RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780588|ref|YP_003065001.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] (317 letters) >gnl|CDD|31167 COG0825, AccA, Acetyl-CoA carboxylase alpha subunit [Lipid metabolism]. Length = 317 Score = 443 bits (1141), Expect = e-125 Identities = 179/317 (56%), Positives = 235/317 (74%), Gaps = 1/317 (0%) Query: 1 MRHYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQK 60 M +YLDFE+PI++LEAKI ELK L+ E+ + D S+EI LE + + +IYS LTPWQ+ Sbjct: 1 MANYLDFEKPIAELEAKIDELKALA-EENDVDLSDEIERLEKRLAELTKKIYSNLTPWQR 59 Query: 61 TQVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSD 120 Q++RHP+RP+ +DYI LFT F+ L GDR F DDPA+ GLARF GQPV +IG +KG D Sbjct: 60 VQLARHPDRPYTLDYIELLFTDFVELHGDRAFADDPAIVGGLARFGGQPVVVIGHQKGRD 119 Query: 121 TKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIAR 180 TK ++K NFG PRPEGYRKA+RLM++A++F +P+I+FIDT GAYPG+ AE RGQ EAIAR Sbjct: 120 TKEKLKRNFGMPRPEGYRKALRLMKLAEKFGLPIITFIDTPGAYPGIGAEERGQSEAIAR 179 Query: 181 ATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSR 240 +L+VPI+SI+IGEGGSGGA+ I A+ V MLE++ YSVISPEG ASILW+D+S+ Sbjct: 180 NLREMARLKVPIISIVIGEGGSGGALAIGVADRVLMLENSTYSVISPEGCASILWKDASK 239 Query: 241 AAQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSET 300 A +AA AMKI A DL++L IIDGIIPEP+GGAHR+P ++ + + L E E Sbjct: 240 AKEAAEAMKITAHDLKELGIIDGIIPEPLGGAHRDPEAAAEALKNALLKELHELDKLPEE 299 Query: 301 EIREHRRQKYLNIGRNL 317 E+ R Q++ +IG Sbjct: 300 ELLARRYQRFRSIGLFE 316 >gnl|CDD|164574 CHL00198, accA, acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional. Length = 322 Score = 307 bits (787), Expect = 4e-84 Identities = 129/313 (41%), Positives = 197/313 (62%), Gaps = 3/313 (0%) Query: 3 HYLDFEEPISDLEAKIHELKKLS-REDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKT 61 H DF +P+++LE+++ EL KL+ + D + +++ + + EI+ LTP Q+ Sbjct: 7 HVPDFMKPLAELESQVEELSKLAPKNDKVIN--NKLKSFQRKLRILKKEIFYSLTPLQRL 64 Query: 62 QVSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDT 121 + R RP +DYI + +I L GDR DDPA+ G+ + +G+ + +G ++G +T Sbjct: 65 HLVRQSERPTTLDYIPYILDEWIELHGDRGGSDDPALVGGIGKINGRTIVFLGHQRGRNT 124 Query: 122 KSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARA 181 K + NFG P P GYRKA+RLM+ A++F +P+++FIDT GA+ GV AE GQGEAIA Sbjct: 125 KENVLRNFGMPSPGGYRKALRLMKHANKFGLPILTFIDTPGAWAGVKAEKLGQGEAIAVN 184 Query: 182 TEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSRA 241 +VPI+ IIGEGGSGGA+GI + + MLE+A+Y+V +PE A+ILW+DS ++ Sbjct: 185 LREMFSFEVPIICTIIGEGGSGGALGIGIGDSIMMLEYAVYTVATPEACAAILWKDSKKS 244 Query: 242 AQAAIAMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSETE 301 AA A+KI + DL+ L IID IIPEPIGGA +PA + + + + L S +E Sbjct: 245 LDAAEALKITSEDLKVLGIIDEIIPEPIGGAQADPASASKILKKKLIRQLDFLKILSPSE 304 Query: 302 IREHRRQKYLNIG 314 ++ HR +K+ +G Sbjct: 305 LKAHRYEKFRKLG 317 >gnl|CDD|112085 pfam03255, ACCA, Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit. Acetyl co-enzyme A carboxylase carboxyltransferase is composed of an alpha and beta subunit. Length = 145 Score = 207 bits (529), Expect = 3e-54 Identities = 78/146 (53%), Positives = 104/146 (71%), Gaps = 1/146 (0%) Query: 3 HYLDFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQ 62 L+FE+P+++LEAKI EL+KL+R++ + D S+EI LE + K EIYS LTPWQ+ Q Sbjct: 1 VLLEFEKPLAELEAKIDELRKLARKN-DVDVSDEIHRLEKKLDKLKREIYSNLTPWQRVQ 59 Query: 63 VSRHPNRPHYIDYINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTK 122 ++RHP+RP +DYI ++ FI L GDR DDPA+ GL R G+PV +IG +KG DTK Sbjct: 60 LARHPDRPTTLDYIENILDDFIELHGDRAGADDPAIVGGLGRIDGRPVVVIGHQKGRDTK 119 Query: 123 SRIKHNFGSPRPEGYRKAVRLMEMAD 148 + NFG P PEGYRKA+RLM+ AD Sbjct: 120 ENLLRNFGMPAPEGYRKALRLMKHAD 145 >gnl|CDD|144579 pfam01039, Carboxyl_trans, Carboxyl transferase domain. All of the members in this family are biotin dependent carboxylases. The carboxyl transferase domain carries out the following reaction; transcarboxylation from biotin to an acceptor molecule. There are two recognized types of carboxyl transferase. One of them uses acyl-CoA and the other uses 2-oxoacid as the acceptor molecule of carbon dioxide. All of the members in this family utilize acyl-CoA as the acceptor molecule. Length = 487 Score = 88.5 bits (220), Expect = 2e-18 Identities = 48/190 (25%), Positives = 72/190 (37%), Gaps = 35/190 (18%) Query: 100 IGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVISFID 159 G AR G PV ++ + + G + KA R + + D F IP++ +D Sbjct: 284 TGFARLGGIPVGVVANQP--------RVLAGVLFIDSADKAARFIRLCDAFNIPLVILVD 335 Query: 160 TAGAYPGVDAEARGQGEAIARATEMCL----KLQVPILSIIIGE--GGSGGAMGIAA--A 211 G PG D E G I + L + VP +++I + GG+ M A Sbjct: 336 VPGFLPGTDQEYGG----ILKHGAKLLYALAEATVPKITVIPRKAYGGAYVVMDSKINGA 391 Query: 212 NFVYMLEHAIYSVISPEGAASILWRDSSRAA-------QAAIAMKIIATDLQDLSI---- 260 + V A +V+ PEGA I +R AA +A A KI + Q Sbjct: 392 DAVAAWPTARIAVMGPEGAVEIKFRKELAAATMRYKDLEALRAQKIAEYEEQLSPPYVAA 451 Query: 261 ----IDGIIP 266 D +I Sbjct: 452 ARGFADLVID 461 Score = 34.9 bits (81), Expect = 0.029 Identities = 25/99 (25%), Positives = 38/99 (38%), Gaps = 6/99 (6%) Query: 125 IKHNF-----GSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIA 179 + GS P K R ME+A + P+I D+ GA E I Sbjct: 61 VVAQDFTVWGGSLGPAHGFKITRAMELAIKEGEPLIGINDSGGARIQEGVENLRGYGLIF 120 Query: 180 RATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLE 218 A +P +S++ G GGA A +F+ M++ Sbjct: 121 GANSR-ASGVIPQISLVTGPCAGGGAYSPALGDFIIMVK 158 >gnl|CDD|34408 COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism]. Length = 526 Score = 82.2 bits (203), Expect = 2e-16 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 27/190 (14%) Query: 96 PAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKIPVI 155 + G AR G+PV II + +H G + KA R + + D F IP++ Sbjct: 312 KNIVTGFARIDGRPVGIIANQP--------RHLGGVLDIDSADKAARFIRLCDAFNIPLV 363 Query: 156 SFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAA----A 211 +DT G PG D E G + A+ + VP +++I + G + Sbjct: 364 FLVDTPGFMPGTDQEYGGIIKHGAKLLYAVAEATVPKITVITRKAYGGAYYVMGGKALGP 423 Query: 212 NFVYMLEHAIYSVISPEGAASILWR----DSSRAAQAAIAMK--IIATDLQDLS------ 259 +F Y A +V+ PEGA SIL+R + R + ++ +IA + S Sbjct: 424 DFNYAWPTAEIAVMGPEGAVSILYRKELAAAERPEEREALLRKQLIAEYEEQFSNPYYAA 483 Query: 260 ---IIDGIIP 266 ID +I Sbjct: 484 ERGYIDAVID 493 Score = 47.9 bits (114), Expect = 4e-06 Identities = 32/147 (21%), Positives = 55/147 (37%), Gaps = 17/147 (11%) Query: 75 YINSLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQ---EKGSDTKSRIKHNFGS 131 + +L H + + L GD + G+ +G+ V + KG G+ Sbjct: 60 ELGALAGHRMGGDANELPGD--GVVTGIGTINGRKVFVFANDFTVKG-----------GT 106 Query: 132 PRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVP 191 +K +R E+A +PVI D+ GA + I +P Sbjct: 107 LGEMTAKKILRAQELAIENGLPVIGLNDSGGARIQEGVPSLAGYGRIFYRNAR-ASGVIP 165 Query: 192 ILSIIIGEGGSGGAMGIAAANFVYMLE 218 +S+++G GGA A +FV M+ Sbjct: 166 QISVVMGPCAGGGAYSPALTDFVIMVR 192 >gnl|CDD|35760 KOG0540, KOG0540, KOG0540, 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism, Lipid transport and metabolism]. Length = 536 Score = 65.4 bits (159), Expect = 2e-11 Identities = 44/172 (25%), Positives = 71/172 (41%), Gaps = 20/172 (11%) Query: 78 SLFTHFISLAGDRLFGDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGY 137 S F F GD + G AR +G+ V I+G K G E Sbjct: 326 SRFFEFKPGYGD-------TLVTGFARLNGRTVGIVGNN--------PKFAGGVLFSESA 370 Query: 138 RKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQVPILSIII 197 K R +E+ D+ IP+I + G G AEA G + A+ +VP ++II Sbjct: 371 VKGARFIELCDQRNIPLIFLQNITGFMVGRAAEAGGIAKHGAKLVYAVACAKVPKITIIT 430 Query: 198 GEGGSGGAMGIAA----ANFVYMLEHAIYSVISPEGAASILWRDSSRAAQAA 245 G G GG + + + Y +A +V+ + AA+++++ + A A Sbjct: 431 G-GSYGGNYAMCSRGYSGDINYAWPNARIAVMGGKQAANVIFQITLEKAVAL 481 Score = 31.9 bits (72), Expect = 0.25 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 27/153 (17%) Query: 77 NSLFTHFISLAGDRLFGDDP----AMQIGLARFHGQPVAIIGQE---KGSDTKSRIKHNF 129 S F AG ++G + ++ G R +G+ +I + KG Sbjct: 77 GSPFIELDQFAGHEMYGKEKVPSGSIVTGRGRINGRKCFVIANDFTVKG----------- 125 Query: 130 GSPRPEGYRKAVRLMEMADRFKIPVISFIDTAGAYPGVDAEARGQGEAIARATEMCLKLQ 189 GS P +K +R E+AD ++P I +D+ GA AE+ R + Sbjct: 126 GSYYPITVKKHLRAQEIADNNRLPCIYLVDSGGARLPRQAESFADSYHFGR---IFYNQN 182 Query: 190 V------PILSIIIGEGGSGGAMGIAAANFVYM 216 V P +S+I+G +GGA A A+ M Sbjct: 183 VMSSGNIPQISVIMGSCTAGGAYVPAMADETIM 215 >gnl|CDD|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. The function of the NMDA subtype receptor serves critical functions in neuronal development, functioning, and degeneration in the mammalian central nervous system. The functional NMDA receptor is a heterotetramer comprising two NR1 and two NR2 (A, B, C, and D) or NR3 (A and B) subunits. The receptor controls a cation channel that is highly permeable to monovalent ions and calcium and exhibits voltage-dependent inhibition by magnesium. Dual agonists, glutamate and glycine, are required for efficient activation of the NMDA receptor. Among NMDA receptor subtypes, the NR2B subunit containing receptors appear particularly important for pain perception; thus NR2B-selective antagonists may be useful in the treatment of chronic pain. Length = 362 Score = 32.3 bits (74), Expect = 0.18 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 247 AMKIIATDLQDLSIIDGIIPEPIGGAHRNPAQTISSVGEIISQFLSETSTYSET 300 A+ I+A + L G +PEP + + SS G+ +++FL + ET Sbjct: 264 AVAIVARAAESLLRDKGALPEPPVNCYDTANKRESS-GQYLARFLMNVTFDGET 316 >gnl|CDD|39429 KOG4228, KOG4228, KOG4228, Protein tyrosine phosphatase [Signal transduction mechanisms]. Length = 1087 Score = 29.6 bits (66), Expect = 1.2 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 12/88 (13%) Query: 6 DFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEA-------MVCKTLSEIYSK---- 54 D E P S L +LK++ + EE + L + M+C L E SK Sbjct: 801 DTEVPASTLAPYSQKLKRIDPPENKTGLEEEFKTLNSCKPRTRMMICGNLPENKSKNRQV 860 Query: 55 -LTPWQKTQVSRHPNRPHYIDYINSLFT 81 + P+ + +V P DYIN+ F Sbjct: 861 NILPYDRNRVILIPTHGESSDYINASFI 888 >gnl|CDD|48241 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH). TyrOH catalyzes the conversion of tyrosine to L-dihydroxyphenylalanine (L-DOPA), the rate-limiting step in the biosynthesis of the catecholamines dopamine, noradrenaline, and adrenaline.. Length = 298 Score = 29.1 bits (65), Expect = 1.5 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Query: 58 WQKTQVSRHPNRPHYI---DYINSLFTHFISLAGDRLFGDDPAMQIGLA 103 +Q TQ RH + P + D + L H LA D F + IGLA Sbjct: 144 FQCTQYIRHASSPMHSPEPDCCHELLGHVPMLA-DPTFA-QFSQDIGLA 190 >gnl|CDD|31120 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid metabolism]. Length = 294 Score = 28.7 bits (64), Expect = 2.0 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 8/71 (11%) Query: 93 GDDPAMQIGLARFHGQPVAIIGQEKGSDTKSRIKHNFGSPRPEGYRKAVRLMEMADRFKI 152 G D A+ G +G PV + + + + + GS E K R +E A K+ Sbjct: 107 GLDDAVVTGEGTINGLPVVLAVMD-----FAFMGGSMGSVVGE---KITRAIERAIEDKL 158 Query: 153 PVISFIDTAGA 163 P++ F + GA Sbjct: 159 PLVLFSASGGA 169 >gnl|CDD|143508 cd06841, PLPDE_III_MccE_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus. Length = 379 Score = 28.4 bits (64), Expect = 2.4 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 134 PEGYRKAVR-LMEMADRFKIPVISFIDTAGAYPG 166 PE Y A + L+E+ DR + ++D G +P Sbjct: 182 PEAYSAAAKKLIELLDRLFGLELEYLDLGGGFPA 215 >gnl|CDD|37294 KOG2083, KOG2083, KOG2083, Na+/K+ symporter [Inorganic ion transport and metabolism]. Length = 643 Score = 27.6 bits (61), Expect = 4.3 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 6/86 (6%) Query: 164 YPGVDAEARGQGEAIARATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAI-- 221 YP + A+G G+ L + I IGE + +NF ++L +A+ Sbjct: 351 YPSILFFAKGYGKNKEPLRGYLLTFLTAVSFIAIGE---LNIIAPIISNF-FLLSYALIN 406 Query: 222 YSVISPEGAASILWRDSSRAAQAAIA 247 +S A S WR S + A ++ Sbjct: 407 FSCFHASLAISEGWRPSFKFYNAWVS 432 >gnl|CDD|144523 pfam00956, NAP, Nucleosome assembly protein (NAP). NAP proteins are involved in moving histones into the nucleus, nucleosome assembly and chromatin fluidity. They affect the transcription of many genes. Length = 237 Score = 27.7 bits (62), Expect = 4.8 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 17 KIHELKKLSRE--DINEDFSEEIRELEAMVCKTLSEIYSK 54 ++ LK L +E ++ F EE+ ELE K +Y K Sbjct: 3 RVEALKALQKELDELEAKFQEEVLELERKYDKLYQPLYDK 42 >gnl|CDD|35863 KOG0644, KOG0644, KOG0644, Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]. Length = 1113 Score = 27.4 bits (60), Expect = 5.6 Identities = 15/77 (19%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Query: 6 DFEEPISDLEAKIHELKKLSREDINEDFSEEIRELEAMVCKTLSEIYSKLTPWQKTQVSR 65 F D EA+ HE ++L+ F +L ++V ++ W Sbjct: 330 RFLTGSRDGEARNHEFEQLAWRSNLLIFVTRSSDLSSIVVTARNDHRLC--VWNLYTGQL 387 Query: 66 HPNRPHYIDYINSLFTH 82 N + D + L H Sbjct: 388 LHNLMGHSDEVYVLDVH 404 >gnl|CDD|36182 KOG0964, KOG0964, KOG0964, Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]. Length = 1200 Score = 27.3 bits (60), Expect = 5.9 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Query: 4 YLDFEEPISDLEAKIHELKKLSREDINEDFSE-EIRELEAM------VCKTLSEIYSKLT 56 +++F E L+ + EL + S++ I E + + R+ EA+ V K SE++S+L Sbjct: 979 FVNFSEQRESLKKRQEELDR-SKDSILELITVLDQRKYEAIDLTFKQVKKNFSEVFSRLV 1037 Query: 57 P 57 P Sbjct: 1038 P 1038 >gnl|CDD|39024 KOG3820, KOG3820, KOG3820, Aromatic amino acid hydroxylase [Amino acid transport and metabolism]. Length = 461 Score = 27.2 bits (60), Expect = 6.0 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Query: 58 WQKTQVSRHPNRPHYI---DYINSLFTHFISLAGDRLFGDDPAMQIGLA 103 + TQ RH + P Y D + L H + L D F + +IGLA Sbjct: 269 FHCTQYIRHHSSPFYTPEPDTCHELLGH-VPLFADPSFA-QFSQEIGLA 315 >gnl|CDD|132932 cd07021, Clp_protease_NfeD_like, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease. Nodulation formation efficiency D (NfeD; stomatin operon partner protein, STOPP; DUF107) is a member of membrane-anchored ClpP-class proteases. Currently, more than 300 NfeD homologs have been identified - all of which are bacterial or archaeal in origin. Majority of these genomes have been shown to possess operons containing a homologous NfeD/stomatin gene pair, causing NfeD to be previously named STOPP (stomatin operon partner protein). NfeD homologs can be divided into two groups: long and short forms. Long-form homologs have a putative ClpP-class serine protease domain while the short form homologs do not. Downstream from the ClpP-class domain is the so-called NfeD or DUF107 domain. N-terminal region of the NfeD homolog PH1510 (1510-N or PH1510-N) from Pyrococcus horikoshii has been shown to possess serine protease activity and has a Ser-Lys catalytic dyad, preferentially cleaving hydrophobic substrates. Difference in oligomeric form and catalytic residues between 1510-N (forming a dimer) and ClpP (forming a tetradecamer) shows a possible functional difference: 1510-N is likely to have a regulatory function while ClpP is involved in protein quality control. Length = 178 Score = 27.2 bits (61), Expect = 6.4 Identities = 7/29 (24%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Query: 140 AVRLMEMADRFKIPVISFIDT----AGAY 164 A+ ++++ IP I++++ AGA Sbjct: 47 ALEIVDLILNSPIPTIAYVNDRAASAGAL 75 >gnl|CDD|37259 KOG2048, KOG2048, KOG2048, WD40 repeat protein [General function prediction only]. Length = 691 Score = 27.2 bits (60), Expect = 6.4 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Query: 232 SILWRDSSRAAQAAIAMKIIATDLQDLSIIDGIIPEPIGGA----HRNPAQTISSVG 284 S+ W + R + ++ I DL L + GGA NP TI ++G Sbjct: 74 SLAWAEGGRLFSSGLSGSITEWDLHTLKQK--YNIDSNGGAIWSIAINPENTILAIG 128 >gnl|CDD|48024 cd03460, 1,2-CTD, Catechol 1,2 dioxygenase (1,2-CTD) catalyzes an intradiol cleavage reaction of catechol to form cis,cis-muconate. 1,2-CTDs is homodimers with one catalytic non-heme ferric ion per monomer. They belong to the aromatic dioxygenase family, a family of mononuclear non-heme iron intradiol-cleaving enzymes that catalyze the oxygenation of catecholates to aliphatic acids via the cleavage of aromatic rings.. Length = 282 Score = 27.2 bits (60), Expect = 7.2 Identities = 18/79 (22%), Positives = 25/79 (31%), Gaps = 11/79 (13%) Query: 61 TQVSRHPNRPHYIDYINSLFTHF-----ISLAGDRLFGDDPAMQ-----IGLARFHGQPV 110 + RH NRP +I + S H I++ GD DD A I Sbjct: 202 NALGRHGNRPAHIHFFVSAPGHRKLTTQINIEGDPYIWDDFAFATREGLIPEVVEVEDAA 261 Query: 111 AIIGQEKGSDTKSRIKHNF 129 A+ I +F Sbjct: 262 ALKQYGLDGPFA-EIAFDF 279 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 26.7 bits (60), Expect = 7.9 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Query: 142 RLMEMADRFKIPVISFI---DTAGA-YPGVDAEARGQGEAIARATEMCLKLQVPI 192 +L E AD IP I FI D A + A + EA R + LQ+PI Sbjct: 107 KLWEFADEAGIPRIIFINKMDRERADFDKTLAALQ---EAFGRP---VVPLQLPI 155 >gnl|CDD|144031 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4. Length = 251 Score = 26.9 bits (60), Expect = 8.3 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 18/92 (19%) Query: 181 ATEMCLKLQVPILSIIIGEGGSGGAMGIAAANFVYMLEHAIYSVISPEGAASILWRDSSR 240 E+ +L ++++ GG G A GIA VI E A S Sbjct: 154 GLEILEQLGGVPDAVVVPVGGGGLAAGIARG---LKELGPGIRVIGVEPAVS-------- 202 Query: 241 AAQAAIAMKIIATDLQDLSIIDGIIPEPIGGA 272 +A AM+++A +GI+ EP A Sbjct: 203 DEEALEAMRLLARR-------EGILVEPSSAA 227 >gnl|CDD|35676 KOG0455, KOG0455, KOG0455, Homoserine dehydrogenase [Amino acid transport and metabolism]. Length = 364 Score = 26.9 bits (59), Expect = 8.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 90 RLFGDDPAMQIGLARFHGQPVAIIGQEKGSDT 121 RL G D + I R+ QP+ I G G+ Sbjct: 316 RLRGSDNIISIYTKRYKTQPLVIQGAGAGAAV 347 >gnl|CDD|144444 pfam00850, Hist_deacetyl, Histone deacetylase domain. Histones can be reversibly acetylated on several lysine residues. Regulation of transcription is caused in part by this mechanism. Histone deacetylases catalyse the removal of the acetyl group. Histone deacetylases are related to other proteins. Length = 302 Score = 26.8 bits (60), Expect = 8.6 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 134 PEGYRKAVR-LMEMADRFKIPVISFI 158 EGY + R L+E+AD + PV+S + Sbjct: 256 TEGYAERTRLLLELADEYGGPVVSVL 281 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,889,340 Number of extensions: 210829 Number of successful extensions: 760 Number of sequences better than 10.0: 1 Number of HSP's gapped: 748 Number of HSP's successfully gapped: 45 Length of query: 317 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 223 Effective length of database: 4,232,491 Effective search space: 943845493 Effective search space used: 943845493 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (25.7 bits)