HHSEARCH alignment of GI: 254780589 and SCOP domain: d1y7ma1

Alignment
>d1y7ma1 b.160.1.1 (A:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
Probab=99.36  E-value=1.1e-12  Score=95.83  Aligned_cols=95  Identities=28%  Similarity=0.331  Sum_probs=75.7

Q ss_pred             CCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCCCHHCCCCCCCCCEEEEEEECCCCCCCCCCEEEECCCCC
Q ss_conf             78479999837869999860788966899986521323898870101787475079998401258757652142079989
Q gi|254780589|r   49 FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN  128 (239)
Q Consensus        49 ~~pi~Irv~K~e~~Lel~~~~~~g~~~l~ktY~Ic~~sg~lGpK~~eGD~kTPEG~Y~i~~~~~np~S~y~ls~~i~YPN  128 (239)
                      ..|..|.|.+.+++|.||+.+     +++++|||+.|..         +..||+|.|+|..+..++.+.|+-        
T Consensus         5 ~~p~~I~Vd~~~~~l~~~~~g-----~~v~~~pvs~G~~---------~~~TP~G~~~i~~k~~~~~~~~~~--------   62 (116)
T d1y7ma1           5 TIPYHIAVSIGAKTLTLSLNN-----RVMKTYPIAVGKI---------LTQTPTGEFYIINRQRNPGGPFGA--------   62 (116)
T ss_dssp             GCCEEEEEETTTTEEEEEETT-----EEEEEEECBEEBT---------TBCCCCEEEEEEEEEECCCGGGTT--------
T ss_pred             CCCEEEEEECCCCEEEEEECC-----EEEEEEEECCCCC---------CCCCCCEEEEECCCCCCCCCCCCC--------
T ss_conf             887799999888999999999-----9999944043789---------987766666601222111377652--------


Q ss_pred             HHHHHCCCCCCCEEECCCC--------CCCCCEEECHHHHHHHHHHHH
Q ss_conf             8899729998826871677--------866718706466999999999
Q gi|254780589|r  129 EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVR  168 (239)
Q Consensus       129 ~~Dr~~grtG~~I~IHG~~--------~S~GC~amtd~~i~EIy~~v~  168 (239)
                         .+....++++.|||..        +|+|||.|.++++++||..++
T Consensus        63 ---~~~~~~~~~~~~hg~~~~~~~g~~~ShGCIrl~~~da~~ly~~~~  107 (116)
T d1y7ma1          63 ---YWLSLSAAHYGIHGTNNPASIGKAVSKGCIRMHNKDVIELASIVP  107 (116)
T ss_dssp             ---EEEEESSTTCEEECCSCGGGTTSEEESSCEECCHHHHHHHHHHCC
T ss_pred             ---EEEEECCCCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHCCC
T ss_conf             ---789821677422122145557988799700529999999996699


SCOP domain information

class: All beta proteins
fold: L,D-transpeptidase catalytic domain-like
superfamily: L,D-transpeptidase catalytic domain-like
family: L,D-transpeptidase catalytic domain-like
domain: Hypothetical protein YkuD, C-terminal domain
species: Bacillus subtilis [TaxId: 1423]