RPSBLAST alignment of GI: 254780583 and protein with PDBid: 1vme

>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410
 Score = 63.2 bits (153), Expect = 5e-11
 Identities = 21/143 (14%), Positives = 36/143 (25%), Gaps = 13/143 (9%)

Query: 27  TAAIDAPDTYIISKMLRE-----KGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLE 81
              ID        + +           +THI   H   DH+ +     K     +     
Sbjct: 63  NVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIAS 122

Query: 82  ESSKI-------PGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMNDHFLCVGDT 134
              K              + DG+  + G    K + TP          +++       D 
Sbjct: 123 NFGKRLLEGFYGIKDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYLDGILFS-CDV 181

Query: 135 LFSLGCGRIFEDSYAEMFESLEK 157
                   I +DS   + E    
Sbjct: 182 GGGYLLPEILDDSNESVVERYLP 204