Query gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str. psy62] Match_columns 101 No_of_seqs 105 out of 1502 Neff 5.8 Searched_HMMs 39220 Date Sun May 29 21:43:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780586.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK11628 transcriptional regul 100.0 3.3E-34 8.5E-39 205.8 10.9 90 6-100 1-90 (105) 2 COG0271 BolA Stress-induced mo 100.0 6.4E-30 1.6E-34 182.6 9.1 84 10-97 6-89 (90) 3 KOG2313 consensus 100.0 3.1E-28 7.9E-33 173.5 9.2 93 3-95 6-100 (100) 4 pfam01722 BolA BolA-like prote 99.9 5.7E-26 1.5E-30 161.2 8.2 71 15-95 2-72 (72) 5 KOG3348 consensus 99.9 1.5E-24 3.9E-29 153.5 7.7 82 6-99 2-83 (85) 6 COG5007 Predicted transcriptio 99.9 1.8E-21 4.6E-26 136.8 9.2 76 9-99 3-79 (80) 7 TIGR00559 pdxJ pyridoxal phosp 50.8 8.3 0.00021 19.4 1.4 45 54-98 141-190 (265) 8 TIGR01249 pro_imino_pep_1 prol 38.5 22 0.00056 17.1 2.0 26 15-44 273-298 (310) 9 PRK11190 putative DNA uptake p 38.0 31 0.00078 16.3 2.7 16 7-22 106-121 (192) 10 COG2108 Uncharacterized conser 37.6 35 0.0009 16.0 3.0 30 61-93 90-119 (353) 11 pfam10330 Stb3 Putative Sin3 b 30.0 44 0.0011 15.5 2.4 25 52-76 31-55 (93) 12 TIGR02116 toxin_Txe_YoeB addic 20.5 4.3 0.00011 20.9 -4.2 14 64-77 57-70 (82) No 1 >PRK11628 transcriptional regulator BolA; Provisional Probab=100.00 E-value=3.3e-34 Score=205.82 Aligned_cols=90 Identities=33% Similarity=0.491 Sum_probs=84.8 Q ss_pred CHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCCEEE Q ss_conf 41999999999841995179999506568887777789985089999982034799888999999999999833782287 Q gi|254780586|r 6 TSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHAL 85 (101) Q Consensus 6 ~~~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~iHAl 85 (101) |++.++|+++|..+|+|.+++|+|+|++|.||.| +++||+|+|||+.|.|+++|+|||+||++|+++|+++|||| T Consensus 1 M~i~~~I~~kL~~~f~p~~L~V~deS~~H~~~~g-----~esHf~v~IvS~~F~g~s~i~RHR~Vy~~L~~el~~~IHAL 75 (105) T PRK11628 1 MMIREQIEEKLRAAFQPVFLEVVDESYRHNVPAG-----SESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHAL 75 (105) T ss_pred CCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC-----CCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHCCCCCHH T ss_conf 9779999999984279858999879877789999-----97748999985675999899999999999999982897512 Q ss_pred EEECCCHHHHHHHHC Q ss_conf 776076899998533 Q gi|254780586|r 86 SIEAFSPDEKHTLKN 100 (101) Q Consensus 86 sik~~tp~E~~~~k~ 100 (101) +|+||||+||++++. T Consensus 76 si~~~Tp~Ew~~~~~ 90 (105) T PRK11628 76 ALHTYTIKEWEGLQD 90 (105) T ss_pred EEECCCHHHHHHCCC T ss_conf 454189999985469 No 2 >COG0271 BolA Stress-induced morphogen (activity unknown) [Signal transduction mechanisms] Probab=99.96 E-value=6.4e-30 Score=182.58 Aligned_cols=84 Identities=39% Similarity=0.681 Sum_probs=80.4 Q ss_pred HHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 99999998419951799995065688877777899850899999820347998889999999999998337822877760 Q gi|254780586|r 10 NRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEA 89 (101) Q Consensus 10 ~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~iHAlsik~ 89 (101) ++|+++|+..|+|..++|+|+|++|.||.| +|++||+|.|||+.|+|+|+|+|||+||++|+|+|.++||||+|+| T Consensus 6 ~~Ie~~l~~~f~p~~l~i~deS~~h~~~~~----g~~~Hf~i~IVS~~F~G~s~v~rHr~V~~~L~del~~~iHALal~t 81 (90) T COG0271 6 ERIEKKLRAAFPPSFLEIIDESHRHHGHAG----GGGSHFKVVIVSEAFQGKSLVARHRLVYSALKDELSGGIHALALHT 81 (90) T ss_pred HHHHHHHHHCCCCCEEEEEECCCCCCCCCC----CCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEE T ss_conf 999999981189756999863445355789----9887089999765548852999999999999999835320047673 Q ss_pred CCHHHHHH Q ss_conf 76899998 Q gi|254780586|r 90 FSPDEKHT 97 (101) Q Consensus 90 ~tp~E~~~ 97 (101) +||+||.. T Consensus 82 ~t~~e~~~ 89 (90) T COG0271 82 YTPEEWKG 89 (90) T ss_pred ECCCHHCC T ss_conf 16611024 No 3 >KOG2313 consensus Probab=99.95 E-value=3.1e-28 Score=173.46 Aligned_cols=93 Identities=41% Similarity=0.539 Sum_probs=85.8 Q ss_pred CCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCC-CCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCC- Q ss_conf 5514199999999984199517999950656888777778-99850899999820347998889999999999998337- Q gi|254780586|r 3 ICHTSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFN-GLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKE- 80 (101) Q Consensus 3 i~~~~~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~-~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~- 80 (101) -.++++..+|.++|...|.|..+++.|+|++|+||++-.. .++|+||+|.|||+.|+|+++|+||||||++|+||+.+ T Consensus 6 ~~~g~~~~ri~~~l~~~lkp~~le~~n~S~~hagH~~~kg~~~~EtHFrv~vVS~~FeG~s~v~RHRlVy~~L~eEl~~~ 85 (100) T KOG2313 6 GIYGPRESRIREKLFEALKPLNLELYNESHQHAGHAVPKGMDGAETHFRVEVVSSAFEGLSLVKRHRLVYKALKEELAGT 85 (100) T ss_pred CCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHHCC T ss_conf 66273999999875764075148886146554445556578788667899983344477418899999999999986065 Q ss_pred CCEEEEEECCCHHHH Q ss_conf 822877760768999 Q gi|254780586|r 81 ELHALSIEAFSPDEK 95 (101) Q Consensus 81 ~iHAlsik~~tp~E~ 95 (101) ++|||+|.++||+|| T Consensus 86 gvHAL~i~aKTP~e~ 100 (100) T KOG2313 86 GVHALSIMAKTPSEV 100 (100) T ss_pred CEEEEEEECCCCCCC T ss_conf 425777632587779 No 4 >pfam01722 BolA BolA-like protein. This family consist of the morphoprotein BolA from E. coli and its various homologues. In E. coli over expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase. BolA is also induced by stress during early stages of growth and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5. Probab=99.93 E-value=5.7e-26 Score=161.18 Aligned_cols=71 Identities=39% Similarity=0.659 Sum_probs=67.2 Q ss_pred HHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCHHH Q ss_conf 99841995179999506568887777789985089999982034799888999999999999833782287776076899 Q gi|254780586|r 15 KIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDE 94 (101) Q Consensus 15 kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~iHAlsik~~tp~E 94 (101) +|+++|+|..++|.|+|++| +++||+|+|+|+.|.|||+|+|||+||++|+++|+++||||+|+|+||+| T Consensus 2 lL~~~~~~~~l~V~d~S~~~----------~gsHf~i~IvS~~F~g~s~i~rhr~V~~~L~~~~~~~iHAlsikt~t~~E 71 (72) T pfam01722 2 LLTAALPPAHLEVEDESHKG----------GGSHFKVVVVSDAFEGKSLVKRHRLVYAALKEELASGIHALSIKTYTPEE 71 (72) T ss_pred HHHHHCCCCEEEEEECCCCC----------CCCCEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC T ss_conf 45854998489999689999----------87718999982676899689999999999999974896157989477012 Q ss_pred H Q ss_conf 9 Q gi|254780586|r 95 K 95 (101) Q Consensus 95 ~ 95 (101) | T Consensus 72 ~ 72 (72) T pfam01722 72 W 72 (72) T ss_pred C T ss_conf 9 No 5 >KOG3348 consensus Probab=99.91 E-value=1.5e-24 Score=153.45 Aligned_cols=82 Identities=35% Similarity=0.519 Sum_probs=75.9 Q ss_pred CHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCCCEEE Q ss_conf 41999999999841995179999506568887777789985089999982034799888999999999999833782287 Q gi|254780586|r 6 TSLINRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHAL 85 (101) Q Consensus 6 ~~~~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~iHAl 85 (101) +.-.+.++++|+..|.|.+++|.|+| |||++.|.|.|||+.|+|+++|+|||+||.+|.++|+. |||| T Consensus 2 ~~~e~~l~~~L~~~l~p~~v~V~D~S-----------gGCG~~F~v~IvS~~FeGKs~L~rHRlVN~~L~Eeik~-iHal 69 (85) T KOG3348 2 TVTEERLEELLTEALEPEHVEVQDVS-----------GGCGSMFDVVIVSAAFEGKSLLARHRLVNSILAEEIKE-IHAL 69 (85) T ss_pred CCHHHHHHHHHHHHCCCEEEEEEECC-----------CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH-HHHH T ss_conf 50689999999834484699999757-----------98664078999731007717999999999999999998-7653 Q ss_pred EEECCCHHHHHHHH Q ss_conf 77607689999853 Q gi|254780586|r 86 SIEAFSPDEKHTLK 99 (101) Q Consensus 86 sik~~tp~E~~~~k 99 (101) +++||||++|.+.. T Consensus 70 t~kt~t~~~w~~~~ 83 (85) T KOG3348 70 TIKTYTPEEWSKAS 83 (85) T ss_pred EEEECCHHHHCCCC T ss_conf 33323765504444 No 6 >COG5007 Predicted transcriptional regulator, BolA superfamily [Transcription] Probab=99.86 E-value=1.8e-21 Score=136.78 Aligned_cols=76 Identities=28% Similarity=0.447 Sum_probs=70.0 Q ss_pred HHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEHHHCCCCHHHHHHHHHHHHHHHHCCC-CEEEEE Q ss_conf 9999999984199517999950656888777778998508999998203479988899999999999983378-228777 Q gi|254780586|r 9 INRITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEE-LHALSI 87 (101) Q Consensus 9 ~~~I~~kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~~~sHf~i~IvS~~F~g~s~i~rHr~V~~~L~~e~~~~-iHAlsi 87 (101) .++|+..|...|+.+.++|+.+ ++||.+++||+.|.|+|+|+|||+||+.|.+.|.++ ||||+| T Consensus 3 ~e~Ik~ll~~~L~~e~v~V~Gd---------------g~Hf~vi~Vs~~F~g~srvkrqq~vYApL~~~i~~~~IHAlsi 67 (80) T COG5007 3 NEEIKSLLENALPLEEVEVEGD---------------GSHFQVIAVSEEFAGKSRVKRQQLVYAPLMAYIADNEIHALSI 67 (80) T ss_pred HHHHHHHHHHCCCCCEEEEECC---------------CCEEEEEEEHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEE T ss_conf 7999999982288527899627---------------7248998864866672377878888998998851285278886 Q ss_pred ECCCHHHHHHHH Q ss_conf 607689999853 Q gi|254780586|r 88 EAFSPDEKHTLK 99 (101) Q Consensus 88 k~~tp~E~~~~k 99 (101) |+|||+||...+ T Consensus 68 kt~Tp~eW~~~~ 79 (80) T COG5007 68 KTYTPAEWARDR 79 (80) T ss_pred EECCHHHHHHCC T ss_conf 515888961402 No 7 >TIGR00559 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy . PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic . In Escherichia coli, the pdx genes involved in vitamin B6 have been characterised , , . This entry represents PdxJ, which catalyses the condensation of 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one and 1-deoxy-D-xylulose-5-phosphate to form pyridoxine-5'-phosphate. The product of the PdxJ reaction is then oxidized by PdxH to pyridoxal 5'-phosphate.; GO: 0008615 pyridoxine biosynthetic process, 0005737 cytoplasm. Probab=50.79 E-value=8.3 Score=19.39 Aligned_cols=45 Identities=22% Similarity=0.333 Sum_probs=36.0 Q ss_pred EEHHHCCCCHHHHHHHHHHHHHHHHC----CCCEEEE-EECCCHHHHHHH Q ss_conf 82034799888999999999999833----7822877-760768999985 Q gi|254780586|r 54 VSPTFTGISKTFRHRKIYDLLHKEIK----EELHALS-IEAFSPDEKHTL 98 (101) Q Consensus 54 vS~~F~g~s~i~rHr~V~~~L~~e~~----~~iHAls-ik~~tp~E~~~~ 98 (101) ....=.|-..|+-|==+|+.|..++. +.|||+| +|-++|+|.++- T Consensus 141 ~~A~e~g~~~iE~hTg~YA~~~~~~~~nannqihaisvlkdksP~e~~~e 190 (265) T TIGR00559 141 SAAAEVGADRIEIHTGVYANLYNKLYSNANNQIHAISVLKDKSPKELKEE 190 (265) T ss_pred HHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHH T ss_conf 99997089848850224689888774100132122311115886899999 No 8 >TIGR01249 pro_imino_pep_1 proline iminopeptidase; InterPro: IPR005944 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases . Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This group of serine peptidase belong to MEROPS peptidase family S33 (clan SC). They are proline iminopeptidase (Prolyl aminopeptidase, 3.4.11.5 from EC), which catalyzes the removal of the N-terminal proline from peptides. This family represents one of two related families of proline iminopeptidase containing the alpha/beta fold. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members. ; GO: 0016804 prolyl aminopeptidase activity, 0005737 cytoplasm. Probab=38.46 E-value=22 Score=17.10 Aligned_cols=26 Identities=23% Similarity=0.346 Sum_probs=21.4 Q ss_pred HHHHHCCCCEEEEEEECCCCCCCCCCCCCC Q ss_conf 998419951799995065688877777899 Q gi|254780586|r 15 KIRIALSPDDLQVINESHLHVGHQPQFNGL 44 (101) Q Consensus 15 kL~~~l~~~~i~V~D~S~~H~gH~~~~~~~ 44 (101) -|.++||...|.|+.+ |||.++.++. T Consensus 273 aL~kafPea~L~v~~~----AGHsa~dp~~ 298 (310) T TIGR01249 273 ALHKAFPEAELKVVNN----AGHSAFDPNN 298 (310) T ss_pred HHHHCCCCCEEEEECC----CCCCCCCHHH T ss_conf 6752185514667457----8866576547 No 9 >PRK11190 putative DNA uptake protein; Provisional Probab=37.98 E-value=31 Score=16.30 Aligned_cols=16 Identities=19% Similarity=0.515 Sum_probs=7.3 Q ss_pred HHHHHHHHHHHHHCCC Q ss_conf 1999999999841995 Q gi|254780586|r 7 SLINRITEKIRIALSP 22 (101) Q Consensus 7 ~~~~~I~~kL~~~l~~ 22 (101) ++.++|+..|...+.| T Consensus 106 ~l~~~i~~vl~~~i~P 121 (192) T PRK11190 106 PLMERVEYVLQSQINP 121 (192) T ss_pred CHHHHHHHHHHHHCCH T ss_conf 5999999999873195 No 10 >COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Probab=37.59 E-value=35 Score=15.98 Aligned_cols=30 Identities=23% Similarity=0.403 Sum_probs=22.9 Q ss_pred CCHHHHHHHHHHHHHHHHCCCCEEEEEECCCHH Q ss_conf 988899999999999983378228777607689 Q gi|254780586|r 61 ISKTFRHRKIYDLLHKEIKEELHALSIEAFSPD 93 (101) Q Consensus 61 ~s~i~rHr~V~~~L~~e~~~~iHAlsik~~tp~ 93 (101) +-+|+|-.-+-++|++||....| |++||+. T Consensus 90 l~~ieR~~~~ir~LK~efG~~fH---iHLYT~g 119 (353) T COG2108 90 LLEIERTVEYIRLLKDEFGEDFH---IHLYTTG 119 (353) T ss_pred HHHHHHHHHHHHHHHHHHCCCEE---EEEEECC T ss_conf 89999999999999876353205---9984066 No 11 >pfam10330 Stb3 Putative Sin3 binding protein. This is a family of the conserved N-terminal end of a group of proteins conserved in fungi. It is likely to be a Sin3 binding protein. Sin3p does not bind DNA directly even though the yeast SIN3 gene functions as a transcriptional repressor. Sin3p is part of a large multiprotein complex. Stb3 appears to bind directly to ribosomal RNA Processing Elements (RRPE) although there are no obvious domains which would accord with this, implying that Stb3 may be a novel RNA-binding protein. Probab=30.02 E-value=44 Score=15.47 Aligned_cols=25 Identities=24% Similarity=0.329 Sum_probs=21.2 Q ss_pred EEEEHHHCCCCHHHHHHHHHHHHHH Q ss_conf 9982034799888999999999999 Q gi|254780586|r 52 KIVSPTFTGISKTFRHRKIYDLLHK 76 (101) Q Consensus 52 ~IvS~~F~g~s~i~rHr~V~~~L~~ 76 (101) ...-+.|++++.-++-|+|..+|+. T Consensus 31 t~~vPgF~~l~~sKqRRLi~~AlE~ 55 (93) T pfam10330 31 TTSVPGFSDLSPSKQRRLIVAALEG 55 (93) T ss_pred HCCCCCCCCCCHHHHHHHHHHHHHC T ss_conf 1147884658989999999999862 No 12 >TIGR02116 toxin_Txe_YoeB addiction module toxin, Txe/YoeB family; InterPro: IPR009614 The Axe-Txe pair in Enterococcus faecium and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This family describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by match to.. Probab=20.47 E-value=4.3 Score=20.94 Aligned_cols=14 Identities=36% Similarity=0.415 Sum_probs=10.7 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 89999999999998 Q gi|254780586|r 64 TFRHRKIYDLLHKE 77 (101) Q Consensus 64 i~rHr~V~~~L~~e 77 (101) =++||+||.+..++ T Consensus 57 ~~eHRLVY~V~d~~ 70 (82) T TIGR02116 57 TDEHRLVYLVEDDE 70 (82) T ss_pred CCCCEEEEEEECCC T ss_conf 75650577875794 Done!