RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|30620 COG0271, BolA, Stress-induced morphogen (activity unknown) [Signal transduction mechanisms]. Length = 90 Score = 75.8 bits (186), Expect = 3e-15 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Query: 11 RITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKI 70 RI +K+R A P L++I+ESH H GH G G +H ++ IVS F G S RHR + Sbjct: 7 RIEKKLRAAFPPSFLEIIDESHRHHGHA----GGGGSHFKVVIVSEAFQGKSLVARHRLV 62 Query: 71 YDLLHKEIKEELHALSIEAFSPDE 94 Y L E+ +HAL++ ++P+E Sbjct: 63 YSALKDELSGGIHALALHTYTPEE 86 >gnl|CDD|145069 pfam01722, BolA, BolA-like protein. This family consist of the morphoprotein BolA from E. coli and its various homologues. In E. coli over expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase. BolA is also induced by stress during early stages of growth and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5. Length = 72 Score = 74.9 bits (185), Expect = 5e-15 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 10/81 (12%) Query: 14 EKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKIYDL 73 + + AL P L+V +ESH G +H ++ +VS F G S RHR +Y Sbjct: 1 KLLTAALPPAHLEVEDESHKG----------GGSHFKVVVVSDAFEGKSLVKRHRLVYAA 50 Query: 74 LHKEIKEELHALSIEAFSPDE 94 L +E+ +HALSI+ ++P+E Sbjct: 51 LKEELASGIHALSIKTYTPEE 71 >gnl|CDD|37524 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31+ [Signal transduction mechanisms]. Length = 100 Score = 72.8 bits (178), Expect = 2e-14 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 2/88 (2%) Query: 9 INRITEKIRIALSPDDLQVINESHLHVGHQ-PQFNGLGETHIRIKIVSPTFTGISKTFRH 67 +RI EK+ AL P +L++ NESH H GH P+ ETH R+++VS F G+S RH Sbjct: 12 ESRIREKLFEALKPLNLELYNESHQHAGHAVPKGMDGAETHFRVEVVSSAFEGLSLVKRH 71 Query: 68 RKIYDLLHKEIKEE-LHALSIEAFSPDE 94 R +Y L +E+ +HALSI A +P E Sbjct: 72 RLVYKALKEELAGTGVHALSIMAKTPSE 99 >gnl|CDD|38558 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induced morphogen)-related protein [Signal transduction mechanisms]. Length = 85 Score = 43.0 bits (101), Expect = 2e-05 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 12/85 (14%) Query: 11 RITEKIRIALSPDDLQVINESHLHVGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHRKI 70 R+ E + AL P+ ++V + S G G + IVS F G S RHR + Sbjct: 7 RLEELLTEALEPEHVEVQDVS----------GGCGSM-FDVVIVSAAFEGKSLLARHRLV 55 Query: 71 YDLLHKEIKEELHALSIEAFSPDEK 95 +L +EIK E+HAL+I+ ++P+E Sbjct: 56 NSILAEEIK-EIHALTIKTYTPEEW 79 >gnl|CDD|34612 COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription]. Length = 80 Score = 39.5 bits (92), Expect = 2e-04 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 48 HIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKE-ELHALSIEAFSPDE 94 H ++ VS F G S+ R + +Y L I + E+HALSI+ ++P E Sbjct: 27 HFQVIAVSEEFAGKSRVKRQQLVYAPLMAYIADNEIHALSIKTYTPAE 74 >gnl|CDD|37006 KOG1795, KOG1795, KOG1795, U5 snRNP spliceosome subunit [RNA processing and modification]. Length = 2321 Score = 27.7 bits (61), Expect = 0.80 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 11/82 (13%) Query: 28 INESHLHVGHQPQFNGLGETHIRIKIVSPTFT-GISKTFR-------HRKIYDLLHKEIK 79 IN ++++VG Q Q L T I + PT + + FR H + + L + Sbjct: 1535 INRANVYVGFQVQ---LDLTGIYMHGKIPTLKISLIQIFRAHLWQKIHESVVNDLCQVFD 1591 Query: 80 EELHALSIEAFSPDEKHTLKNH 101 +EL ALSIE + H K++ Sbjct: 1592 QELDALSIETVQKETIHPRKSY 1613 >gnl|CDD|30407 COG0058, GlgP, Glucan phosphorylase [Carbohydrate transport and metabolism]. Length = 750 Score = 26.4 bits (58), Expect = 1.6 Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 67 HRKIYDLLHKEIKEELHALSIEAFSPDEKHTLKN 100 +Y L E+K L + FSP K KN Sbjct: 645 PNALYYELENEVKPVLDEIIDGRFSPGWKSRFKN 678 >gnl|CDD|31569 COG1379, COG1379, Uncharacterized conserved protein [Function unknown]. Length = 403 Score = 25.7 bits (56), Expect = 2.8 Identities = 6/32 (18%), Positives = 14/32 (43%) Query: 37 HQPQFNGLGETHIRIKIVSPTFTGISKTFRHR 68 H P + LG + ++ +F + K + + Sbjct: 195 HSPYPHRLGREFNQFEVEEISFEELRKAIKGK 226 >gnl|CDD|176978 CHL00037, petA, cytochrome f. Length = 320 Score = 24.9 bits (55), Expect = 4.6 Identities = 10/27 (37%), Positives = 19/27 (70%) Query: 72 DLLHKEIKEELHALSIEAFSPDEKHTL 98 D + E+KE++ LS + +SP++K+ L Sbjct: 122 DRISPEMKEKIGNLSFQPYSPEKKNIL 148 >gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11. NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase (NP-GAPDH, EC=1.2.1.9) catalyzes the irreversible oxidation of glyceraldehyde 3-phosphate to 3-phosphoglycerate generating NADPH for biosynthetic reactions. This CD also includes the Arabidopsis thaliana osmotic-stress-inducible ALDH family 11, ALDH11A3 and similar sequences. In autotrophic eukaryotes, NP-GAPDH generates NADPH for biosynthetic processes from photosynthetic glyceraldehyde-3-phosphate exported from the chloroplast and catalyzes one of the classic glycolytic bypass reactions unique to plants. Length = 473 Score = 24.8 bits (55), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 59 TGISKTFRHRKIYDLLHKEIKEELHALSI 87 T I + H + D L + +KEE+ L + Sbjct: 283 TAIKRVLVHESVADELVELLKEEVAKLKV 311 >gnl|CDD|153272 cd07588, BAR_Amphiphysin, The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Amphiphysins function primarily in endocytosis and other membrane remodeling events. They contain an N-terminal BAR domain with an additional N-terminal amphipathic helix (an N-BAR), a variable central domain, and a C-terminal SH3 domain. This subfamily is composed of different isoforms of amphiphysin and Bridging integrator 2 (Bin2). Amphiphysin I proteins, enriched in the brain and nervous system, contain domains that bind clathrin, Adaptor Protein complex 2 (AP2), dynamin and synaptojanin. They function in synaptic vesicle endocytosis. Some amphiphysin II isoforms, also called Bridging integrator 1 (Bin1), are localized in many different tissues and may function in intracellular vesicle trafficking. In skeletal muscle, Bin1 plays a role in the organization and maintenance of the T-tubule network. Bin2 is mainly expressed in hematopoietic cells and is upregulated during granulocyte differentiation. The N-BAR domains of amphiphysins form a curved dimer with a positively-charged concave face that can drive membrane bending and curvature. Length = 211 Score = 24.6 bits (54), Expect = 5.5 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 68 RKIYDLLHKEIKEELHAL 85 +K+Y+ L+ E+ EEL AL Sbjct: 152 KKVYEELNTELHEELPAL 169 >gnl|CDD|38093 KOG2882, KOG2882, KOG2882, p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism]. Length = 306 Score = 24.5 bits (53), Expect = 7.0 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 7/63 (11%) Query: 40 QFNGLGETHIRI-KIVSPTFTGISKTFRHR-----KIYDLLHKEIKEELHALSIEAFSPD 93 +F LG ++ I S + I+ + R K+Y + + I+EEL E F Sbjct: 74 KFAKLGFNSVKEENIFSSAYA-IADYLKKRKPFGKKVYVIGEEGIREELDEAGFEYFGGG 132 Query: 94 EKH 96 Sbjct: 133 PDG 135 >gnl|CDD|37281 KOG2070, KOG2070, KOG2070, Guanine nucleotide exchange factor [Nucleotide transport and metabolism]. Length = 661 Score = 23.9 bits (51), Expect = 9.2 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Query: 59 TGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEKHTLK 99 TG+SK FR Y L +E+ E H +E + PD + Sbjct: 231 TGLSKPFRRLDKYPTLLQEL--ERH---MEDYHPDRGDIQR 266 >gnl|CDD|111276 pfam02367, UPF0079, Uncharacterized P-loop hydrolase UPF0079. This uncharacterized family contains a P-loop. Length = 123 Score = 23.8 bits (52), Expect = 9.7 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 9/52 (17%) Query: 43 GLGETHIRIKIVSPTFT------GISKTFRHRKIYDLLHKEIKEELHALSIE 88 GLG I + SPTFT H +Y L E E L L Sbjct: 38 GLG---ITGNVTSPTFTLVNVYEPGKLPLYHYDLYRLEDPEELELLGILDYA 86 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0805 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,245,578 Number of extensions: 58579 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's gapped: 180 Number of HSP's successfully gapped: 21 Length of query: 101 Length of database: 6,263,737 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,794,325 Effective search space: 158212725 Effective search space used: 158212725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.3 bits)