BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str. psy62] (97 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 194 bits (493), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE Sbjct: 1 MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60 Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS Sbjct: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97 >gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Score = 22.7 bits (47), Expect = 1.5, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 5 CELTKKTVMSGNKVSH 20 CE+ K T+ G+K++H Sbjct: 333 CEVKKATIKEGSKINH 348 >gi|254780156|ref|YP_003064569.1| putative inositol-1-monophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 256 Score = 21.9 bits (45), Expect = 2.5, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 13 MSGNKVSHANNKTRRRFLPNLCRI 36 +S + + +A K RFL LCRI Sbjct: 149 LSNSIICYATFKRNSRFLMQLCRI 172 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 21.2 bits (43), Expect = 3.6, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 39 ISDIMEQKYQLRISKCALRS 58 I E+ +QLR SK A+R+ Sbjct: 379 IKPYFEEHHQLRYSKEAIRA 398 >gi|254780645|ref|YP_003065058.1| hypothetical protein CLIBASIA_02660 [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 20.4 bits (41), Expect = 5.8, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 78 SARMRTLRSQILKKMSEKSS 97 + +MR L L+K+SEK S Sbjct: 43 AVKMRILVESFLRKLSEKES 62 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.128 0.342 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,434 Number of Sequences: 1233 Number of extensions: 1695 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 97 length of database: 328,796 effective HSP length: 61 effective length of query: 36 effective length of database: 253,583 effective search space: 9128988 effective search space used: 9128988 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)