RPSBLAST alignment of GI: 254780583 and protein with PDBid: 2gcu

>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245
 Score = 93.9 bits (232), Expect = 3e-20
 Identities = 48/210 (22%), Positives = 67/210 (31%), Gaps = 13/210 (6%)

Query: 28  AAIDA--PDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEESSK 85
             ID          K++ E G  L +  NTH H DH      LK           +    
Sbjct: 31  LLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKA--S 88

Query: 86  IPGIDHGLSDGDTFDFGSHPIKIIATPGHTIGHICY------HFMNDHFLCVGDTLFSLG 139
               D  L  GD    G   +++ ATPGHT G + Y                GD +   G
Sbjct: 89  GSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRG 148

Query: 140 CGRIFEDSYAE---MFESLEKIKSFSDKTHIYFGHEYTENNAYFALSCDPHNLELQKYCS 196
           CGR      +          +I +    T IY  H+Y             HN  L K   
Sbjct: 149 CGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKE 208

Query: 197 KVKSMRSQNLYTNPSTISLEKKVNPFLRIE 226
             K++ S    + P  I +    N    ++
Sbjct: 209 TFKTIMSNLNLSYPKMIDVAVPANMVCGLQ 238