RPSBLAST alignment of GI: 254780583 and protein with PDBid: 3iog

>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding, periplasm,; HET: SDF; 1.41A {Aeromonas hydrophila} PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A Length = 227
 Score = 74.4 bits (182), Expect = 2e-14
 Identities = 28/169 (16%), Positives = 52/169 (30%), Gaps = 28/169 (16%)

Query: 30  IDAPDTYIISKMLREK-----GWFLTHIFNTHHHIDHTRANLNLKKFFNCTIFGP----- 79
           + A  T   ++ L +         +  + NT++H D    N   K      +        
Sbjct: 37  VGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQTRDL 96

Query: 80  ---------------LEESSKIPGIDHGLSDGDTFDFGSHPIKII-ATPGHTIGHICYHF 123
                          L E   +P +   +     F      ++   A P HT   I  +F
Sbjct: 97  MKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVYF 156

Query: 124 MNDHFLCVGDTLFSLGCGRIFEDSYAEMFESLEKIKSFS-DKTHIYFGH 171
            ++  L  G  L     G +         ++LE++K+       +  GH
Sbjct: 157 PDEQVLYGGCILKE-KLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGH 204