RPSBLAST alignment for GI: 254780583 and conserved domain: PLN02962

>gnl|CDD|178547 PLN02962, PLN02962, hydroxyacylglutathione hydrolase. Length = 251
 Score = 49.4 bits (118), Expect = 8e-07
 Identities = 43/155 (27%), Positives = 64/155 (41%), Gaps = 35/155 (22%)

Query: 40  KMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSKIPGI---------- 89
            +++E G  L +  NTH H DH      LK              +K+PG+          
Sbjct: 53  SLVKELGLKLIYAMNTHVHADHVTGTGLLK--------------TKLPGVKSIISKASGS 98

Query: 90  --DHGLSDGDTFDFGSHPIKIIATPGHTIGHICY------HFMNDHFLCVGDTLFSLGCG 141
             D  +  GD   FG   +++ ATPGHT G + Y                GD L   GCG
Sbjct: 99  KADLFVEPGDKIYFGDLYLEVRATPGHTAGCVTYVTGEGPDQPQPRMAFTGDALLIRGCG 158

Query: 142 RI-FED-SYAEMFESLE-KIKSFSDKTHIYFGHEY 173
           R  F+  S  ++++S+  +I +    T IY  H+Y
Sbjct: 159 RTDFQGGSSDQLYKSVHSQIFTLPKDTLIYPAHDY 193