RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) >3bbo_Y Ribosomal protein L28; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Nicotiana tabacum} (Y:) Length = 151 Score = 73.4 bits (180), Expect = 9e-15 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Query: 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60 R+C T K NKVSH+N+KT++ NL + + ++ +LR+S A++++E Sbjct: 74 ARRICPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIE 133 Query: 61 RQGGLDRFLSNSKKENLS 78 + GLD + + Sbjct: 134 K-NGLDAVAKKAGIDLSK 150 >2jz6_A 50S ribosomal protein L28; structure, NESG, ribonucleoprotein, structural genomics, PSI-2, protein structure initiative; NMR {Thermotoga maritima MSB8} (A:) Length = 77 Score = 73.1 bits (180), Expect = 1e-14 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60 M++ CE+ K SGN VSH++ K+ R F PNL ++ ++ ++R+ L+S + Sbjct: 6 MAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKSGK 64 Query: 61 RQGGLD 66 + + Sbjct: 65 VKKYVG 70 >2jl6_1 50S ribosomal protein L28, 50S ribosomal protein L25; methylation, translation, paromomycin, tRNA-binding, tRNA, zinc, mRNA, ribosome, repressor, RNA-binding; 3.45A {Thermus thermophilus} PDB: 2jl8_1 (1:) Length = 89 Score = 71.0 bits (174), Expect = 5e-14 Identities = 15/91 (16%), Positives = 32/91 (35%), Gaps = 15/91 (16%) Query: 1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47 MS+VCE++ K + N + ++RR PNL ++ + Q+ Sbjct: 1 MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVA--GQEI 58 Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENLS 78 R++ + V + + + Sbjct: 59 TFRVAASHIPKVYELVERAAAAAAAAAAAAA 89 >3i1n_X 50S ribosomal protein L28; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 2qao_Z* 2qba_Z* 2qbc_Z* 2qbe_Z 2qbg_Z 2qbi_Z* 2qbk_Z* 2qov_Z 2qox_Z 2qoz_Z* 2qp1_Z* 2z4l_Z* 2z4n_Z* 3df2_Z 3df4_Z 2qam_Z 3i1p_X 3i1r_X 3i1t_X 3i20_X ... (X:1-33) Length = 33 Score = 57.7 bits (140), Expect = 5e-10 Identities = 21/33 (63%), Positives = 26/33 (78%) Query: 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33 MSRVC++T K ++GN SHA N T+RRFLPNL Sbjct: 1 MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNL 33 >2zjr_U 50S ribosomal protein L28; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} (U:1-47) Length = 47 Score = 44.5 bits (105), Expect = 5e-06 Identities = 13/46 (28%), Positives = 15/46 (32%), Gaps = 13/46 (28%) Query: 1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNL 33 MSR C LT K + N V T+R NL Sbjct: 1 MSRECYLTGKKNLVVNSVIRRGKARADGGVGRKTTGITKRVQRANL 46 >2j01_1 50S ribosomal protein L28; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} (1:1-46) Length = 46 Score = 30.6 bits (69), Expect = 0.078 Identities = 12/46 (26%), Positives = 19/46 (41%), Gaps = 13/46 (28%) Query: 1 MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNL 33 MS+VCE++ K + N + ++RR PNL Sbjct: 1 MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNL 46 >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} (A:) Length = 208 Score = 25.8 bits (55), Expect = 2.3 Identities = 4/22 (18%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 23 NKTRRRFL--PNLCRITLISDI 42 T + + ++ SDI Sbjct: 13 LGTENLYFQSNAMMKLMFASDI 34 >2j0j_A Focal adhesion kinase 1; cell migration, phosphorylation, FERM, transferase, ATP-binding, integrin signaling, nucleotide-binding; HET: 4ST; 2.8A {Gallus gallus} PDB: 2j0k_A* (A:132-221) Length = 90 Score = 25.0 bits (55), Expect = 3.4 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 53 KCALRSVERQGGLDRFLSNSKKENLSAR-MRTLRSQILKK 91 K +E+ GL RF S +++ A+ +R L Q ++ Sbjct: 30 KSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQ 69 >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} (A:132-221) Length = 90 Score = 25.0 bits (55), Expect = 3.4 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 53 KCALRSVERQGGLDRFLSNSKKENLSAR-MRTLRSQILKK 91 K +E+ GL RF S +++ A+ +R L Q ++ Sbjct: 30 KSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQ 69 >3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua} (A:1-28,A:284-349) Length = 94 Score = 25.1 bits (54), Expect = 3.8 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 9 KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49 +K ++ K NNKT R F+ N C+I L+ + Y L Sbjct: 15 EKFYLADTKEQFLNNKTYRDFVLNSCQI-LVENAKLDGYLL 54 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.128 0.342 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 603,860 Number of extensions: 21450 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 12 Length of query: 97 Length of database: 4,956,049 Length adjustment: 57 Effective length of query: 40 Effective length of database: 3,029,164 Effective search space: 121166560 Effective search space used: 121166560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.5 bits)