RPSBLAST alignment for GI: 254780583 and conserved domain: KOG0813

>gnl|CDD|36031 KOG0813, KOG0813, KOG0813, Glyoxylase [General function prediction only]. Length = 265
 Score =  180 bits (458), Expect = 3e-46
 Identities = 89/253 (35%), Positives = 127/253 (50%), Gaps = 9/253 (3%)

Query: 13  DNFCILIH-NHKYRLTAAID---APDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNL 68
           DN+  L+    K      +D           K L ++   LT I  THHH DH+  N ++
Sbjct: 12  DNYMYLLGDGDKTIDADLVDPAEPEYVIPSLKKLDDENRRLTAILTTHHHYDHSGGNEDI 71

Query: 69  KKFFNCTIFGPLEESSKIPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHF---MN 125
           K+     I        +IPGI  GL DG+T   G   ++ + TPGHT GHICY+      
Sbjct: 72  KREIPYDIKVIGGADDRIPGITRGLKDGETVTVGGLEVRCLHTPGHTAGHICYYVTESTG 131

Query: 126 DHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCD 185
           +  +  GDTLF  GCGR FE +  +M  SL ++ +  D T IY GHEYT++N  FA   +
Sbjct: 132 ERAIFTGDTLFGAGCGRFFEGTAEQMDSSLNELIALPDDTRIYPGHEYTKSNLKFARYVE 191

Query: 186 PHNLELQKYCSKVKSMRSQNLYTN-PSTISLEKKVNPFLRIENTSLRKNLNM-ENASNLA 243
           P N   Q+    +   RS+   T  PST+  EK  NPF+R++   ++K L + E A  + 
Sbjct: 192 PRNEVEQEKLDWLVERRSKEKPTMVPSTLGEEKLYNPFMRLKKEKVQKALGLTETADRIV 251

Query: 244 VFTELRIRKNQSK 256
           V  +LR  KN+  
Sbjct: 252 VMGKLRELKNRFS 264