|326436903|gb|EGD82473.1| hypothetical protein PTSG_03122 [Salpingoeca sp. ATCC 50818]
          Length = 257

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/250 (30%), Positives = 113/250 (45%), Gaps = 6/250 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + + L  DN+  L+ +   R  AAID  +   +     E    + ++  TH H DH   N
Sbjct: 4   VVVPLLSDNYGYLLVDKATREAAAIDPVEPKKVLAAAEENNADIKYVLTTHSHWDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
              K+                  +D  + D D+ D GS  + ++ATP HT GH+CY+   
Sbjct: 64  AEFKRLRPSVTIFG-GRGDGADAVDQEVWDDDSLDIGSIKVSVLATPCHTPGHVCYYATA 122

Query: 125 -NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLE-KIKSFSDKTHIYFGHEYTENNAYFAL 182
            +D  +  GDTLF  GCG   + +   M+++L  K+    D T +Y GHEYT  N  FA 
Sbjct: 123 GDDRAVFTGDTLFIGGCGNFNQGTPQMMYDALYTKLGRLPDDTRVYVGHEYTVKNLTFAR 182

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNL 242
             +P N  +Q+  +  +  R    YT PSTI  EK  NPF+R   T +        A  +
Sbjct: 183 VVEPDNRAVQEKLAWAEEQRQAGQYTVPSTIGEEKAFNPFMRCHETPVHAYCG--TADAV 240

Query: 243 AVFTELRIRK 252
                +R RK
Sbjct: 241 TALATVRERK 250


>gi|116642887|ref|NP_056303.3| probable hydrolase PNKD isoform 1 precursor [Homo sapiens]
 gi|158563846|sp|Q8N490|PNKD_HUMAN RecName: Full=Probable hydrolase PNKD; AltName:
           Full=Myofibrillogenesis regulator 1; Short=MR-1;
           AltName: Full=Paroxysmal nonkinesiogenic dyskinesia
           protein; AltName: Full=Trans-activated by hepatitis C
           virus core protein 2
 gi|119591008|gb|EAW70602.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_a [Homo sapiens]
 gi|119591012|gb|EAW70606.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_a [Homo sapiens]
 gi|158260757|dbj|BAF82556.1| unnamed protein product [Homo sapiens]
 gi|168269718|dbj|BAG09986.1| myofibrillogenesis regulator 1 isoform 1 [synthetic construct]
          Length = 385

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 361 TGDDDYSRAQLLEELRRLKDMHK 383


>gi|22209034|gb|AAH36457.1| Paroxysmal nonkinesigenic dyskinesia [Homo sapiens]
          Length = 385

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 361 TGDDDYSRAQLLEELRRLKDMHK 383


>gi|21703352|ref|NP_072094.1| probable hydrolase PNKD isoform 2 [Homo sapiens]
 gi|12804161|gb|AAH02937.1| Paroxysmal nonkinesigenic dyskinesia [Homo sapiens]
 gi|37182625|gb|AAQ89113.1| AWQG2491 [Homo sapiens]
 gi|117644974|emb|CAL37953.1| hypothetical protein [synthetic construct]
 gi|117645160|emb|CAL38046.1| hypothetical protein [synthetic construct]
 gi|119591009|gb|EAW70603.1| paroxysmal nonkinesiogenic dyskinesia, isoform CRA_b [Homo sapiens]
          Length = 361

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 98  LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 157

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 158 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 216

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 217 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 276

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 277 AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 336

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 337 TGDDDYSRAQLLEELRRLKDMHK 359


>gi|6330255|dbj|BAA86498.1| KIAA1184 protein [Homo sapiens]
          Length = 380

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 117 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 176

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 177 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 235

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 236 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 295

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR    +L++ L      
Sbjct: 296 AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGP 355

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              ++ S   +  ELR  K+  K
Sbjct: 356 TGDDDYSRAQLLEELRRLKDMHK 378


>gi|24111643|ref|NP_706153.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 301]
 gi|30061764|ref|NP_835935.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 2457T]
 gi|82542805|ref|YP_406752.1| hydroxyacylglutathione hydrolase [Shigella boydii Sb227]
 gi|110804259|ref|YP_687779.1| hydroxyacylglutathione hydrolase [Shigella flexneri 5 str. 8401]
 gi|81723766|sp|Q83MC1|GLO2_SHIFL RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123147256|sp|Q0T802|GLO2_SHIF8 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|123560514|sp|Q325T4|GLO2_SHIBS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|24050416|gb|AAN41860.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 2a
           str. 301]
 gi|30040006|gb|AAP15740.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 2a
           str. 2457T]
 gi|81244216|gb|ABB64924.1| probable hydroxyacylglutathione hydrolase [Shigella boydii Sb227]
 gi|110613807|gb|ABF02474.1| probable hydroxyacylglutathione hydrolase [Shigella flexneri 5 str.
           8401]
 gi|281599563|gb|ADA72547.1| Hydroxyacylglutathione hydrolase [Shigella flexneri 2002017]
 gi|313646731|gb|EFS11190.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2a str. 2457T]
 gi|332761995|gb|EGJ92267.1| hydroxyacylglutathione hydrolase [Shigella flexneri 4343-70]
 gi|332764636|gb|EGJ94866.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-671]
 gi|332768611|gb|EGJ98792.1| hydroxyacylglutathione hydrolase [Shigella flexneri 2930-71]
 gi|333008971|gb|EGK28430.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-218]
 gi|333022176|gb|EGK41416.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-304]
          Length = 251

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +I TPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVITTPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE +  +M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTALQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIFP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINGINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|26246156|ref|NP_752195.1| hydroxyacylglutathione hydrolase [Escherichia coli CFT073]
 gi|81478436|sp|Q8FKY7|GLO2_ECOL6 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|26106553|gb|AAN78739.1|AE016755_239 Probable hydroxyacylglutathione hydrolase [Escherichia coli CFT073]
          Length = 251

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + D +T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTQVVKDSETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|296205570|ref|XP_002749825.1| PREDICTED: probable hydrolase PNKD [Callithrix jacchus]
          Length = 385

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 118/263 (44%), Gaps = 13/263 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + +L  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHRDCRVYGS-PQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRMERKGTCPSTLGEERSYNPFLRTHCLELQEALGPGPGP 360

Query: 235 -NMENASNLAVFTELRIRKNQSK 256
              +  S   +  ELR  K+  K
Sbjct: 361 TGDDECSRAQLLEELRRLKDMHK 383


>gi|325496138|gb|EGC93997.1| hydroxyacylglutathione hydrolase [Escherichia fergusonii ECD227]
          Length = 251

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +     E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPRET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|166795234|ref|NP_001107642.1| probable hydrolase PNKD isoform 1 [Bos taurus]
 gi|160419155|sp|A7YY46|PNKD_BOVIN RecName: Full=Probable hydrolase PNKD
 gi|154425585|gb|AAI51299.1| PNKD protein [Bos taurus]
 gi|296490311|gb|DAA32424.1| probable hydrolase PNKD isoform 1 [Bos taurus]
          Length = 385

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 81/260 (31%), Positives = 116/260 (44%), Gaps = 13/260 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  LI + + RL  A+D  D   +   + ++G  L  I  TH H DH+  N
Sbjct: 122 LPIPVLSDNYSYLIIDTQARLAVAVDPSDPQAVQASIEKEGVNLVAILCTHKHWDHSGGN 181

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +L +               IP + H L   D    G   I+ +ATPGHT GH+ Y    
Sbjct: 182 RDLSRRHQDCRVYGS-PQDSIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDG 240

Query: 126 DH-----FLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYF 180
           +       L  GD LF  GCGR FE +   M  SL+ +    D T ++ GHEY E N  F
Sbjct: 241 EPYEGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF 300

Query: 181 ALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL------ 234
           A   +P NL  ++    V+  R +   T PST+  E+  NPFLR     L++ L      
Sbjct: 301 AGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERSYNPFLRTHCLVLQEALGPSPGP 360

Query: 235 -NMENASNLAVFTELRIRKN 253
              +  S   +   LR  K+
Sbjct: 361 TGDDGCSRAQLLERLRQLKD 380


>gi|253988339|ref|YP_003039695.1| hydroxyacylglutathione hydrolase (glyoxalase ii) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779789|emb|CAQ82950.1| hydroxyacylglutathione hydrolase (glyoxalase ii) [Photorhabdus
           asymbiotica]
          Length = 250

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 85/252 (33%), Positives = 134/252 (53%), Gaps = 7/252 (2%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I+I    DN+  L+     R +  +D  ++  +   L+  GW    I  THHH DH    
Sbjct: 4   ISIPALSDNYIWLL-CDDNRHSVIVDPAESQPVLDTLKSHGWIPDAILLTHHHHDHVGGV 62

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +   F        EE+ +  G    +  G++ +FG+   ++I  PGHT+GHI ++   
Sbjct: 63  PGILDQFPELPVYGPEET-QSKGATMIVRGGNSINFGNFSFQVIDVPGHTLGHIAFYQ-- 119

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
             +L  GDTLFS GCGR+FE +  +M+ S+ KI    D T I   HEYT +N  FA +  
Sbjct: 120 APYLFCGDTLFSGGCGRLFEGTAEQMYTSIGKIAELPDDTLICCAHEYTVSNMKFAHA-I 178

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME-NASNLA- 243
             N  + +Y  KV  MR  N  T P+T+ +EKK+N FL+ ++  L++N+ ++ N+  L+ 
Sbjct: 179 LPNQAISEYQQKVTQMRENNQPTVPTTLQIEKKINIFLKCDDIDLQRNIGIKPNSQPLSV 238

Query: 244 VFTELRIRKNQS 255
           VF +LRI K++ 
Sbjct: 239 VFRQLRINKDRF 250


>gi|74310827|ref|YP_309246.1| hydroxyacylglutathione hydrolase [Shigella sonnei Ss046]
 gi|157157699|ref|YP_001461377.1| hydroxyacylglutathione hydrolase [Escherichia coli E24377A]
 gi|187731163|ref|YP_001879009.1| hydroxyacylglutathione hydrolase [Shigella boydii CDC 3083-94]
 gi|191167021|ref|ZP_03028843.1| hydroxyacylglutathione hydrolase [Escherichia coli B7A]
 gi|193067563|ref|ZP_03048530.1| hydroxyacylglutathione hydrolase [Escherichia coli E110019]
 gi|194432716|ref|ZP_03065001.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1012]
 gi|260853417|ref|YP_003227308.1| putative hydroxyacylglutathione hydrolase [Escherichia coli O26:H11
           str. 11368]
 gi|260866355|ref|YP_003232757.1| putative hydroxyacylglutathione hydrolase [Escherichia coli O111:H-
           str. 11128]
 gi|300926568|ref|ZP_07142354.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 182-1]
 gi|301326096|ref|ZP_07219492.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 78-1]
 gi|309797927|ref|ZP_07692307.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 145-7]
 gi|331666453|ref|ZP_08367333.1| hydroxyacylglutathione hydrolase [Escherichia coli TA271]
 gi|331675870|ref|ZP_08376587.1| hydroxyacylglutathione hydrolase [Escherichia coli H591]
 gi|123618007|sp|Q3Z5F1|GLO2_SHISS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|166990454|sp|A7ZHU8|GLO2_ECO24 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226724031|sp|B2U350|GLO2_SHIB3 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|73854304|gb|AAZ87011.1| probable hydroxyacylglutathione hydrolase [Shigella sonnei Ss046]
 gi|157079729|gb|ABV19437.1| hydroxyacylglutathione hydrolase [Escherichia coli E24377A]
 gi|187428155|gb|ACD07429.1| hydroxyacylglutathione hydrolase [Shigella boydii CDC 3083-94]
 gi|190902914|gb|EDV62641.1| hydroxyacylglutathione hydrolase [Escherichia coli B7A]
 gi|192958975|gb|EDV89411.1| hydroxyacylglutathione hydrolase [Escherichia coli E110019]
 gi|194418978|gb|EDX35062.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 1012]
 gi|257752066|dbj|BAI23568.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O26:H11 str. 11368]
 gi|257762711|dbj|BAI34206.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O111:H- str. 11128]
 gi|300417426|gb|EFK00737.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 182-1]
 gi|300847156|gb|EFK74916.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 78-1]
 gi|308118467|gb|EFO55729.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 145-7]
 gi|320179849|gb|EFW54795.1| Hydroxyacylglutathione hydrolase [Shigella boydii ATCC 9905]
 gi|323157953|gb|EFZ44055.1| hydroxyacylglutathione hydrolase [Escherichia coli EPECa14]
 gi|323165911|gb|EFZ51693.1| hydroxyacylglutathione hydrolase [Shigella sonnei 53G]
 gi|323176524|gb|EFZ62116.1| hydroxyacylglutathione hydrolase [Escherichia coli 1180]
 gi|324115456|gb|EGC09398.1| hydroxyacylglutathione hydrolase [Escherichia coli E1167]
 gi|331066298|gb|EGI38176.1| hydroxyacylglutathione hydrolase [Escherichia coli TA271]
 gi|331076430|gb|EGI47707.1| hydroxyacylglutathione hydrolase [Escherichia coli H591]
 gi|332093753|gb|EGI98808.1| hydroxyacylglutathione hydrolase [Shigella boydii 3594-74]
 gi|332095030|gb|EGJ00065.1| hydroxyacylglutathione hydrolase [Shigella boydii 5216-82]
 gi|332097576|gb|EGJ02555.1| hydroxyacylglutathione hydrolase [Shigella dysenteriae 155-74]
          Length = 251

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|332974236|gb|EGK11169.1| hydroxyacylglutathione hydrolase [Kingella kingae ATCC 23330]
          Length = 253

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 76/263 (28%), Positives = 123/263 (46%), Gaps = 18/263 (6%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M+SL+I  I   +DN+  L+   +     AIDA     +   +++ G  L  I+ THHH 
Sbjct: 1   MSSLHIVPIPALNDNYIWLL--QQGNEAIAIDAGQAEPVLAYVQQHGLQLVQIWVTHHHG 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DHT     L+  F         + +        + +     + +  I +    GHT  H+
Sbjct: 59  DHTAGIAALQAAFPRCQVFGAHDIA---AATQIVQEDSQISWQNKQIDVWQIAGHTANHL 115

Query: 120 CYHFMNDH--FLCVGDTLFSLGCGRIFEDSYAEM-FESLEKIKSFSDKTHIYFGHEYTEN 176
            Y   +D    +  GDTLFS GCGR+F DS  E  + SL++I      T +Y  HEYT +
Sbjct: 116 AYLLRDDEQLHVFCGDTLFSAGCGRVFPDSQPEWLYRSLQRIARLPSDTLLYPAHEYTAS 175

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FA   +P+N  +      V   ++    T P +++ E+++NPFLR+    +++ +  
Sbjct: 176 NLRFAAHIEPNNPHIA-----VAQAKAACTPTLPVSLAHEQQINPFLRVHLPEVQQRVAE 230

Query: 237 ENA----SNLAVFTELRIRKNQS 255
                   ++AVFT LR  KN+ 
Sbjct: 231 HYQADLVDDVAVFTALREWKNRF 253


>gi|320173692|gb|EFW48881.1| Hydroxyacylglutathione hydrolase [Shigella dysenteriae CDC 74-1112]
          Length = 251

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCCAHEYTLSNMKFALSIIP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|260596628|ref|YP_003209199.1| hydroxyacylglutathione hydrolase [Cronobacter turicensis z3032]
 gi|260215805|emb|CBA28253.1| Hydroxyacylglutathione hydrolase [Cronobacter turicensis z3032]
          Length = 251

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 128/251 (50%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++ + +    +D  +   + + + E  W    I  THHH DHT    
Sbjct: 5   SIPAFEDNYIWVLNDEEGK-CLIVDPGEAEPVFRAIEENQWQPVAILLTHHHHDHTGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L       +     E ++  G    ++DG+ F+         +TPGHT+GH  Y     
Sbjct: 64  AL-VARFPDLIVYGPEETRSKGAQVIVNDGEKFNVLGCEFLAFSTPGHTLGHFSYFSFP- 121

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDT+FS GCGR+FE +  +M++S +KI +  + T I   HEYT +N  F ++  P
Sbjct: 122 -YLFCGDTMFSAGCGRLFEGTPTQMYQSFQKINALPENTLICCAHEYTLSNLKFLVAILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN--MENASNLAV 244
           ++  L +Y  +V  +R++N  T PS +  E+++N +LR+E+  L   +N  +  ++    
Sbjct: 181 NDPVLTQYYREVNELRAKNQKTLPSILKNERQINLYLRLEDDDLIDKINPDLRLSTPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K+  
Sbjct: 241 FAWLRSKKDNF 251


>gi|218703461|ref|YP_002410980.1| hydroxyacylglutathione hydrolase [Escherichia coli UMN026]
 gi|293403291|ref|ZP_06647382.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1412]
 gi|298378905|ref|ZP_06988786.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1302]
 gi|300900032|ref|ZP_07118229.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 198-1]
 gi|331661583|ref|ZP_08362506.1| hydroxyacylglutathione hydrolase [Escherichia coli TA143]
 gi|226723993|sp|B7N874|GLO2_ECOLU RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|218430558|emb|CAR11424.1| putative hydroxyacylglutathione hydrolase [Escherichia coli UMN026]
 gi|284919982|emb|CBG33037.1| probable hydroxyacylglutathione hydrolase [Escherichia coli 042]
 gi|291429144|gb|EFF02164.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1412]
 gi|298280018|gb|EFI21522.1| hydroxyacylglutathione hydrolase [Escherichia coli FVEC1302]
 gi|300356437|gb|EFJ72307.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 198-1]
 gi|331060005|gb|EGI31969.1| hydroxyacylglutathione hydrolase [Escherichia coli TA143]
          Length = 251

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L K F   +    +E+ +  G    + DG+      H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVKKFPQIVVYGPQET-QDKGTTRVVKDGEIAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|94469298|gb|ABF18498.1| glyoxylase 3 [Aedes aegypti]
          Length = 302

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 76/265 (28%), Positives = 128/265 (48%), Gaps = 12/265 (4%)

Query: 1   MTSLNIA-ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           MT + +  I    DNF  L+  ++ +  A +D  +   + ++ +E G  L  +  THHH 
Sbjct: 40  MTRMTVKKIPALKDNFMYLVVCNETKNAAIVDPVEPDRVLQVAKESGVSLNKVLTTHHHW 99

Query: 60  DHTRANLNLKKFFNCTI-----FGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGH 114
           DH   N +L K +                 +I  + + +   DT + G+  ++ I+TP H
Sbjct: 100 DHAGGNADLFKRYQADTSLGPLQIYGGNDERIDNLTNPVGQDDTLEIGNLKVRCISTPCH 159

Query: 115 TIGHICYHF--MNDHFLCVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGH 171
           T  HICY+     D  +  GDTLF  GCGR FE +  +M+++ + K+ +  D T +Y GH
Sbjct: 160 TTSHICYYIETPEDKVVFTGDTLFLAGCGRFFEGTPQQMYDALITKLSALPDDTKVYCGH 219

Query: 172 EYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYT-NPSTISLEKKVNPFLRIENTSL 230
           EY  NN  F  + +P N++  +  +  K    +      PSTI  EK+ N F+R+   S+
Sbjct: 220 EYALNNLRFGNTVEPDNVDTLQLLNIAKESDLEGRRAMVPSTIGQEKRTNVFMRVHEASV 279

Query: 231 RKNLNMENASNLAVFTELRIRKNQS 255
           +K +    ++ L     LR  K++ 
Sbjct: 280 QKFVG--KSTPLETMQALRAAKDKF 302


>gi|209917399|ref|YP_002291483.1| hydroxyacylglutathione hydrolase [Escherichia coli SE11]
 gi|226723994|sp|B6HZS5|GLO2_ECOSE RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|209910658|dbj|BAG75732.1| putative hydroxyacylglutathione hydrolase [Escherichia coli SE11]
 gi|324020676|gb|EGB89895.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 117-3]
          Length = 251

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++S+ K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSINKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|170021440|ref|YP_001726394.1| hydroxyacylglutathione hydrolase [Escherichia coli ATCC 8739]
 gi|188492268|ref|ZP_02999538.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194438202|ref|ZP_03070294.1| hydroxyacylglutathione hydrolase [Escherichia coli 101-1]
 gi|253774766|ref|YP_003037597.1| hydroxyacylglutathione hydrolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160326|ref|YP_003043434.1| hydroxyacylglutathione hydrolase [Escherichia coli B str. REL606]
 gi|300927904|ref|ZP_07143464.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 187-1]
 gi|312970310|ref|ZP_07784491.1| hydroxyacylglutathione hydrolase [Escherichia coli 1827-70]
 gi|189041220|sp|B1IPU6|GLO2_ECOLC RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|169756368|gb|ACA79067.1| hydroxyacylglutathione hydrolase [Escherichia coli ATCC 8739]
 gi|188487467|gb|EDU62570.1| metallo-beta-lactamase family protein [Escherichia coli 53638]
 gi|194422866|gb|EDX38861.1| hydroxyacylglutathione hydrolase [Escherichia coli 101-1]
 gi|242376042|emb|CAQ30727.1| glyoxalase II [Escherichia coli BL21(DE3)]
 gi|253325810|gb|ACT30412.1| hydroxyacylglutathione hydrolase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972227|gb|ACT37898.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli B str.
           REL606]
 gi|253976436|gb|ACT42106.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           BL21(DE3)]
 gi|300464059|gb|EFK27552.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 187-1]
 gi|310336959|gb|EFQ02097.1| hydroxyacylglutathione hydrolase [Escherichia coli 1827-70]
 gi|323963575|gb|EGB59132.1| hydroxyacylglutathione hydrolase [Escherichia coli H489]
 gi|323972504|gb|EGB67710.1| hydroxyacylglutathione hydrolase [Escherichia coli TA007]
          Length = 251

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+    D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSVLPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|114706740|ref|ZP_01439640.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Fulvimarina pelagi HTCC2506]
 gi|114537688|gb|EAU40812.1| putative hydroxyacylglutathione hydrolase (glyoxalase ii) (glx ii)
           protein [Fulvimarina pelagi HTCC2506]
          Length = 254

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 108/254 (42%), Positives = 140/254 (55%), Gaps = 3/254 (1%)

Query: 1   MTSLNI-AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHI 59
           M  + I       DNF +L+H      T AIDAP+   I   L   GW LTHI  THHH 
Sbjct: 1   MAEIEIRQFGCRSDNFGVLVHRGDT--TIAIDAPEERPILDALSASGWTLTHILTTHHHA 58

Query: 60  DHTRANLNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHI 119
           DH  AN  LK  F   I GP  E+S IPGID     GDT D G   +++IATPGHT+G I
Sbjct: 59  DHVAANEALKDRFGVKIIGPKGEASNIPGIDETAEGGDTLDVGGIEVRVIATPGHTLGEI 118

Query: 120 CYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAY 179
            Y+      L   D LFSLGCGR+FE   A M+ SL++++   D T +Y GHEYT  NA 
Sbjct: 119 SYYLPEAKALFAADALFSLGCGRLFEGDPAMMWTSLKRLRDLPDDTMLYCGHEYTATNAR 178

Query: 180 FALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA 239
            AL  DP+NL +Q+  S+V+ +R+    T P  +  EKK NPFLR ++   +  + M  A
Sbjct: 179 CALDLDPNNLLVQERASEVEHLRAAGKPTIPVELGREKKTNPFLRADDPEFQTAVGMAGA 238

Query: 240 SNLAVFTELRIRKN 253
             + VF   R  ++
Sbjct: 239 DPVEVFAHARKTRD 252


>gi|110640427|ref|YP_668155.1| hydroxyacylglutathione hydrolase [Escherichia coli 536]
 gi|191171362|ref|ZP_03032911.1| hydroxyacylglutathione hydrolase [Escherichia coli F11]
 gi|215485368|ref|YP_002327799.1| hydroxyacylglutathione hydrolase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|300990973|ref|ZP_07179423.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 200-1]
 gi|306813368|ref|ZP_07447561.1| hydroxyacylglutathione hydrolase [Escherichia coli NC101]
 gi|312964726|ref|ZP_07778977.1| hydroxyacylglutathione hydrolase [Escherichia coli 2362-75]
 gi|123344357|sp|Q0TLC5|GLO2_ECOL5 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|254798843|sp|B7UJA8|GLO2_ECO27 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|110342019|gb|ABG68256.1| probable hydroxyacylglutathione hydrolase [Escherichia coli 536]
 gi|190908296|gb|EDV67886.1| hydroxyacylglutathione hydrolase [Escherichia coli F11]
 gi|215263440|emb|CAS07760.1| predicted hydroxyacylglutathione hydrolase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|222032037|emb|CAP74776.1| hydroxyacylglutathione hydrolase [Escherichia coli LF82]
 gi|300305639|gb|EFJ60159.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 200-1]
 gi|305854131|gb|EFM54570.1| hydroxyacylglutathione hydrolase [Escherichia coli NC101]
 gi|312290747|gb|EFR18625.1| hydroxyacylglutathione hydrolase [Escherichia coli 2362-75]
 gi|312944815|gb|ADR25642.1| hydroxyacylglutathione hydrolase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324011827|gb|EGB81046.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 60-1]
          Length = 251

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|29841459|gb|AAP06491.1| SJCHGC05735 protein [Schistosoma japonicum]
 gi|226468550|emb|CAX69952.1| hydroxyacylglutathione hydrolase [Schistosoma japonicum]
 gi|226484694|emb|CAX74256.1| hydroxyacylglutathione hydrolase [Schistosoma japonicum]
          Length = 261

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 68/260 (26%), Positives = 112/260 (43%), Gaps = 12/260 (4%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + +    DN+  ++ +    + A +D  +   +  +++++G  L  +  THHH DH   N
Sbjct: 4   VILPALSDNYMYMVIDRASNICAVVDPVEPDKVLSVVKQRGLQLKSVLTTHHHSDHAGGN 63

Query: 66  LNLKKFFNCTIFGPLEESSKIPGI----DHGLSDGDTFDFGSHPIKIIATPGHTIGHICY 121
           L+L           L        I                 +  ++ +ATP HT GHICY
Sbjct: 64  LDLIAKCKEQGLEALSVYGGDDRIGGLTVTVSHGYKMKIGNNLTVQCLATPCHTTGHICY 123

Query: 122 HFMNDHFL-----CVGDTLFSLGCGRIFEDSYAEMFES-LEKIKSFSDKTHIYFGHEYTE 175
               ++         GDTLF  GCGR FE +  +MF++ +E +      T +Y GHEYT 
Sbjct: 124 LVTEENSTKEGAVFTGDTLFLGGCGRFFEGTAEQMFKALIETLSKLPTATKVYCGHEYTV 183

Query: 176 NNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLN 235
            N  F L+ +P N  L+     VK +R+ N  + P TI  E   NPF+R+    +  +  
Sbjct: 184 KNLEFGLTIEPKNEALKHRLEAVKRLRASNQPSVPGTIGEELATNPFMRVSEVDVLTHA- 242

Query: 236 MENASNLAVFTELRIRKNQS 255
            +    +     +R  K+  
Sbjct: 243 -KTTDPIKAMKIIREEKDHF 261


>gi|331645381|ref|ZP_08346485.1| hydroxyacylglutathione hydrolase [Escherichia coli M605]
 gi|281177432|dbj|BAI53762.1| putative hydroxyacylglutathione hydrolase [Escherichia coli SE15]
 gi|320197301|gb|EFW71917.1| Hydroxyacylglutathione hydrolase [Escherichia coli WV_060327]
 gi|330910058|gb|EGH38568.1| hydroxyacylglutathione hydrolase [Escherichia coli AA86]
 gi|331045543|gb|EGI17669.1| hydroxyacylglutathione hydrolase [Escherichia coli M605]
          Length = 251

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 131/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLRKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|188534761|ref|YP_001908558.1| Putative hydroxyacylglutathione hydrolase [Erwinia tasmaniensis
           Et1/99]
 gi|226723996|sp|B2VHJ7|GLO2_ERWT9 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|188029803|emb|CAO97683.1| Putative hydroxyacylglutathione hydrolase [Erwinia tasmaniensis
           Et1/99]
          Length = 251

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 81/251 (32%), Positives = 126/251 (50%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I    DN+   + N        +D  +   + + + E  W    I  THHH DH     
Sbjct: 5   SIPALQDNYIWTL-NDDSGRCLIVDPGEAAPVLRAITENQWQPQAILLTHHHHDHVGGVA 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L   +        +E+S   G +  + DGD          IIATPGHT+GHI Y     
Sbjct: 64  ELLSHYPDLTVYGPQETS-HKGANSLVGDGDRIHVLGLDFTIIATPGHTLGHISYFSHP- 121

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE +  +MFES +K+    D T +   HEYT +N  F+ +  P
Sbjct: 122 -YLFCGDTLFSAGCGRLFEGTAKQMFESFQKLNQLPDDTLVCCAHEYTLSNLTFSHTFYP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNME--NASNLAV 244
            + E+ +Y  ++K +RS+N  T P+ + LE+K+N FLR ++  L++ ++ E  +     +
Sbjct: 181 QDTEIARYYHEIKELRSKNGITLPTKLELERKINVFLRTKDVELQRLISTEPDHLDEWEI 240

Query: 245 FTELRIRKNQS 255
           F  LR +K+  
Sbjct: 241 FATLREKKDSF 251


>gi|323938755|gb|EGB35001.1| hydroxyacylglutathione hydrolase [Escherichia coli E1520]
 gi|323963757|gb|EGB59259.1| hydroxyacylglutathione hydrolase [Escherichia coli M863]
 gi|327254931|gb|EGE66541.1| hydroxyacylglutathione hydrolase [Escherichia coli STEC_7v]
          Length = 251

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|294010314|ref|YP_003543774.1| hydroxyacylglutathione hydrolase [Sphingobium japonicum UT26S]
 gi|292673644|dbj|BAI95162.1| hydroxyacylglutathione hydrolase [Sphingobium japonicum UT26S]
          Length = 240

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 136/248 (54%), Gaps = 14/248 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I +  DN+  L+H+     T A+D      + +  R++ W ++ I+NTH H DH   N
Sbjct: 5   VRIPVLSDNYVWLLHDDASGETVAVDPAVAEPVLEAARQRDWTISQIWNTHWHGDHVGGN 64

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             +K    CTI GP  E+ KI  +D  + +GD+   G+H   ++  P HT GH+ YH  +
Sbjct: 65  AAIKAATGCTITGPAAEAEKIGTLDRMVREGDSVRIGAHQAAVLEVPAHTAGHVAYHLAD 124

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           D  + VGDTLF++GCGR+FE + A+MF ++ +  +  D T +Y  HEYT++N  FAL+ +
Sbjct: 125 DRLIFVGDTLFAMGCGRLFEGTAAQMFANMRRFAALPDDTVVYCAHEYTQSNGRFALTVE 184

Query: 186 PHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLAVF 245
           P N  L+   ++V + RS+   T P+++  E+  N F+R              AS++A  
Sbjct: 185 PDNAALRARMAEVDAARSRGEATVPTSVGQERATNVFMR--------------ASDVAQL 230

Query: 246 TELRIRKN 253
            E R  K+
Sbjct: 231 AERRAAKD 238


>gi|323191551|gb|EFZ76811.1| hydroxyacylglutathione hydrolase [Escherichia coli RN587/1]
          Length = 251

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|332526659|ref|ZP_08402764.1| hydroxyacylglutathione hydrolase [Rubrivivax benzoatilyticus JA2]
 gi|332110920|gb|EGJ11097.1| hydroxyacylglutathione hydrolase [Rubrivivax benzoatilyticus JA2]
          Length = 256

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 77/257 (29%), Positives = 120/257 (46%), Gaps = 10/257 (3%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           +A+  + DN   ++H+      A +D  D   ++  L  +G  L  I  THHH DH    
Sbjct: 4   VALPAFADNVIWMLHD--GHDAAVVDPGDAAPVAAELDARGLRLAAILVTHHHGDHVGGI 61

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFM- 124
             L+      ++GP      IP     +  GD  +      ++I  PGHT GH+ +    
Sbjct: 62  AALRPRLQGPVWGPAR--EDIPTPFVPVHGGDRIELLGRAFEVIDVPGHTAGHVAFFEHG 119

Query: 125 --NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFAL 182
              +  L  GDTLFS GCGR+FE + A+M  SL ++ +  D T I   HEYT +N  FA 
Sbjct: 120 AAREPLLFCGDTLFSAGCGRLFEGTAAQMAASLARLAALPDDTRICCAHEYTLSNLAFAA 179

Query: 183 SCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNL---NMENA 239
           + +P N ++  Y +  +  R+    T P+ +  E+ VNPFLR    ++          + 
Sbjct: 180 AVEPGNEKIAAYTALCQDRRAAGRLTLPAVLGHERDVNPFLRCREAAVVAAAREQGAASG 239

Query: 240 SNLAVFTELRIRKNQSK 256
             + VF  LR  KN+ +
Sbjct: 240 QEVDVFAALRNWKNRYR 256


>gi|328723254|ref|XP_001945653.2| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like
           isoform 1 [Acyrthosiphon pisum]
          Length = 295

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 112/251 (44%), Gaps = 5/251 (1%)

Query: 8   ISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLN 67
           +    DNF  L+ ++  +  A +D     ++   + ++   LT +  THHH DH   N  
Sbjct: 45  LPALSDNFMYLLIDNSTKEAAIVDPVAPDVVWDAVHKENVKLTTVLTTHHHWDHAGGNKE 104

Query: 68  LKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKII-ATPGHTIGHICYHFM-- 124
           L           +    +I G+   +                  TP HT GHICY+    
Sbjct: 105 LINSNTNDQLTVIGGDDRIDGLTVMIDTHGVDFQFGSLNIKCLRTPCHTTGHICYYVNGG 164

Query: 125 NDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTH-IYFGHEYTENNAYFALS 183
            D  +  GDTLF  GCGR FE +  +M+E+L KI S    +  ++ GHEY   N  F L 
Sbjct: 165 QDDVVFTGDTLFLGGCGRFFEGTATQMYEALIKILSQLPDSTAVFCGHEYAIQNLKFGLH 224

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENASNLA 243
            +P N  +      V++ R     + PSTI LEK +NPF+R+EN S++K +       + 
Sbjct: 225 VEPSNHYILNTLEDVETKRKLKEPSVPSTIGLEKLINPFMRVENESVQK-VTQTVGDPIE 283

Query: 244 VFTELRIRKNQ 254
               LR  KN 
Sbjct: 284 TMKMLRDLKNN 294


>gi|333009685|gb|EGK29135.1| hydroxyacylglutathione hydrolase [Shigella flexneri VA-6]
 gi|333010752|gb|EGK30178.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-272]
 gi|333021251|gb|EGK40504.1| hydroxyacylglutathione hydrolase [Shigella flexneri K-227]
          Length = 251

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +I TPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVITTPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE +  +M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTALQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSIFP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|157159673|ref|YP_001456991.1| hydroxyacylglutathione hydrolase [Escherichia coli HS]
 gi|166990455|sp|A7ZWF4|GLO2_ECOHS RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|157065353|gb|ABV04608.1| hydroxyacylglutathione hydrolase [Escherichia coli HS]
          Length = 251

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAITANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++SL+K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|325192568|emb|CCA26998.1| hydroxyacylglutathione hydrolase putative [Albugo laibachii Nc14]
          Length = 258

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 118/266 (44%), Gaps = 19/266 (7%)

Query: 1   MTSLNIAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHID 60
           M+   + I +  DN+  L+ +    + AAID  D   + +     G  +  I  TH H D
Sbjct: 1   MSLQVVPIPVLDDNYAYLLIDKANHVAAAIDPVDAKKVYEKATALGVIIVTILTTHGHWD 60

Query: 61  HTRANLNLKKFFNCTIFGPLEESSKIPGI----------DHGLSDGDTFDFGSHPIKIIA 110
           H   N  L    +       + +  +P             H ++D D    G   +K   
Sbjct: 61  HAGGNKALVALLSPKTNDCKDSNEAVPVFGGVGDDVEAATHHVNDQDVITVGQLQVKAYH 120

Query: 111 TPGHTIGHICYHFMNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSF-SDKTHIYF 169
           TP HT GH+ YH   +  L  GDTLF  GCGR F+ + AEM  +L  I +     T IY 
Sbjct: 121 TPCHTRGHVLYH--CEDALFTGDTLFIAGCGRFFQGTPAEMHHALNSIIAKLPLDTRIYC 178

Query: 170 GHEYTENNAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTS 229
           GHEYT  N  FA S +P N+++ K     ++       T PS++  E   NPF+R+   +
Sbjct: 179 GHEYTLKNLQFAASIEPQNMDVAKKLLWAETQ----KCTIPSSVREELATNPFMRVNEPN 234

Query: 230 LRKNLNMENASNLAVFTELRIRKNQS 255
           +R+    E    + V   LR RK+Q 
Sbjct: 235 IRRVTGHE--DPVQVLRALRERKDQF 258


>gi|117622494|ref|YP_851407.1| hydroxyacylglutathione hydrolase [Escherichia coli APEC O1]
 gi|218557148|ref|YP_002390061.1| hydroxyacylglutathione hydrolase [Escherichia coli S88]
 gi|237707794|ref|ZP_04538275.1| hydroxyacylglutathione hydrolase [Escherichia sp. 3_2_53FAA]
 gi|160386242|sp|A1A7Q3|GLO2_ECOK1 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|226723988|sp|B7MBI8|GLO2_ECO45 RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|115511618|gb|ABI99692.1| putative hydroxyacylglutathione hydrolase [Escherichia coli APEC
           O1]
 gi|218363917|emb|CAR01582.1| putative hydroxyacylglutathione hydrolase [Escherichia coli S88]
 gi|226899004|gb|EEH85263.1| hydroxyacylglutathione hydrolase [Escherichia sp. 3_2_53FAA]
 gi|294493353|gb|ADE92109.1| hydroxyacylglutathione hydrolase [Escherichia coli IHE3034]
 gi|307628306|gb|ADN72610.1| hydroxyacylglutathione hydrolase [Escherichia coli UM146]
 gi|315289704|gb|EFU49097.1| hydroxyacylglutathione hydrolase [Escherichia coli MS 110-3]
 gi|323958796|gb|EGB54495.1| hydroxyacylglutathione hydrolase [Escherichia coli H263]
          Length = 251

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|156393744|ref|XP_001636487.1| predicted protein [Nematostella vectensis]
 gi|156223591|gb|EDO44424.1| predicted protein [Nematostella vectensis]
          Length = 318

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/265 (28%), Positives = 109/265 (41%), Gaps = 14/265 (5%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           I +   +DN+  +I +        +D  D   +  +L ++   L  +  TH H DH+  N
Sbjct: 54  IPVPFLYDNYSYIIVDITTSSAVVVDPSDPEAVKDVLNKEKLQLEAVLTTHKHWDHSGGN 113

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
            +LK  F        E               D  +F     ++  T   T GH   H + 
Sbjct: 114 TSLKADFPSVAVYGSELDDAPGLTHTRKPLCDISNFSGKVSQLSFTAFSTPGHTAGHVVY 173

Query: 126 DHFL---------CVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
                          GD LF  GCGRIFE +  EM ESL+ + S  D T ++ GH+Y   
Sbjct: 174 LLHGAVFNSVDSLFSGDLLFLGGCGRIFEGAPGEMLESLQTVSSLKDDTLLWPGHDYAMK 233

Query: 177 NAYFALSCDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNM 236
           N  FAL+ +P N  L+     V  MR+    T+PSTI  EK  NPFLR     +   +  
Sbjct: 234 NLMFALTIEPSNYHLRAKMDWVVEMRNNKYMTSPSTIGEEKLYNPFLRTHLAIVGSAVGF 293

Query: 237 ENASN-----LAVFTELRIRKNQSK 256
               +     ++V   LR RKN  K
Sbjct: 294 TQDDDVNLRAVSVLKALRERKNNFK 318


>gi|91209280|ref|YP_539266.1| hydroxyacylglutathione hydrolase [Escherichia coli UTI89]
 gi|122424930|sp|Q1RFX9|GLO2_ECOUT RecName: Full=Hydroxyacylglutathione hydrolase; AltName:
           Full=Glyoxalase II; Short=Glx II
 gi|91070854|gb|ABE05735.1| probable hydroxyacylglutathione hydrolase [Escherichia coli UTI89]
          Length = 251

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 132/251 (52%), Gaps = 6/251 (2%)

Query: 7   AISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANL 66
           +I  + DN+  ++++   R    +D  D   +   +    W    IF THHH DH     
Sbjct: 5   SIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAISANNWQPEAIFLTHHHHDHVGGVK 63

Query: 67  NLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND 126
            L + F   +    +E+ +  G    + DG+T     H   +IATPGHT+GHI   + + 
Sbjct: 64  ELVEKFPQIVVYGPQET-QDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHI--CYFSK 120

Query: 127 HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDP 186
            +L  GDTLFS GCGR+FE + ++M++S++K+ +  D T +   HEYT +N  FALS  P
Sbjct: 121 PYLFCGDTLFSGGCGRLFEGTPSQMYQSIKKLSALPDDTLVCCAHEYTLSNMKFALSILP 180

Query: 187 HNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENTSLRKNLNMENA--SNLAV 244
           H+L +  Y  KVK +R++N  T P  +  E+++N FLR E+  L   +N E         
Sbjct: 181 HDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLKQPEER 240

Query: 245 FTELRIRKNQS 255
           F  LR +K++ 
Sbjct: 241 FAWLRSKKDRF 251


>gi|329120517|ref|ZP_08249182.1| hydroxyacylglutathione hydrolase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327461975|gb|EGF08305.1| hydroxyacylglutathione hydrolase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 253

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/256 (28%), Positives = 110/256 (42%), Gaps = 16/256 (6%)

Query: 6   IAISLYHDNFCILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRAN 65
           + I    DN+  L+ +   R  A +D  +   +   L   G  L  I+ THHH DHT   
Sbjct: 8   VPIPALSDNYIWLLSD--GRTAACVDPGEAAPVLDFLNAHGLALAQIWITHHHGDHTGGV 65

Query: 66  LNLKKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             LK+ F             +P  D    +G    F     ++   PGHT GH+ Y   +
Sbjct: 66  AELKRRFPKCAV---YGGGDVPAADMAAGEGGIIRFAGRTARVWHIPGHTAGHLAYLLED 122

Query: 126 D--HFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALS 183
                +  GDTLFS GCGR+F  +  ++  S  ++ +  D T +Y  HEYT  N  FA  
Sbjct: 123 GGRTHVFCGDTLFSAGCGRVFTGTMEQLAASCRRLAALPDDTLLYPAHEYTAANLAFAEC 182

Query: 184 CDPHNLELQKYCSKVKSMRSQNLYTNPSTISLEKKVNPFLRIENT----SLRKNLNMENA 239
            +P N +++    +     + +  T P T+  EK++NPFLR  +        +       
Sbjct: 183 VEPGNPDIRAARQQ-----AAHPPTLPVTLVHEKRINPFLRTAHPAVACRAAEAAGRPLP 237

Query: 240 SNLAVFTELRIRKNQS 255
              AVF  LR  KN+ 
Sbjct: 238 DETAVFAALREWKNRF 253


>gi|71892005|ref|YP_277735.1| hydroxyacylglutathione hydrolase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|123641084|sp|Q493H8|GLO2_BLOPB RecName: Full=Hydroxyacylglutathion