RPSBLAST alignment of GI: 254780583 and SCOP domain: d2gmna1

Alignment
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Length = 264
 Score = 72.8 bits (177), Expect = 3e-14
 Identities = 35/192 (18%), Positives = 59/192 (30%), Gaps = 33/192 (17%)

Query: 30  IDA---PDTYIISKMLREKGWF---LTHIFNTHHHIDHTRANLNLKKFFNCTIFGPLEES 83
           +D      T +I   + + G+    +  I NTH H+DHT     +KK     +     + 
Sbjct: 41  MDTAMPQSTGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKKETGAQLVAGERDK 100

Query: 84  SKIPG------------------IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMN 125
             + G                  +D  + +GD    G   +   ATPGH+ G   +    
Sbjct: 101 PLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWEMTV 160

Query: 126 DH--------FLCVGDTLFSLGCGRI-FEDSYAEMFESLEKIKSFSDKTHIYFGHEYTEN 176
                     F C G    +   G+  +     +   +  K K+      +    E    
Sbjct: 161 KDGKEDREVLFFCSGTVALNRLVGQPTYAGIVDDYRATFAKAKAMKIDVLLGPHPEVYGM 220

Query: 177 NAYFALSCDPHN 188
            A  A   D   
Sbjct: 221 QAKRAEMKDGAP 232

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Zn metallo-beta-lactamase
domain: Zn metallo-beta-lactamase
species: Bradyrhizobium japonicum [TaxId: 375]