BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780589|ref|YP_003065002.1| hypothetical protein
CLIBASIA_02380 [Candidatus Liberibacter asiaticus str. psy62]
         (239 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|115522169|ref|YP_779080.1| hypothetical protein RPE_0139 [Rhodopseudomonas palustris BisA53]
 gi|115516116|gb|ABJ04100.1| protein of unknown function DUF949 [Rhodopseudomonas palustris
           BisA53]
          Length = 481

 Score =  344 bits (882), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 109/234 (46%), Positives = 147/234 (62%), Gaps = 4/234 (1%)

Query: 8   LLFALFIFLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
           ++ A  + L GC+    S +   KA  P+S  LI  MQ K      P ++R+FK E  LE
Sbjct: 14  VVLAAGVALAGCNSDEISLANNAKANQPVSPKLIAEMQSKDMDLQAPMLVRLFKQEAELE 73

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +WK+    +Y LLK Y IC WSG  GPK+  GD QAPEGFY I    +NP S Y+LS N 
Sbjct: 74  VWKQTRSGQYALLKTYPICRWSGDLGPKVREGDRQAPEGFYSISPGQMNPQSAYYLSFNT 133

Query: 125 GFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           G+PN FDKA  RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G  Q   Q+QA+
Sbjct: 134 GYPNAFDKALGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYSLGRESFFG-GQRAFQLQAY 192

Query: 185 PFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           PF+MT  NM  +++NPN  FW M+K G+D+FE   QEP ++    +YVF    T
Sbjct: 193 PFKMTPANMARHRSNPNMPFWKMIKEGYDHFEVTRQEPKVEFCEARYVFDPAPT 246


>gi|27375303|ref|NP_766832.1| hypothetical protein blr0192 [Bradyrhizobium japonicum USDA 110]
 gi|27348439|dbj|BAC45457.1| blr0192 [Bradyrhizobium japonicum USDA 110]
          Length = 526

 Score =  343 bits (881), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 109/241 (45%), Positives = 149/241 (61%), Gaps = 7/241 (2%)

Query: 4   RYNILLFALF---IFLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           R  +   AL    + L GC     S +   KA  P+   L+ +M +K      P ++R+F
Sbjct: 12  RALLASVALLTASVLLAGCDTDQVSLATNAKANQPVPPKLLAAMVEKDMDLQSPILVRLF 71

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E  LE+WK+  + ++ LLK Y IC WSG  GPK+  GD QAPEGFY I    +NP S 
Sbjct: 72  KQEAELEVWKQTRNGQFALLKTYPICRWSGDLGPKVREGDRQAPEGFYSINPGQMNPQSA 131

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+LS N G+PN FDKA  RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G  Q 
Sbjct: 132 YYLSFNTGYPNAFDKALGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYSLGRESFFG-GQK 190

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             Q+QA+PF+MT  NM  ++NNPN  FW M+K G+D+FE   QEP +    K+YVF   +
Sbjct: 191 AFQLQAYPFKMTPVNMAKHRNNPNMPFWKMIKEGYDHFEVTRQEPKVDFCEKKYVFDAAK 250

Query: 238 T 238
           T
Sbjct: 251 T 251


>gi|192288940|ref|YP_001989545.1| hypothetical protein Rpal_0510 [Rhodopseudomonas palustris TIE-1]
 gi|192282689|gb|ACE99069.1| protein of unknown function DUF949 [Rhodopseudomonas palustris
           TIE-1]
          Length = 478

 Score =  342 bits (878), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 146/240 (60%), Gaps = 6/240 (2%)

Query: 4   RYNILLFALFI--FLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           R  +L  AL     L GC+    + +   KA  P+   L+ +MQ+K      P ++R+FK
Sbjct: 8   RALMLTAALATMPLLAGCNSDQMALATNAKANQPVPPKLVAAMQEKNMDLQSPILVRLFK 67

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E  LE+WK++    + LLK Y IC WSG  GPKI  GD QAPEGFY I    +NP S Y
Sbjct: 68  QEAELEVWKQDRTGVFQLLKSYPICRWSGDLGPKIREGDRQAPEGFYSISPGQMNPQSSY 127

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +LS N G+PN FDK+  RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q  
Sbjct: 128 YLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYALGRESFFG-GQRA 186

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QA+PF+MT  N   ++NNPN  FW MLK G+D+FE   QEP +     +YVF     
Sbjct: 187 FQLQAYPFKMTPANFAKHRNNPNMPFWKMLKEGYDHFEVTRQEPKVDFCEHKYVFDAAPP 246


>gi|209883239|ref|YP_002287096.1| pollen allergen Poa pIX/Phl pVI [Oligotropha carboxidovorans OM5]
 gi|209871435|gb|ACI91231.1| pollen allergen Poa pIX/Phl pVI [Oligotropha carboxidovorans OM5]
          Length = 483

 Score =  342 bits (878), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 108/237 (45%), Positives = 150/237 (63%), Gaps = 4/237 (1%)

Query: 4   RYNILLFALF--IFLNGCHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           R  ++  AL   + L GC+    S   KA  P+ E L+  M+ K      P ++R+FK E
Sbjct: 8   RALMVSAALATSVLLAGCNGDTLSRSAKANKPIPEKLLSDMEAKNMDKGSPMLVRLFKQE 67

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE+WK++    + LLK Y IC WSG  GPKI  GD QAPEGFY I    +NP S Y+L
Sbjct: 68  AELEVWKQDRSGRFALLKTYPICRWSGDLGPKIREGDRQAPEGFYSITPAQMNPASAYYL 127

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           S N+G+PN +D+A  RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G  Q+  Q
Sbjct: 128 SFNMGYPNAYDRAWGRTGSQLMVHGDCSSRGCYAMTDEQISEIYSLGRESFFG-GQTAFQ 186

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +QA+PFRMT +NM  +++NPN +FW MLK G+D FE    EP + +  K+YVF    
Sbjct: 187 VQAYPFRMTPQNMARHRDNPNMAFWRMLKEGNDIFEVTRTEPKVDVCEKKYVFDAEP 243


>gi|39933586|ref|NP_945862.1| hypothetical protein RPA0509 [Rhodopseudomonas palustris CGA009]
 gi|39647432|emb|CAE25953.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 491

 Score =  342 bits (877), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 147/240 (61%), Gaps = 6/240 (2%)

Query: 4   RYNILLFALFI--FLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           R  +L  AL     L GC+    + +   KA  P+S  L+ +MQ+K      P ++R+FK
Sbjct: 21  RALMLTAALATMPLLAGCNSDQMALATNAKANQPVSPKLVAAMQEKNMDLQSPILVRLFK 80

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E  LE+WK++    + LLK Y IC WSG  GPKI  GD QAPEGFY I    +NP S Y
Sbjct: 81  QEAELEVWKQDRTGVFQLLKSYPICRWSGDLGPKIREGDRQAPEGFYSISPGQMNPQSSY 140

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +LS N G+PN FDK+  RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q  
Sbjct: 141 YLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYALGRESFFG-GQRA 199

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QA+PF+MT  N   ++NNPN  FW MLK G+D+FE   QEP +     +YVF     
Sbjct: 200 FQLQAYPFKMTPVNFAKHRNNPNMPFWKMLKEGYDHFEVTRQEPKVDFCEHKYVFDAAPP 259


>gi|316931931|ref|YP_004106913.1| putative transcriptional regulatory protein [Rhodopseudomonas
           palustris DX-1]
 gi|315599645|gb|ADU42180.1| putative exported protein; putative transcriptional regulatory
           protein at C-terminal [Rhodopseudomonas palustris DX-1]
          Length = 477

 Score =  341 bits (875), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 108/240 (45%), Positives = 147/240 (61%), Gaps = 6/240 (2%)

Query: 4   RYNILLFALFI--FLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           R  ++  AL     L GC+    + +   KA  P+   L+ +MQ+K      P ++R+FK
Sbjct: 8   RALLVTAALATMPLLAGCNSDQMALATNAKASQPVPPKLVAAMQEKNMDLQSPILVRLFK 67

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E  LE+WK++    + LLK Y IC WSG  GPKI  GD QAPEGFY I    +NP S Y
Sbjct: 68  QEAELEVWKQDRTGVFQLLKSYPICRWSGDLGPKIREGDRQAPEGFYSISPGQMNPQSSY 127

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +LS N G+PN FDK+  RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q  
Sbjct: 128 YLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYALGRESFFG-GQRA 186

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QA+PF+MT  N   ++NNPN  FW MLK G+D+FE   QEP +    ++YVF     
Sbjct: 187 FQLQAYPFKMTPANFAKHRNNPNMPFWKMLKQGYDHFEVTRQEPKVDFCEQKYVFDAAPP 246


>gi|90422051|ref|YP_530421.1| hypothetical protein RPC_0527 [Rhodopseudomonas palustris BisB18]
 gi|90104065|gb|ABD86102.1| protein of unknown function DUF949 [Rhodopseudomonas palustris
           BisB18]
          Length = 477

 Score =  341 bits (874), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 108/240 (45%), Positives = 146/240 (60%), Gaps = 6/240 (2%)

Query: 4   RYNILLFALF--IFLNGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           R  +   AL   + L GC+    S +   KA  P+   L+  MQ K      P ++R+FK
Sbjct: 8   RALVTSVALATGVMLAGCNSDEISLANNAKANQPVPPKLVAEMQTKDMDLQAPMLVRLFK 67

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E  LE+WK+    ++ LLK Y IC WSG  GPK+  GD QAPEGFY I    +NP S Y
Sbjct: 68  QEAELEVWKQTRSGQFALLKTYPICRWSGDLGPKVREGDRQAPEGFYNITPAQMNPQSAY 127

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +LS N G+PN FDKA  RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G  Q  
Sbjct: 128 YLSFNTGYPNAFDKALGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYSLGRESFFG-GQRA 186

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QA+PF+MT  NM  ++NNPN  FW M+K G+D+FE   QEP ++    +YVF     
Sbjct: 187 FQLQAYPFKMTPVNMAKHRNNPNMPFWKMIKEGYDHFEVTRQEPKVEFCEAKYVFDPATP 246


>gi|148258745|ref|YP_001243330.1| transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146410918|gb|ABQ39424.1| putative exported protein of unknown function with transcriptiona
           regulatory protein domain (C-term) [Bradyrhizobium sp.
           BTAi1]
          Length = 494

 Score =  340 bits (873), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 107/247 (43%), Positives = 149/247 (60%), Gaps = 10/247 (4%)

Query: 1   MTNRYNILLFALFIFL------NGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHP 51
           M NR  + +      L       GC+    + +   KA  P+   L+ ++ +K      P
Sbjct: 1   MINRAFVRVLMTSAALAAGALLTGCNSDQVALATSAKANQPVPPKLVATIAEKDMDTQSP 60

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
            ++R+FK E  LE+WK++   ++ LLK Y IC WSG  GPK+  GD QAPEGFY I  + 
Sbjct: 61  ILVRVFKQEAELEVWKQDRSGKFALLKTYPICRWSGDLGPKVREGDRQAPEGFYSINPSQ 120

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSL 171
           +NP S Y+LS N G+PN FDKA  RTG+ LM+HG+C+S GC+AM ++Q+ EIYA+ R+S 
Sbjct: 121 MNPQSAYYLSFNTGYPNAFDKALGRTGSQLMVHGDCSSRGCFAMTDEQIAEIYALGRESF 180

Query: 172 RGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQY 231
            G  Q   Q QA+PFRMT  NM  ++NNPN  FW M+K G+D+FE   QEP +    K+Y
Sbjct: 181 FG-GQRAFQFQAYPFRMTPMNMARHRNNPNMPFWRMIKEGYDHFEVTRQEPKVDFCEKKY 239

Query: 232 VFFKGQT 238
           VF   + 
Sbjct: 240 VFNAQKP 246


>gi|110635389|ref|YP_675597.1| hypothetical protein Meso_3060 [Mesorhizobium sp. BNC1]
 gi|110286373|gb|ABG64432.1| protein of unknown function DUF949 [Chelativorans sp. BNC1]
          Length = 439

 Score =  339 bits (871), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 111/237 (46%), Positives = 147/237 (62%), Gaps = 3/237 (1%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           M +R+   +      L GC  S        AE  L   +   ++ K  S   P ++R+FK
Sbjct: 10  MKSRFACAVLLPAFILVGCSGSLEDLAPKAAERKLPPEVTEIIKAKGMSTNAPIMMRVFK 69

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E +LE+WK+  D  Y L+K Y+IC WSG  GPK   GD QAPEGFY I    +NPNS Y
Sbjct: 70  EEGVLEVWKQKKDGRYDLVKSYEICKWSGKLGPKYTEGDRQAPEGFYTIRPQQMNPNSSY 129

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
            LS NIGFPN +D+A+ RTG  LM+HG C+SAGCY+M ++Q++EIYA  RD+ RG  Q  
Sbjct: 130 HLSFNIGFPNAYDRANGRTGQHLMVHGACSSAGCYSMTDEQVEEIYAFARDAFRG-GQEA 188

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            Q QAFPFRMT++NM  Y+N+PNY FW MLK G+D+FE     P + +   +YVF +
Sbjct: 189 FQFQAFPFRMTAQNMARYRNDPNYPFWQMLKEGYDHFEMTKAPPKVDVCEARYVFNR 245


>gi|85713798|ref|ZP_01044788.1| hypothetical protein NB311A_04639 [Nitrobacter sp. Nb-311A]
 gi|85699702|gb|EAQ37569.1| hypothetical protein NB311A_04639 [Nitrobacter sp. Nb-311A]
          Length = 491

 Score =  338 bits (867), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 147/240 (61%), Gaps = 6/240 (2%)

Query: 4   RYNILLFALF--IFLNGCHHSRSLID---KAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           R  + L AL     L GC+   + +    KA  P+   L+ +M  K      P +IR+FK
Sbjct: 8   RAIMTLAALTGGTLLAGCNTDDASLASNAKANRPVPPKLVAAMTAKDMELQSPILIRLFK 67

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E  LE+WK++   ++ LLK Y IC WSG  GPK   GD QAPEGFY I    +NP S Y
Sbjct: 68  QEAELEVWKQDRSGKFALLKIYPICRWSGDLGPKTREGDRQAPEGFYSITPAQMNPRSSY 127

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +LS N G+PNEFDK+  RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q  
Sbjct: 128 YLSFNTGYPNEFDKSLGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYAVGRESFFG-GQRA 186

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QA+PFRMT+ N+  ++NNPN  FW M+K G+D+FE   QEP +     +YVF     
Sbjct: 187 FQLQAYPFRMTAANLAKHRNNPNMPFWKMIKEGNDHFEVTRQEPKVAFCEHKYVFDPAPP 246


>gi|299132837|ref|ZP_07026032.1| pollen allergen Poa PIX/Phl PVI [Afipia sp. 1NLS2]
 gi|298592974|gb|EFI53174.1| pollen allergen Poa PIX/Phl PVI [Afipia sp. 1NLS2]
          Length = 475

 Score =  338 bits (866), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 109/244 (44%), Positives = 149/244 (61%), Gaps = 8/244 (3%)

Query: 1   MTNRYNI------LLFALFIFLNGCHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M NR  I         A    L GC+    +   KA  P+ E L+  M+ K      P +
Sbjct: 1   MINRSLIRALMVSAALATGTLLAGCNGENLAQSAKATKPIPEKLLAEMEAKNMDKGSPIL 60

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +R+FK E+ LE+WK++    + LLK Y IC WSG  GPKI  GD Q PEGFY I    +N
Sbjct: 61  VRLFKQESELEVWKQDRSGRFALLKTYAICRWSGDLGPKIREGDRQTPEGFYSITPGQMN 120

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           P S Y+LS N+G+PN +D+A  RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G
Sbjct: 121 PASAYYLSFNMGYPNAYDRAWGRTGSQLMVHGDCSSRGCYAMTDEQISEIYSLGRESFFG 180

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q+  Q+QA+PFRMT +NM  Y++NPN  FW MLK G+D FE    EP + + +K+YVF
Sbjct: 181 -GQTAFQVQAYPFRMTPQNMAKYRDNPNMPFWRMLKEGNDIFEVTKTEPKVDVCDKKYVF 239

Query: 234 FKGQ 237
               
Sbjct: 240 DAEP 243


>gi|153008240|ref|YP_001369455.1| hypothetical protein Oant_0905 [Ochrobactrum anthropi ATCC 49188]
 gi|151560128|gb|ABS13626.1| protein of unknown function DUF949 [Ochrobactrum anthropi ATCC
           49188]
          Length = 412

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 149/241 (61%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  R  IL   +    L GC  S    L  +AE PL E ++  M+ K  +   P ++RIF
Sbjct: 1   MKIRTAILGSVMATALLAGCQGSSVSDLSLRAEKPLPEKVVAKMKAKGMTRTSPIMVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E  LE+WK+  + +Y  +  Y IC WSG  GPK   GD QAPEGFY +    +NPNS 
Sbjct: 61  KEEGTLEVWKQKNNGKYDQIASYDICKWSGKLGPKYIEGDRQAPEGFYNVRPAQMNPNSS 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+LS NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLSFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+++PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 DFQIQAFPFRMTAANMARYKSDPNYSFWKMLKQGYDSFEVTKVPPKVDVCEKRYVFNVAT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|146337733|ref|YP_001202781.1| putative exported protein transcriptiona regulatory protein at
           C-terminal [Bradyrhizobium sp. ORS278]
 gi|146190539|emb|CAL74541.1| conserved hypothetical protein; putative exported protein; putative
           transcriptiona regulatory protein at C-terminal
           [Bradyrhizobium sp. ORS278]
          Length = 501

 Score =  336 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 103/225 (45%), Positives = 142/225 (63%), Gaps = 4/225 (1%)

Query: 17  NGCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
            GC+    + +   KA  P+   L+ ++ +K      P ++R+FK E  LE+WK++   +
Sbjct: 35  TGCNSDQVALATSAKANQPVPPKLVAAIAEKDMDTQSPILVRVFKQEAELEVWKQDRSGK 94

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA 133
           + LLK Y IC WSG  GPK+  GD QAPEGFY I  + +NP S Y+LS N G+PN FDKA
Sbjct: 95  FALLKTYPICRWSGDLGPKVREGDRQAPEGFYSINPSQMNPQSAYYLSFNTGYPNAFDKA 154

Query: 134 HNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNM 193
             RTG+ LM+HG+C+S GC+AM ++Q+ EIYA+ R+S  G  Q   Q QA+PFRMT  NM
Sbjct: 155 LGRTGSQLMVHGDCSSRGCFAMTDEQIAEIYALGRESFFG-GQRAFQFQAYPFRMTPVNM 213

Query: 194 QLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
             ++NNPN  FW M+K G+D FE   QEP +    K+YVF   + 
Sbjct: 214 ARHRNNPNMPFWRMIKEGYDAFEVTRQEPKVDFCEKKYVFNAQKP 258


>gi|75674589|ref|YP_317010.1| hypothetical protein Nwi_0391 [Nitrobacter winogradskyi Nb-255]
 gi|74419459|gb|ABA03658.1| Protein of unknown function [Nitrobacter winogradskyi Nb-255]
          Length = 492

 Score =  335 bits (860), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 106/227 (46%), Positives = 144/227 (63%), Gaps = 4/227 (1%)

Query: 15  FLNGCHHSRSLID---KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVD 71
            L GC+   + +    KA  P+S  L+ +M  K      P +IR+FK E  LE+WK++  
Sbjct: 21  LLAGCNTDDASLASNAKANRPVSPKLVAAMTAKDMELQSPILIRLFKQEAELEVWKQDRS 80

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFD 131
            ++ LLK Y IC WSG  GPK   GD QAPEGFY I    +NP S Y+LS N G+PNEFD
Sbjct: 81  GKFALLKSYPICRWSGDLGPKTREGDRQAPEGFYSITPAQMNPRSSYYLSFNTGYPNEFD 140

Query: 132 KAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSK 191
           K+  RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q   Q+QA+PFRMT+ 
Sbjct: 141 KSLGRTGSQLMVHGDCSSRGCYAMTDEQIAEIYAVGRESFFG-GQRAFQLQAYPFRMTAA 199

Query: 192 NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           N+  ++NNPN  FW M+K G+D+FE   QEP +    ++YVF     
Sbjct: 200 NLAKHRNNPNMPFWKMIKEGNDHFEVTRQEPKVAFCERKYVFDPAPP 246


>gi|118592084|ref|ZP_01549478.1| hypothetical protein SIAM614_25447 [Stappia aggregata IAM 12614]
 gi|118435380|gb|EAV42027.1| hypothetical protein SIAM614_25447 [Stappia aggregata IAM 12614]
          Length = 424

 Score =  335 bits (859), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 107/241 (44%), Positives = 150/241 (62%), Gaps = 5/241 (2%)

Query: 3   NRYNILLFALFI--FLNGCHHS--RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
            R   +  AL +   L  C      +  +KA+ P+S ++   M     S   P +IRIFK
Sbjct: 23  RRTARIGAALLLAGVLVACQGDEFSAGPNKAQLPVSASIKRKMNDLNMSSSSPIMIRIFK 82

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E+ LE+WK+    +Y LL E++IC WSG  GPK + GD QAPEGFY I    +NPNS Y
Sbjct: 83  EESALEVWKQTRTGKYQLLDEFEICKWSGELGPKFKEGDRQAPEGFYEITPALMNPNSSY 142

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
            L+ N+G+PN +D+AH RTG+ LM+HG C+S GCYAM ++Q+Q+IYA+ RDS +G  Q  
Sbjct: 143 HLAFNLGYPNSYDRAHGRTGSHLMVHGACSSRGCYAMTDEQVQDIYALARDSFKG-GQRS 201

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            Q+QAFPFRMT +NM  ++++ +  FW MLK G+D+FE     P I +  K+YVF     
Sbjct: 202 FQVQAFPFRMTPENMARHRDSEHMEFWQMLKTGYDHFEVTQTPPQISVCEKKYVFDATTL 261

Query: 239 I 239
           +
Sbjct: 262 V 262


>gi|91974778|ref|YP_567437.1| hypothetical protein RPD_0298 [Rhodopseudomonas palustris BisB5]
 gi|91681234|gb|ABE37536.1| protein of unknown function DUF949 [Rhodopseudomonas palustris
           BisB5]
          Length = 487

 Score =  334 bits (858), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 103/224 (45%), Positives = 138/224 (61%), Gaps = 4/224 (1%)

Query: 18  GCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEY 74
           GC+    S +   KA  P+   L+  MQ K      P ++R+FK E  LE+WK++    +
Sbjct: 24  GCNSDQMSLATNAKANQPVPPKLVAEMQAKNMDLQSPILVRLFKQEAELEVWKQDRTGVF 83

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH 134
            LLK Y IC WSG  GPK+  GD QAPEGFY I    +NP S Y+LS N G+PN FDK+ 
Sbjct: 84  ALLKSYPICRWSGDLGPKVREGDRQAPEGFYAISPGQMNPQSSYYLSFNTGYPNAFDKSL 143

Query: 135 NRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQ 194
            RTG+ LM+HG+C+S GCYAM ++Q+ EIY++ R+S  G  Q   Q+QA+PF+MT  N  
Sbjct: 144 GRTGSQLMVHGDCSSRGCYAMTDEQIAEIYSLGRESFFG-GQRAFQLQAYPFKMTPVNFA 202

Query: 195 LYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            ++NNPN  FW MLK G+D+FE   QEP +     +YVF     
Sbjct: 203 KHRNNPNMPFWKMLKEGYDHFEVTRQEPKVDFCEHKYVFDAAPP 246


>gi|239833077|ref|ZP_04681406.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825344|gb|EEQ96912.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 417

 Score =  334 bits (858), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  R  IL   L    L GC  S    L  +AE PL E ++  M+ K  +   P ++RIF
Sbjct: 1   MKIRTAILGSLLATTLLAGCQGSSVSDLSLRAEKPLPEKVVAKMKAKGMTRTSPIMVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NPNS 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPNSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+++PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 DFQIQAFPFRMTAANMARYKSDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVST 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|92116107|ref|YP_575836.1| hypothetical protein Nham_0486 [Nitrobacter hamburgensis X14]
 gi|91799001|gb|ABE61376.1| protein of unknown function DUF949 [Nitrobacter hamburgensis X14]
          Length = 502

 Score =  334 bits (858), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 106/234 (45%), Positives = 144/234 (61%), Gaps = 4/234 (1%)

Query: 8   LLFALFIFLNGCHHSRSLID---KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
            + A   FL GC+ + + +    KA  P+   L+ +M +K      P +IR+FK E  LE
Sbjct: 29  AVLASGAFLAGCNGNDASLASNAKANQPVPPKLVAAMTEKDMELQSPILIRLFKQEAELE 88

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +WK+N   ++ LLK Y IC WSG  GPK   GD QAPEGFY I    +NP S Y+LS N 
Sbjct: 89  VWKQNRSGKFALLKTYPICRWSGDLGPKTREGDRQAPEGFYSISPAQMNPRSAYYLSFNT 148

Query: 125 GFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           G+PN FDK+  RTG++LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q   Q QA+
Sbjct: 149 GYPNAFDKSLGRTGSELMVHGDCSSRGCYAMTDEQIAEIYALGRESFFG-GQHAFQFQAY 207

Query: 185 PFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           PF MT  N+  ++NNPN  FW M+K G D+FE  HQ P ++    +YVF     
Sbjct: 208 PFHMTPVNLAKHRNNPNMPFWKMIKEGSDHFEVTHQAPKVEFCEHKYVFDPAPP 261


>gi|86747657|ref|YP_484153.1| hypothetical protein RPB_0531 [Rhodopseudomonas palustris HaA2]
 gi|86570685|gb|ABD05242.1| Protein of unknown function DUF949 [Rhodopseudomonas palustris
           HaA2]
          Length = 485

 Score =  332 bits (852), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 106/224 (47%), Positives = 140/224 (62%), Gaps = 4/224 (1%)

Query: 18  GCHH---SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEY 74
           GC+    S +   KA  P+   L+ +MQ K      P ++R+FK E  LE+WK++    Y
Sbjct: 24  GCNSDQMSLARNAKANQPVPPKLVAAMQDKNMDLQSPILVRLFKQEAELEVWKQDRSGVY 83

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH 134
            LLK Y IC WSG  GPKI  GD QAPEGFY I    +NP S Y+LS N G+PN FDK+ 
Sbjct: 84  ALLKTYPICRWSGDLGPKIREGDRQAPEGFYSISPGQMNPQSSYYLSFNTGYPNAFDKSL 143

Query: 135 NRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQ 194
            RTG+ LM+HG+C+S GCYAM ++Q+ EIYA+ R+S  G  Q   Q+QA+PF+MT  N  
Sbjct: 144 GRTGSQLMVHGDCSSRGCYAMTDEQIAEIYALGRESFFG-GQRAFQLQAYPFKMTPVNFA 202

Query: 195 LYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            ++NNPN  FW MLK G+D+FE   QEP +    ++YVF     
Sbjct: 203 KHRNNPNMPFWRMLKQGYDHFEVTRQEPKVDFCEQKYVFDAAPP 246


>gi|148560248|ref|YP_001259845.1| putative lipoprotein [Brucella ovis ATCC 25840]
 gi|148371505|gb|ABQ61484.1| putative lipoprotein [Brucella ovis ATCC 25840]
          Length = 403

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQIAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|254500364|ref|ZP_05112515.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436435|gb|EEE43114.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 410

 Score =  331 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 104/243 (42%), Positives = 151/243 (62%), Gaps = 5/243 (2%)

Query: 1   MTNRYNILLFALFI--FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           M  R    + A+ +   L GC      S  +K + P+S ++   M         P +IRI
Sbjct: 20  MYKRACTRVAAVLLAGVLVGCQADDFASGPNKHKAPVSASIKRKMADLNMPSTSPIMIRI 79

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK E+ LE+WK+    ++ LL+E++IC WSG  GPK + GD QAPEGFY +    +NPNS
Sbjct: 80  FKEESELEVWKQTRTGKFKLLEEFEICKWSGKLGPKFKEGDRQAPEGFYEVTPALMNPNS 139

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
            Y L+ N+GFPN +D+AH RTG+ LM+HG C+S GCYAM ++Q+Q+IYA+ RDS +G   
Sbjct: 140 SYHLAFNLGFPNRYDQAHGRTGSHLMVHGACSSRGCYAMTDEQVQDIYALARDSFKG-GA 198

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
              Q+QAFPFRMT +N+  + ++ + +FW MLK G+D+FE  +  P I +  K+YVF   
Sbjct: 199 RSFQVQAFPFRMTPENLAKHYDSQHLAFWKMLKTGYDHFEVTNTPPAISVCEKKYVFDAT 258

Query: 237 QTI 239
             +
Sbjct: 259 PLV 261


>gi|254718078|ref|ZP_05179889.1| hypothetical protein Bru83_00779 [Brucella sp. 83/13]
 gi|265983029|ref|ZP_06095764.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839702|ref|ZP_07472504.1| lipoprotein [Brucella sp. NF 2653]
 gi|264661621|gb|EEZ31882.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405162|gb|EFM61439.1| lipoprotein [Brucella sp. NF 2653]
          Length = 403

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|23502881|ref|NP_699008.1| putative lipoprotein [Brucella suis 1330]
 gi|161619949|ref|YP_001593836.1| hypothetical protein BCAN_A2079 [Brucella canis ATCC 23365]
 gi|163844053|ref|YP_001628457.1| hypothetical protein BSUIS_A1874 [Brucella suis ATCC 23445]
 gi|254705037|ref|ZP_05166865.1| hypothetical protein Bsuib36_14174 [Brucella suis bv. 3 str. 686]
 gi|260567495|ref|ZP_05837965.1| pollen allergen Poa pIX/Phl pVI [Brucella suis bv. 4 str. 40]
 gi|261755738|ref|ZP_05999447.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|306842842|ref|ZP_07475482.1| lipoprotein [Brucella sp. BO2]
 gi|23348910|gb|AAN30923.1| lipoprotein, putative [Brucella suis 1330]
 gi|161336760|gb|ABX63065.1| protein of unknown function DUF949 [Brucella canis ATCC 23365]
 gi|163674776|gb|ABY38887.1| protein of unknown function DUF949 [Brucella suis ATCC 23445]
 gi|260157013|gb|EEW92093.1| pollen allergen Poa pIX/Phl pVI [Brucella suis bv. 4 str. 40]
 gi|261745491|gb|EEY33417.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|306287036|gb|EFM58547.1| lipoprotein [Brucella sp. BO2]
          Length = 403

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|62290878|ref|YP_222671.1| lipoprotein [Brucella abortus bv. 1 str. 9-941]
 gi|82700790|ref|YP_415364.1| hypothetical protein BAB1_2034 [Brucella melitensis biovar Abortus
           2308]
 gi|189025093|ref|YP_001935861.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus S19]
 gi|237816386|ref|ZP_04595379.1| lipoprotein [Brucella abortus str. 2308 A]
 gi|254690167|ref|ZP_05153421.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus bv. 6
           str. 870]
 gi|254694658|ref|ZP_05156486.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus bv. 3
           str. Tulya]
 gi|254696283|ref|ZP_05158111.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731200|ref|ZP_05189778.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus bv. 4
           str. 292]
 gi|256258421|ref|ZP_05463957.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus bv. 9
           str. C68]
 gi|260546140|ref|ZP_05821880.1| pollen allergen Poa pIX/Phl pVI [Brucella abortus NCTC 8038]
 gi|260755706|ref|ZP_05868054.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758931|ref|ZP_05871279.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760653|ref|ZP_05872996.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884733|ref|ZP_05896347.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214982|ref|ZP_05929263.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297247263|ref|ZP_06930981.1| lipoprotein [Brucella abortus bv. 5 str. B3196]
 gi|62197010|gb|AAX75310.1| lipoprotein, hypothetical [Brucella abortus bv. 1 str. 9-941]
 gi|82616891|emb|CAJ11990.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella melitensis
           biovar Abortus 2308]
 gi|189020665|gb|ACD73387.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Brucella abortus S19]
 gi|237788453|gb|EEP62668.1| lipoprotein [Brucella abortus str. 2308 A]
 gi|260096247|gb|EEW80123.1| pollen allergen Poa pIX/Phl pVI [Brucella abortus NCTC 8038]
 gi|260669249|gb|EEX56189.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671085|gb|EEX57906.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675814|gb|EEX62635.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874261|gb|EEX81330.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916589|gb|EEX83450.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297174432|gb|EFH33779.1| lipoprotein [Brucella abortus bv. 5 str. B3196]
          Length = 403

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|225626415|ref|ZP_03784454.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225853467|ref|YP_002733700.1| hypothetical protein BMEA_A2093 [Brucella melitensis ATCC 23457]
 gi|254700667|ref|ZP_05162495.1| hypothetical protein Bsuib55_07398 [Brucella suis bv. 5 str. 513]
 gi|254713560|ref|ZP_05175371.1| hypothetical protein BcetM6_09439 [Brucella ceti M644/93/1]
 gi|254716085|ref|ZP_05177896.1| hypothetical protein BcetM_06566 [Brucella ceti M13/05/1]
 gi|256060001|ref|ZP_05450183.1| hypothetical protein Bneo5_06551 [Brucella neotomae 5K33]
 gi|256112359|ref|ZP_05453280.1| hypothetical protein Bmelb3E_06696 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158530|ref|ZP_05456424.1| hypothetical protein BcetM4_06709 [Brucella ceti M490/95/1]
 gi|256253944|ref|ZP_05459480.1| hypothetical protein BcetB_06546 [Brucella ceti B1/94]
 gi|256263053|ref|ZP_05465585.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370432|ref|YP_003107943.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260169444|ref|ZP_05756255.1| hypothetical protein BruF5_14024 [Brucella sp. F5/99]
 gi|261217853|ref|ZP_05932134.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221084|ref|ZP_05935365.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261321297|ref|ZP_05960494.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323975|ref|ZP_05963172.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751175|ref|ZP_05994884.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261758969|ref|ZP_06002678.1| pollen allergen Poa pIX/Phl pVI [Brucella sp. F5/99]
 gi|265993794|ref|ZP_06106351.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997044|ref|ZP_06109601.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|225618072|gb|EEH15115.1| lipoprotein [Brucella ceti str. Cudo]
 gi|225641832|gb|ACO01746.1| protein of unknown function DUF949 [Brucella melitensis ATCC 23457]
 gi|256000595|gb|ACU48994.1| lipoprotein, putative [Brucella microti CCM 4915]
 gi|260919668|gb|EEX86321.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922942|gb|EEX89510.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293987|gb|EEX97483.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261299955|gb|EEY03452.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261738953|gb|EEY26949.1| pollen allergen Poa pIX/Phl pVI [Brucella sp. F5/99]
 gi|261740928|gb|EEY28854.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262551512|gb|EEZ07502.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764775|gb|EEZ10696.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092929|gb|EEZ17104.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326410029|gb|ADZ67094.1| putative lipoprotein [Brucella melitensis M28]
 gi|326539745|gb|ADZ87960.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 403

 Score =  331 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|17986322|ref|NP_538956.1| hypothetical protein BMEI0038 [Brucella melitensis bv. 1 str. 16M]
 gi|256045634|ref|ZP_05448512.1| hypothetical protein Bmelb1R_14110 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260562938|ref|ZP_05833424.1| pollen allergen Poa pIX/Phl pVI [Brucella melitensis bv. 1 str.
           16M]
 gi|265992057|ref|ZP_06104614.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17981907|gb|AAL51220.1| hypothetical protein BMEI0038 [Brucella melitensis bv. 1 str. 16M]
 gi|260152954|gb|EEW88046.1| pollen allergen Poa pIX/Phl pVI [Brucella melitensis bv. 1 str.
           16M]
 gi|263003123|gb|EEZ15416.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 403

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 110/241 (45%), Positives = 149/241 (61%), Gaps = 4/241 (1%)

Query: 1   MTNRYNIL-LFALFIFLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L        L GC  S    L  +AE PL + ++  MQ K      P ++RIF
Sbjct: 1   MKIKTALLCSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMPRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|86359412|ref|YP_471304.1| hypothetical protein RHE_CH03829 [Rhizobium etli CFN 42]
 gi|86283514|gb|ABC92577.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 410

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 114/246 (46%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L GC+ +          + +K E PL  +++ +M  K      P 
Sbjct: 1   MRIRHFAYVSLMALALAGCNDTLETAQVDLSKVKNKVEQPLPPHILNAMAAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYELTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D  + RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAVNGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  QS +Q+QAFPFRMT++NM  ++ +PNY FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQSTVQLQAFPFRMTAENMVKHRLDPNYDFWKMLKVGYDNFEVTKRPPEVNVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQAT 245


>gi|306843460|ref|ZP_07476061.1| lipoprotein [Brucella sp. BO1]
 gi|306276151|gb|EFM57851.1| lipoprotein [Brucella sp. BO1]
          Length = 403

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVST 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|254780589|ref|YP_003065002.1| hypothetical protein CLIBASIA_02380 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040266|gb|ACT57062.1| hypothetical protein CLIBASIA_02380 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 239

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 239/239 (100%), Positives = 239/239 (100%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE
Sbjct: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL
Sbjct: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ
Sbjct: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI
Sbjct: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239


>gi|218462567|ref|ZP_03502658.1| hypothetical protein RetlK5_25260 [Rhizobium etli Kim 5]
          Length = 265

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L GC+ +          + +K E PL  +++ +M  K      P 
Sbjct: 1   MRIRHFAYVSLIALALTGCNDALETAQVDLSKVKNKVEQPLPPHILAAMSAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYDLTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + NY FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQATVQLQAFPFRMTAENMVKHRLDSNYEFWKMLKVGYDNFEVTKRPPEVNVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQAT 245


>gi|294851264|ref|ZP_06791937.1| hypothetical protein BAZG_00164 [Brucella sp. NVSL 07-0026]
 gi|294819853|gb|EFG36852.1| hypothetical protein BAZG_00164 [Brucella sp. NVSL 07-0026]
          Length = 403

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 111/241 (46%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGFY +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFYTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANERTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|209551176|ref|YP_002283093.1| hypothetical protein Rleg2_3600 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536932|gb|ACI56867.1| protein of unknown function DUF949 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 409

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  RY   +  + + L GC+ +          + +K E PL  +++ +M  K      P 
Sbjct: 1   MRIRYFAYVSLMALALTGCNDALETAQVDLSKVKNKVEQPLPPHILAAMSAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYDLTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + +Y FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQATVQLQAFPFRMTAENMVKHRLDSSYDFWKMLKVGYDNFEVTKRPPEVAVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQAT 245


>gi|116254089|ref|YP_769927.1| hypothetical protein RL4356 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258737|emb|CAK09843.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 430

 Score =  329 bits (843), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L+GC+ +          + +K E PL  +++  M  K      P 
Sbjct: 23  MRIRHFAYISLMALALSGCNDALETAQVDLSKVKNKVEQPLPSHILAQMSAKGMDRNSPI 82

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 83  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYELTRANL 142

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 143 NPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 202

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + +Y FW MLK+G+D FE   + P + +  K+YV
Sbjct: 203 G-GQATVQLQAFPFRMTAENMVKHRLDSSYDFWKMLKVGYDNFEVTKRPPEVAVCEKKYV 261

Query: 233 FFKGQT 238
           F +  T
Sbjct: 262 FNQQAT 267


>gi|190893666|ref|YP_001980208.1| hypothetical protein RHECIAT_CH0004100 [Rhizobium etli CIAT 652]
 gi|190698945|gb|ACE93030.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 408

 Score =  328 bits (842), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L GC+ +          + +K E PL  +++ +M  K      P 
Sbjct: 1   MRIRHFAYVSLIALALTGCNDALETAQVDLSKVKNKVEQPLPPHILAAMSAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYDLTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + NY FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQATVQLQAFPFRMTAENMVKHRLDSNYDFWKMLKVGYDNFEVTKRPPEVAVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQVT 245


>gi|327188715|gb|EGE55914.1| hypothetical protein RHECNPAF_800017 [Rhizobium etli CNPAF512]
          Length = 408

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L GC+ +          + +K E PL  +++ +M  K      P 
Sbjct: 1   MRIRHFAYVSLIALALTGCNDALETAQIDLSKVKNKVEQPLPPHILAAMSAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYDLTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + NY FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQATVQLQAFPFRMTAENMVKHRLDSNYDFWKMLKVGYDNFEVTKRPPEVAVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQVT 245


>gi|158424938|ref|YP_001526230.1| hypothetical protein AZC_3314 [Azorhizobium caulinodans ORS 571]
 gi|158331827|dbj|BAF89312.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 425

 Score =  328 bits (841), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 112/218 (51%), Positives = 146/218 (66%), Gaps = 2/218 (0%)

Query: 19  CHHSRS-LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           C+   + +  KA  PLS  +I  M +K  +P +P +IR+FK E  LE+WK   D  Y LL
Sbjct: 28  CNGQGNDVSAKANQPLSPKMISLMSEKDMAPQNPILIRVFKEEAELEVWKAKNDGSYALL 87

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           K Y IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LSIN GFPN FDK+  RT
Sbjct: 88  KTYPICRWSGELGPKVKIGDRQAPEGFYMITPGLMNPNSSYYLSINTGFPNAFDKSWGRT 147

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           G  LMIHG+C+SAGCYAM ++Q+ EI+A+ R++  G  Q   QIQA PFRMT +N+  ++
Sbjct: 148 GEFLMIHGDCSSAGCYAMTDEQIAEIFALAREAFAG-GQRAFQIQAMPFRMTPQNLARHR 206

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           NNPN +FW  LK G+D+FE    EP + + N+QYVF  
Sbjct: 207 NNPNMAFWRNLKQGYDHFEVTKHEPKVNVCNRQYVFDA 244


>gi|227823257|ref|YP_002827229.1| putative periplasmic protein, putative exported protein
           [Sinorhizobium fredii NGR234]
 gi|227342258|gb|ACP26476.1| putative periplasmic protein, putative exported protein
           [Sinorhizobium fredii NGR234]
          Length = 469

 Score =  328 bits (840), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 108/242 (44%), Positives = 159/242 (65%), Gaps = 8/242 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS-------RSLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M  R  ++  A+   L GC +         S+ +K E+ LS  ++  M +       P +
Sbjct: 1   MRFRNLVITTAIAAGLAGCTNETLDSVNLSSVKNKTEYQLSSKMVSKMSELGMQKTSPIL 60

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +RIFK E  LE+WK N  + + LLK YKICAWSG  GPK++ GD QAPEGFY +  + +N
Sbjct: 61  LRIFKEEGTLEVWKANTSSRFQLLKSYKICAWSGKLGPKVKEGDRQAPEGFYPLYPHQMN 120

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           PNS Y+L+IN GFPN +DKA+ R+G  LMIHG C+S+GCY+M ++Q+ EI+A+ RD+ +G
Sbjct: 121 PNSNYYLAINTGFPNAYDKANGRSGTHLMIHGACSSSGCYSMTDEQIIEIFALARDAFKG 180

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q  +Q+QAFP+RMT++NM  +++NPN  FW MLK+G+D FE   + P + +  ++YVF
Sbjct: 181 -GQESVQLQAFPYRMTAENMARHRDNPNIEFWKMLKVGYDQFEVTKRPPQVNVCERKYVF 239

Query: 234 FK 235
            +
Sbjct: 240 NQ 241


>gi|328541957|ref|YP_004302066.1| transcriptional regulatory protein [polymorphum gilvum SL003B-26A1]
 gi|326411707|gb|ADZ68770.1| Putative transcriptional regulatory protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 452

 Score =  328 bits (840), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 100/222 (45%), Positives = 140/222 (63%), Gaps = 1/222 (0%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           G   S     K   P+S  +   M         P +IRIFK E+ LE+WK+  +  Y LL
Sbjct: 30  GDEFSLGSGPKHLRPVSAEVKHKMTDLGMDVSSPIMIRIFKEESQLEVWKQAKNGRYALL 89

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           + ++IC WSG  GPKI+ GD QAPEGFY I    +NPNS Y L+ N+G+PN FD++H RT
Sbjct: 90  QTFEICKWSGELGPKIKEGDRQAPEGFYEITPALMNPNSSYHLAFNLGYPNAFDRSHGRT 149

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           G+ LM+HG C+S GCYAM ++Q+Q+IYA+ RDS +G  Q   Q+QAFPFRMT +NM  ++
Sbjct: 150 GSHLMVHGACSSRGCYAMTDEQVQDIYALARDSFKG-GQRSFQVQAFPFRMTPENMARHR 208

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           +N +  FW MLK G+D+FE     P + +  ++YV+     +
Sbjct: 209 HNQHIDFWRMLKAGYDHFEVTKLPPKVDVCERKYVYDATSIV 250


>gi|241206579|ref|YP_002977675.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860469|gb|ACS58136.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 408

 Score =  326 bits (837), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 161/246 (65%), Gaps = 9/246 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L+GC+ +          + +K E PL  +++  M  K      P 
Sbjct: 1   MRIRHFAYISLMALALSGCNDALETAQVDLSKVKNKVEQPLPSHILAQMSAKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQAPEGFYDLTRANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ R+G+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRSGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q+ +Q+QAFPFRMT++NM  ++ + NY FW MLK+G+D FE   + P + +  K+YV
Sbjct: 181 G-GQATVQLQAFPFRMTAENMVKHRLDGNYDFWKMLKVGYDNFEVTKRPPEVNVCEKKYV 239

Query: 233 FFKGQT 238
           F +  T
Sbjct: 240 FNQQAT 245


>gi|154244467|ref|YP_001415425.1| hypothetical protein Xaut_0510 [Xanthobacter autotrophicus Py2]
 gi|154158552|gb|ABS65768.1| protein of unknown function DUF949 [Xanthobacter autotrophicus Py2]
          Length = 450

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 102/218 (46%), Positives = 140/218 (64%), Gaps = 1/218 (0%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
                   +A  PL+  ++  + +K  SP  P ++RIFK E  LE+WK   D  + LLK 
Sbjct: 35  QTDSEASRRANKPLTPEMVSLIAQKDMSPASPILVRIFKQEAELEVWKATSDGSFALLKT 94

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGA 139
           Y IC WSG  GPK+  GD QAPEGFY I    +NPNS Y+LS N+GFPN FD+++ RTG 
Sbjct: 95  YPICRWSGELGPKVSMGDRQAPEGFYTITPGQMNPNSSYYLSFNLGFPNAFDRSYGRTGE 154

Query: 140 DLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNN 199
            LM+HG+C+SAGCYAM ++Q+ EI+++ R+S  G  Q   Q+QA+PFRMT KN+  ++NN
Sbjct: 155 FLMVHGDCSSAGCYAMTDEQISEIFSLARESFAG-GQRAFQVQAYPFRMTPKNLARHRNN 213

Query: 200 PNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           PN +FW  LK G+D+FE   Q P + +  + YVF    
Sbjct: 214 PNMAFWRNLKQGYDHFEVTKQVPKVNVCGRSYVFDAEP 251


>gi|332716420|ref|YP_004443886.1| hypothetical protein AGROH133_11965 [Agrobacterium sp. H13-3]
 gi|325063105|gb|ADY66795.1| hypothetical protein AGROH133_11965 [Agrobacterium sp. H13-3]
          Length = 475

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 107/243 (44%), Positives = 155/243 (63%), Gaps = 9/243 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M   +  LL    + L+GC+ +          + +K ++PLS +++  + KK      P 
Sbjct: 44  MRLTHFALLACTALILSGCNDTLETVERDVSHVKNKVDYPLSPSILAEIDKKNMDRTSPI 103

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  LEIWK   D  +  + EY+ICAWSG  GPK++ GD QAPEGFY +   +L
Sbjct: 104 MIRIFKEEGALEIWKAKRDNRFDKIAEYQICAWSGKLGPKVKEGDRQAPEGFYNLTPAHL 163

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ R G +LMIHG C+S+GCY+M + Q+ EIY   RD+ +
Sbjct: 164 NPNSKYYLAINTGFPNRYDAANGRNGTNLMIHGACSSSGCYSMTDAQILEIYGFARDAFK 223

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q  +Q+QAFPFRMT++NM  ++ + +  FW MLK+G+D FE   + P + +  K+YV
Sbjct: 224 G-GQKTVQLQAFPFRMTAENMARHRQSEHLDFWKMLKVGYDNFEVTKRPPEVNVCEKKYV 282

Query: 233 FFK 235
           F +
Sbjct: 283 FNQ 285


>gi|254707445|ref|ZP_05169273.1| hypothetical protein BpinM_10862 [Brucella pinnipedialis
           M163/99/10]
 gi|254709013|ref|ZP_05170824.1| hypothetical protein BpinB_01867 [Brucella pinnipedialis B2/94]
 gi|256030538|ref|ZP_05444152.1| hypothetical protein BpinM2_07792 [Brucella pinnipedialis
           M292/94/1]
 gi|261314933|ref|ZP_05954130.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316511|ref|ZP_05955708.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|265987585|ref|ZP_06100142.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|261295734|gb|EEX99230.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303959|gb|EEY07456.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|264659782|gb|EEZ30043.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 403

 Score =  326 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 110/241 (45%), Positives = 150/241 (62%), Gaps = 4/241 (1%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  +  +L   L    L GC  S    L  +AE PL + ++  MQ K  +   P ++RIF
Sbjct: 1   MKIKTALLGSILATALLAGCQGSSVSDLAMRAEKPLPQKIVAKMQAKGMTRTSPILVRIF 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E +LE+WK+  + +Y  +  Y+IC WSG  GPK   GD QAPEGF  +    +NP+S 
Sbjct: 61  KEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKYIEGDRQAPEGFCTVRPAQMNPHSN 120

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y+L+ NIGFPN +D+A+ RTG  LM+HG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q 
Sbjct: 121 YYLAFNIGFPNAYDRANGRTGQHLMVHGACSSSGCYSMTDEQVAEIYAFGRDAFKG-GQR 179

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
             QIQAFPFRMT+ NM  Y+N+PNYSFW MLK G+D FE     P + +  K+YVF    
Sbjct: 180 EFQIQAFPFRMTAANMTRYKNDPNYSFWKMLKQGYDAFETTKVPPKVDVCEKRYVFNVPT 239

Query: 238 T 238
            
Sbjct: 240 P 240


>gi|217976362|ref|YP_002360509.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocella silvestris BL2]
 gi|217501738|gb|ACK49147.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocella silvestris BL2]
          Length = 449

 Score =  325 bits (833), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 98/222 (44%), Positives = 139/222 (62%), Gaps = 3/222 (1%)

Query: 18  GCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           GC  +   S+  +A  P+    +  M++K T+P  P +IR +K E+ LE+WK   D +Y 
Sbjct: 26  GCEDAGLNSISARANAPVPAETVALMKEKGTTPDAPVLIRTYKKESELEVWKMKADGKYA 85

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           LLK Y +C WSG  GPK   GD Q PEGFY I    + PNS Y+L+ N+G+PN +D+A  
Sbjct: 86  LLKTYPVCRWSGQLGPKTREGDRQVPEGFYSITPAQMKPNSAYYLAFNVGYPNAYDRALG 145

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           R G  +M+HG C+SAGC++M + Q+ EIYA+VRD   G  Q  IQ+Q++PFRMT++NM  
Sbjct: 146 RDGGAIMVHGICSSAGCFSMTDPQIGEIYALVRDGFSG-GQREIQMQSYPFRMTAENMAK 204

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           Y+ +PN  FW  LK G D FE   Q+  + + +K+YVF    
Sbjct: 205 YRADPNIGFWKQLKEGSDNFEVTKQQVAVGVCSKRYVFNAEP 246


>gi|319781235|ref|YP_004140711.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167123|gb|ADV10661.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 432

 Score =  324 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 102/229 (44%), Positives = 144/229 (62%), Gaps = 3/229 (1%)

Query: 9   LFALFIFLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +    + + GC++S       +A  PL + ++  M+ K        + RIFK E  LEIW
Sbjct: 10  ILIAALGVAGCNNSSMKDFAPEANKPLPDKILADMRAKGMVRTSSVMARIFKEEGKLEIW 69

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           K   +  Y ++  Y IC WSG  GPK   GD QAPEGFY +    +NP S Y LS NIG+
Sbjct: 70  KAKTNGRYDMVASYDICKWSGKLGPKYTEGDRQAPEGFYTVRPAQMNPRSNYHLSFNIGY 129

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN +D+A+ RTG++LM+HG C+S+GCY+M + Q+++IYA  RD+ +G  Q+  QIQAFPF
Sbjct: 130 PNAYDRANGRTGSNLMVHGACSSSGCYSMTDAQIEQIYAFGRDAFQG-GQTEFQIQAFPF 188

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           RMT+ NM  Y+N+PNY FW MLK+G+D FE     P + +  K+YVF +
Sbjct: 189 RMTAANMARYRNDPNYDFWKMLKVGYDNFEITKVPPKVDVCEKRYVFNQ 237


>gi|110346930|ref|YP_665748.1| hypothetical protein Meso_4116 [Mesorhizobium sp. BNC1]
 gi|110283041|gb|ABG61101.1| protein of unknown function DUF949 [Chelativorans sp. BNC1]
          Length = 335

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 152/228 (66%), Gaps = 2/228 (0%)

Query: 9   LFALFIFLNGCHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWK 67
           + AL +FL+ C  +   +  KA  P+   L+  M +K  SP  P ++RIFK E+ LE+WK
Sbjct: 11  IAALALFLSACVSTVLDVDGKATRPIPAALVADMSRKSMSPSAPVLVRIFKQESELEVWK 70

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP 127
           R+   ++ LLK Y +C WSG  GPK + GD QAPEGFY++    LNPNS+Y+LS N+G+P
Sbjct: 71  RDRSGKFALLKTYPMCRWSGKLGPKKQNGDRQAPEGFYHVSARMLNPNSQYYLSFNLGYP 130

Query: 128 NEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFR 187
           N  + A   TG  LM+HG C+S+GC+A+ ++ + EIYA+ R++L+G  Q   Q+QAFPFR
Sbjct: 131 NRLEAALGYTGEALMVHGACSSSGCFALTDEGVAEIYAVAREALKG-GQGSFQVQAFPFR 189

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           MT +NM   +N+PN++FW+ LKLG+D FE   ++P +     +YVF +
Sbjct: 190 MTPQNMAKNRNDPNFAFWSDLKLGYDIFEVTRRQPKVSYCEGRYVFDR 237


>gi|307942526|ref|ZP_07657874.1| pollen allergen Poa pIX/Phl pVI [Roseibium sp. TrichSKD4]
 gi|307774165|gb|EFO33378.1| pollen allergen Poa pIX/Phl pVI [Roseibium sp. TrichSKD4]
          Length = 408

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 100/222 (45%), Positives = 137/222 (61%), Gaps = 2/222 (0%)

Query: 19  CHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           C         K + P+   +   M +       P +IRIFK E+ LE+WK+     Y LL
Sbjct: 38  CQADELGYGPKHKRPVDSTIKRKMTELGMRSTSPIMIRIFKQESELEVWKQARGGRYKLL 97

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           + ++IC WSG  GPK + GD QAPEGFY I  + +NP S Y L+ N+G+PN FD+AH RT
Sbjct: 98  ETFEICKWSGELGPKFKEGDRQAPEGFYEIMPSLMNPKSSYHLAFNLGYPNRFDRAHGRT 157

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           G+ LM+HG C+S GCYAM +KQ+Q+IYA+ RDS +G  Q   Q+QAFPFRMT +NM   +
Sbjct: 158 GSHLMVHGACSSRGCYAMTDKQVQDIYALARDSFKG-GQRSFQVQAFPFRMTPENMAKNR 216

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
            + +  FW MLK+G+D+FE     P I +  K+YVF     +
Sbjct: 217 ESEHMDFWRMLKVGYDHFELTKVPPKISVCEKKYVFDATPLV 258


>gi|222087383|ref|YP_002545920.1| hypothetical protein Arad_4240 [Agrobacterium radiobacter K84]
 gi|221724831|gb|ACM27987.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 434

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 107/243 (44%), Positives = 156/243 (64%), Gaps = 9/243 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS--------RSLIDKAEHPLSENLIISMQKKRTSPFHPT 52
           M  R+   +  + + L GC+ +          + +K E PL + ++  M KK      P 
Sbjct: 1   MRIRHLAYMSLMALALAGCNDALDTASIDLSKVKNKVEQPLPDRILADMTKKGMDRNSPI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +IRIFK E  +EI K N +  + ++  Y ICAWSG  GPK++ GD QAPEGFY +   NL
Sbjct: 61  MIRIFKEEGTMEILKANQNNRFEVIASYSICAWSGRLGPKVKEGDRQAPEGFYNLTPANL 120

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLR 172
           NPNSKY+L+IN GFPN +D A+ R+G +LMIHG C+S+GCY+M ++Q+ EIYA  RD+ +
Sbjct: 121 NPNSKYYLAINTGFPNRYDAANGRSGNNLMIHGACSSSGCYSMTDQQVLEIYAFARDAFK 180

Query: 173 GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYV 232
           G  Q  IQ++AFPFRMT++NM  ++ + N  FW MLK+G+D FE   + P +++  K+YV
Sbjct: 181 G-GQKTIQLEAFPFRMTAENMVKHRLSSNIEFWKMLKVGYDNFEVTKRPPEVEVCEKKYV 239

Query: 233 FFK 235
           F +
Sbjct: 240 FNQ 242


>gi|90420211|ref|ZP_01228119.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335545|gb|EAS49295.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 378

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 105/221 (47%), Positives = 149/221 (67%), Gaps = 3/221 (1%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           ++ C +   L   AE PL   L+ +++        P ++R++K E+ LE+WK+  D  Y 
Sbjct: 64  VSACQYEDLLP--AEAPLPAALVQAIKSNGMGVKSPILVRLYKEESDLEVWKQKTDGTYA 121

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           LLK Y+ICAWSG  GPK + GD QAPEGFY +    LNPNS Y L++N+G+PN +D+A+ 
Sbjct: 122 LLKTYEICAWSGKLGPKKQEGDRQAPEGFYTVTPAQLNPNSNYHLALNMGYPNTYDRANG 181

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           RTG+ LMIHG C S+GCYAM+++Q+QEIY++ R S  G  Q   QIQA+PFRMT KNM  
Sbjct: 182 RTGSHLMIHGSCNSSGCYAMDDEQVQEIYSLARHSFEG-GQRAFQIQAYPFRMTPKNMAR 240

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           ++N+ +Y FW MLK G DYFE   Q+P + + +++YVF + 
Sbjct: 241 HRNSEHYDFWKMLKKGSDYFEMTRQQPNVGVCDRRYVFDQS 281


>gi|298292760|ref|YP_003694699.1| hypothetical protein Snov_2792 [Starkeya novella DSM 506]
 gi|296929271|gb|ADH90080.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 593

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 101/221 (45%), Positives = 141/221 (63%), Gaps = 1/221 (0%)

Query: 17  NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVL 76
            G      +  K    LS   +  + +K  S   P V+RIFK E+ LE+WK+    +Y L
Sbjct: 34  TGDDGPSPMSAKGTKSLSPQTVALIGEKGMSRTSPIVVRIFKEESELEVWKQTTSGDYAL 93

Query: 77  LKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR 136
           LK Y IC WSG  GPK++ GD QAPEGFY +    +NPNS+Y+LS ++G+PN FD++  R
Sbjct: 94  LKTYPICRWSGELGPKVKEGDRQAPEGFYTVTPGQMNPNSQYYLSFDLGYPNAFDRSLGR 153

Query: 137 TGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLY 196
           TGA+LM+HG+C S GCYAM ++Q+QE++A+ R+S  G  Q   Q+QA+PFRMT++NM  +
Sbjct: 154 TGANLMVHGDCTSRGCYAMTDEQVQEVFALGRESFMG-GQRSFQVQAYPFRMTAENMVRH 212

Query: 197 QNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +NNPN +FW M+K G D FE     P +    K+YVF    
Sbjct: 213 RNNPNLAFWKMIKEGSDTFEVTKAPPKVDFCAKRYVFNATP 253


>gi|150397767|ref|YP_001328234.1| hypothetical protein Smed_2569 [Sinorhizobium medicae WSM419]
 gi|150029282|gb|ABR61399.1| protein of unknown function DUF949 [Sinorhizobium medicae WSM419]
          Length = 481

 Score =  321 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 112/242 (46%), Positives = 158/242 (65%), Gaps = 8/242 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHS-------RSLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M  R  IL  A+   L GC +         S+ +K E+ LS  ++  M++       P +
Sbjct: 9   MRFRNLILTVAVAAALAGCTNETLDSVNLSSVKNKTEYQLSGKMVSKMRELGMQKTSPIL 68

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +RIFK E  LE+WK N    + LLK YKICAWSG  GPK++ GD QAPEGFY +    LN
Sbjct: 69  LRIFKEEGTLEVWKANTANRFQLLKSYKICAWSGKLGPKVKEGDRQAPEGFYPLYPRQLN 128

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           PNS Y+L+IN G+PN +DKA+ RTG  LMIHG C+S+GCY+M ++Q+ EI+A+ RD+ +G
Sbjct: 129 PNSSYYLAINTGYPNTYDKANGRTGTHLMIHGACSSSGCYSMTDEQIIEIFALARDAFKG 188

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q  +Q+QAFPFRMT++NM  +++NPN  FW MLK+G+D FE   + P + +  ++YVF
Sbjct: 189 -GQESVQLQAFPFRMTAENMARHRDNPNIDFWKMLKVGYDQFEVTKRPPAVNVCERKYVF 247

Query: 234 FK 235
            +
Sbjct: 248 NQ 249


>gi|114705348|ref|ZP_01438256.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Fulvimarina pelagi
           HTCC2506]
 gi|114540133|gb|EAU43253.1| Pollen allergen Poa pIX/Phl pVI, C-terminal [Fulvimarina pelagi
           HTCC2506]
          Length = 329

 Score =  321 bits (823), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 103/234 (44%), Positives = 143/234 (61%), Gaps = 1/234 (0%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R     F             + +  AE PL   L+  ++        P ++R+FK E+ 
Sbjct: 4   RRLLTGAFLATALFTATSCKYADLLPAEAPLPAALVAQIRANSMGVNSPMLVRLFKEESE 63

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           LE+WK+  D  Y  LK Y ICAWSG  GPK   GD QAPEGFY +    LNPNS Y L+I
Sbjct: 64  LEVWKQRTDGTYAHLKTYPICAWSGKLGPKFAEGDRQAPEGFYNVNPTQLNPNSSYHLAI 123

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           N+G+PN +D+A+ RTG+ LMIHG C S+GCYAM++ Q+QEIY + R S  G  Q + QIQ
Sbjct: 124 NMGYPNTYDRANGRTGSHLMIHGSCNSSGCYAMDDVQVQEIYGLARHSFEG-GQRNFQIQ 182

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           A+PFRMT +NM  + N+ +Y+FW MLK G DYFE+  + P + + +++Y+F + 
Sbjct: 183 AYPFRMTPQNMARHSNSEHYAFWTMLKKGSDYFEQTRKPPHVGVCDRRYIFDQS 236


>gi|260461662|ref|ZP_05809909.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259032732|gb|EEW33996.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 432

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 102/232 (43%), Positives = 143/232 (61%), Gaps = 3/232 (1%)

Query: 9   LFALFIFLNGCHHSR--SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +    I + GC+ S       +A  PL + ++  M+ K        + RIFK E  LEIW
Sbjct: 10  VLVASIAIAGCNDSSMKDFAPEANKPLPDKILADMKAKGMVRTSSVMARIFKEEGKLEIW 69

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           K   +  Y ++  Y IC WSG  GPK   GD QAPEGFY +  + +NP S Y LS NIGF
Sbjct: 70  KAKTNGRYDMVASYDICKWSGKLGPKYTEGDRQAPEGFYTVRPSQMNPRSNYHLSFNIGF 129

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN +D+A+ RTG +LM+HG C+S+GCY+M + Q+++IYA  RD+ +G  Q+  Q++AFPF
Sbjct: 130 PNAYDRANGRTGQNLMVHGACSSSGCYSMTDAQIEQIYAFGRDAFQG-GQTEFQVEAFPF 188

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           RMT+ NM  Y+N+PNY FW MLK+G+D FE     P + +  K+YVF +   
Sbjct: 189 RMTAANMARYRNDPNYEFWKMLKVGYDNFEITKVPPKVDVCEKRYVFNQVAP 240


>gi|15966436|ref|NP_386789.1| lipoprotein [Sinorhizobium meliloti 1021]
 gi|307300526|ref|ZP_07580306.1| ErfK/YbiS/YcfS/YnhG family protein [Sinorhizobium meliloti BL225C]
 gi|307318391|ref|ZP_07597826.1| ErfK/YbiS/YcfS/YnhG family protein [Sinorhizobium meliloti AK83]
 gi|15075707|emb|CAC47262.1| Hypothetical protein signal peptide [Sinorhizobium meliloti 1021]
 gi|306896073|gb|EFN26824.1| ErfK/YbiS/YcfS/YnhG family protein [Sinorhizobium meliloti AK83]
 gi|306904692|gb|EFN35276.1| ErfK/YbiS/YcfS/YnhG family protein [Sinorhizobium meliloti BL225C]
          Length = 480

 Score =  320 bits (820), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 106/213 (49%), Positives = 148/213 (69%), Gaps = 1/213 (0%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
            S+ +K E+ LS  ++  M++       P ++RIFK E  LE+WK N    + LLK YKI
Sbjct: 30  SSVKNKTEYQLSSKMVSKMRELGMQKTSPILLRIFKEEGTLEVWKANTANRFQLLKSYKI 89

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM 142
           CAWSG  GPK++ GD QAPEGFY +  N +NPNS Y+L+IN G+PN +DKA+ RTG  LM
Sbjct: 90  CAWSGKLGPKMKEGDRQAPEGFYPLYPNQMNPNSSYYLAINTGYPNTYDKANGRTGTHLM 149

Query: 143 IHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNY 202
           IHG C+SAGCY+M N+Q+ EI+A+ RD+ +G  Q  +Q+QAFPFRMT++NM  +++NPN 
Sbjct: 150 IHGACSSAGCYSMTNEQIIEIFALARDAFKG-GQESVQLQAFPFRMTAENMARHRDNPNI 208

Query: 203 SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            FW MLK G+D FE   + P + +  ++YVF +
Sbjct: 209 EFWKMLKAGYDQFEVTKRPPAVNVCERKYVFNQ 241


>gi|304394155|ref|ZP_07376078.1| lipoprotein [Ahrensia sp. R2A130]
 gi|303293595|gb|EFL87972.1| lipoprotein [Ahrensia sp. R2A130]
          Length = 345

 Score =  319 bits (818), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 104/232 (44%), Positives = 149/232 (64%), Gaps = 2/232 (0%)

Query: 5   YNILLFALFIFLNGCHHSRS-LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
               L    + L+GC  + + L  KA  P+ + L+  M+ K  +   P ++RIFK EN L
Sbjct: 2   LLASLAVTGLVLSGCQDNLAGLDTKASVPVPQKLVRQMKAKNMATNAPIMVRIFKQENTL 61

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
           EIWK+  +  Y +L +Y+IC WSG  GPK + GD QAPEGFY +    +NP S+Y L+ N
Sbjct: 62  EIWKKTRNGRYAMLADYEICKWSGKLGPKFKEGDRQAPEGFYNVTPALMNPRSQYHLAFN 121

Query: 124 IGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
           +GFPN +D++H RTG  LM+HG C+SAGCYAM ++Q++ IYA+ RD+ +G  Q   QIQA
Sbjct: 122 MGFPNAYDRSHGRTGTHLMVHGACSSAGCYAMTDQQVEVIYALARDAFKG-GQKGFQIQA 180

Query: 184 FPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           FPFRMT +NM   ++N ++++W MLK GHD+FE     P + +  K+Y F  
Sbjct: 181 FPFRMTEENMVANRDNQHFAYWQMLKKGHDHFEITKVPPKVDVCEKRYEFNT 232


>gi|163759951|ref|ZP_02167035.1| hypothetical protein HPDFL43_17011 [Hoeflea phototrophica DFL-43]
 gi|162282909|gb|EDQ33196.1| hypothetical protein HPDFL43_17011 [Hoeflea phototrophica DFL-43]
          Length = 398

 Score =  319 bits (818), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 100/229 (43%), Positives = 151/229 (65%), Gaps = 2/229 (0%)

Query: 10  FALFIFLNGCHHS-RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
             L + L GC  +  S+ +K EHPL   L+  M+    S   P ++RIFK E +LE+WK+
Sbjct: 1   MLLVVGLVGCQDALDSVSNKVEHPLPSKLVNKMKANDMSTRSPIMMRIFKEEGVLEVWKQ 60

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             +  Y ++  Y+IC WSG  GPK + GD QAPEG+Y I    +NPNS Y+LS N+GFPN
Sbjct: 61  KGNGRYDIIAAYEICKWSGVLGPKFKEGDRQAPEGYYRIYPAQMNPNSSYYLSFNMGFPN 120

Query: 129 EFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRM 188
            +D++HNRTG++LM+HG C+SAGCY+M ++Q+ EIY   RD+ +G  Q +  ++A PFRM
Sbjct: 121 SYDRSHNRTGSNLMVHGACSSAGCYSMTDEQVLEIYGFARDAFKG-GQEYFLVEALPFRM 179

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           T +NM  ++++ ++ FW MLK G+D+FE   + P +++  + YVF +  
Sbjct: 180 TPENMARHRDSEHFEFWKMLKTGYDHFELTKRPPKVEVCERSYVFNQVP 228


>gi|254472222|ref|ZP_05085622.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958505|gb|EEA93705.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 389

 Score =  318 bits (816), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 102/217 (47%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
           C  +    +K + P+S++L   M+ K      P ++R+FK E+ LE+WK+    EY LL+
Sbjct: 28  CQGTEFGAEKHQQPVSKSLSNRMKSKDMELKSPIMVRLFKQESELEVWKQTKSGEYALLE 87

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG 138
            + IC WSG  GPK + GD QAPEGFY +    +NP S Y+LS N+GFPN+FD+AH+RTG
Sbjct: 88  TFDICKWSGKLGPKFKEGDRQAPEGFYEVTPGLMNPFSSYYLSFNLGFPNKFDRAHDRTG 147

Query: 139 ADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQN 198
           ++LM+HG C+S GCYAM ++Q+ +IYA+ RDS  G  Q   Q+QAFPFRMT +NM    +
Sbjct: 148 SNLMVHGACSSRGCYAMTDEQIADIYALGRDSFLG-GQRKFQVQAFPFRMTPENMAKNAS 206

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           + +Y FW MLK G+D+FE   + P I++ +K+YVF  
Sbjct: 207 SEHYEFWRMLKRGYDHFEVTKRPPAIEVCDKKYVFNA 243


>gi|220924463|ref|YP_002499765.1| hypothetical protein Mnod_4595 [Methylobacterium nodulans ORS 2060]
 gi|219949070|gb|ACL59462.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 524

 Score =  318 bits (814), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 99/215 (46%), Positives = 134/215 (62%), Gaps = 1/215 (0%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
             +     +   P+ +  +  M  K  S   P +IR +K E+ +E+WKR  D  Y LLK 
Sbjct: 26  GFAGGGSTRHLQPIPQKTLALMSTKGMSAGDPILIRAYKKESEMEVWKRGSDGRYALLKT 85

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGA 139
           + IC WSG  GPKI  GD QAPEGFY I    +NPNS Y+LS + GFPN FD+A+ RTG 
Sbjct: 86  FPICRWSGQLGPKIRQGDRQAPEGFYTITPGQMNPNSSYYLSFDTGFPNAFDRANGRTGT 145

Query: 140 DLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNN 199
            LM+HG C+SAGC+AM ++ + EIYAI R++  G  Q   Q Q++PFRMT++N+  Y+N+
Sbjct: 146 YLMVHGTCSSAGCFAMTDEAIAEIYAIAREAFAG-GQRGFQFQSYPFRMTAQNVAKYRND 204

Query: 200 PNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           PN  FW  LK G DYFE   +EP + +   +YVF 
Sbjct: 205 PNMPFWKNLKEGSDYFEALREEPKVGVCGTRYVFG 239


>gi|222149988|ref|YP_002550945.1| hypothetical protein Avi_4058 [Agrobacterium vitis S4]
 gi|221736970|gb|ACM37933.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 445

 Score =  316 bits (810), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 103/214 (48%), Positives = 143/214 (66%), Gaps = 1/214 (0%)

Query: 22  SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK 81
             ++ +K E PL   ++ S++ K      P  IRIFK E +LEIWK   D  +  + +Y+
Sbjct: 32  PANVSNKVEQPLPPEILASLKAKGMERNSPIAIRIFKEEGVLEIWKAKTDGRFEKIADYQ 91

Query: 82  ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADL 141
           ICAWSG  GPK + GD QAPEGFY +   NLNP SKY+L+IN GFPN++D  +NR G +L
Sbjct: 92  ICAWSGKLGPKEKEGDRQAPEGFYALTPANLNPYSKYYLAINTGFPNKYDAVNNRNGTNL 151

Query: 142 MIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPN 201
           MIHG C+S+GCY+M + Q+ EIYA  RD+ RG  Q  +Q+QAFPFRMT++NM  ++ + +
Sbjct: 152 MIHGACSSSGCYSMTDAQILEIYAFARDAFRG-GQQTVQLQAFPFRMTAENMARHRYSTH 210

Query: 202 YSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
             FW MLK G+D FE   Q P + + +K+YVF +
Sbjct: 211 MPFWQMLKAGYDQFEVTKQPPQVGVCDKKYVFNQ 244


>gi|188584456|ref|YP_001927901.1| hypothetical protein Mpop_5272 [Methylobacterium populi BJ001]
 gi|179347954|gb|ACB83366.1| protein of unknown function DUF949 [Methylobacterium populi BJ001]
          Length = 475

 Score =  316 bits (809), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 133/222 (59%), Gaps = 4/222 (1%)

Query: 16  LNGCHHS---RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L  C  S        ++  P+    +  MQ K  S   P +IR FK E  +E+WKR  + 
Sbjct: 18  LGACQDSAMLGGASTRSLTPIPPQTLALMQTKGMSQSDPILIRAFKKEAEMEVWKRGSNG 77

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y LLK + IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LS ++G+PN  D+
Sbjct: 78  QYALLKTFPICRWSGQLGPKLKQGDRQAPEGFYAITPGQMNPNSSYYLSFDVGYPNAIDR 137

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A   TG  +M+HG C+S+GC+AM +  M EIYAI R++  G  Q   Q Q++PFRMT+ N
Sbjct: 138 AKGGTGNYIMVHGTCSSSGCFAMTDASMSEIYAIAREAFNG-GQRAFQFQSYPFRMTASN 196

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 197 IAKFRNDPNAPFWKNLKEGSDYFEALKEEPRVAACGTKYVFG 238


>gi|254564096|ref|YP_003071191.1| hypothetical protein METDI5786 [Methylobacterium extorquens DM4]
 gi|254271374|emb|CAX27387.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 462

 Score =  315 bits (808), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 134/222 (60%), Gaps = 4/222 (1%)

Query: 16  LNGCHHS---RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L  C  S        +++ P+    +  MQ K  S   P +IR FK E  +E+WKR  + 
Sbjct: 18  LGACQDSAMLGGASTRSQTPIPPQTLALMQTKGMSQSDPILIRAFKKEAEMEVWKRGANG 77

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y LLK + IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LS ++G+PN  D+
Sbjct: 78  QYALLKTFPICRWSGQLGPKLKQGDRQAPEGFYAITPGQMNPNSSYYLSFDVGYPNAIDR 137

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A   TG  +M+HG C+S+GC+AM +  M EIYAI R++  G  Q   Q Q++PFRMT+ N
Sbjct: 138 AKGGTGNYIMVHGTCSSSGCFAMTDASMSEIYAIAREAFNG-GQRAFQFQSYPFRMTASN 196

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 197 IAKFRNDPNAPFWKNLKEGSDYFETLKEEPRVAACGTKYVFG 238


>gi|218533074|ref|YP_002423890.1| hypothetical protein Mchl_5200 [Methylobacterium chloromethanicum
           CM4]
 gi|218525377|gb|ACK85962.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 462

 Score =  315 bits (807), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 133/222 (59%), Gaps = 4/222 (1%)

Query: 16  LNGCHHS---RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L  C  S        ++  P+    +  MQ K  S   P +IR FK E  +E+WKR  + 
Sbjct: 18  LGACQDSAMLGGASTRSLTPIPPQTLALMQTKGMSQSDPILIRAFKKEAEMEVWKRGANG 77

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y LLK + IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LS ++G+PN  D+
Sbjct: 78  QYALLKTFPICRWSGQLGPKLKQGDRQAPEGFYAITPGQMNPNSSYYLSFDVGYPNAIDR 137

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A   TG  +M+HG C+S+GC+AM +  M EIYAI R++  G  Q   Q Q++PFRMT+ N
Sbjct: 138 AKGGTGNYIMVHGTCSSSGCFAMTDASMSEIYAIAREAFNG-GQRAFQFQSYPFRMTASN 196

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 197 IAKFRNDPNAPFWKNLKEGSDYFETLKEEPRVAACGTKYVFG 238


>gi|163854129|ref|YP_001642172.1| hypothetical protein Mext_4733 [Methylobacterium extorquens PA1]
 gi|163665734|gb|ABY33101.1| protein of unknown function DUF949 [Methylobacterium extorquens
           PA1]
          Length = 462

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 133/222 (59%), Gaps = 4/222 (1%)

Query: 16  LNGCHHS---RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L  C  S        ++  P+    +  MQ K  S   P +IR FK E  +E+WKR  + 
Sbjct: 18  LGACQDSAMLGGASTRSLTPIPPQTLALMQTKGMSQSDPILIRAFKKEAEMEVWKRGANG 77

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y LLK + IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LS ++G+PN  D+
Sbjct: 78  QYALLKTFPICRWSGQLGPKLKQGDRQAPEGFYAITPGQMNPNSSYYLSFDVGYPNAIDR 137

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A   TG  +M+HG C+S+GC+AM +  M EIYAI R++  G  Q   Q Q++PFRMT+ N
Sbjct: 138 AKGGTGNYIMVHGTCSSSGCFAMTDASMSEIYAIAREAFNG-GQRAFQFQSYPFRMTASN 196

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 197 IAKFRNDPNAPFWKNLKEGSDYFETLKEEPRVAACGTKYVFG 238


>gi|240141585|ref|YP_002966065.1| hypothetical protein MexAM1_META1p5185 [Methylobacterium extorquens
           AM1]
 gi|240011562|gb|ACS42788.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
          Length = 462

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 133/222 (59%), Gaps = 4/222 (1%)

Query: 16  LNGCHHS---RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L  C  S        ++  P+    +  MQ K  S   P +IR FK E  +E+WKR  + 
Sbjct: 18  LGACQDSAMLGGASTRSLTPIPPQTLALMQTKGMSQSDPILIRAFKKEAEMEVWKRGANG 77

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y LLK + IC WSG  GPK++ GD QAPEGFY I    +NPNS Y+LS ++G+PN  D+
Sbjct: 78  QYALLKTFPICRWSGQLGPKLKQGDRQAPEGFYAITPGQMNPNSSYYLSFDVGYPNAIDR 137

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A   TG  +M+HG C+S+GC+AM +  M EIYAI R++  G  Q   Q Q++PFRMT+ N
Sbjct: 138 AKGGTGNYIMVHGTCSSSGCFAMTDASMSEIYAIAREAFNG-GQRAFQFQSYPFRMTASN 196

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 197 IAKFRNDPNAPFWKNLKEGSDYFETLKEEPRVAACGTKYVFG 238


>gi|300024682|ref|YP_003757293.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526503|gb|ADJ24972.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 321

 Score =  315 bits (807), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 98/227 (43%), Positives = 140/227 (61%), Gaps = 1/227 (0%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWK 67
            + A  + L  C ++ ++   +E PLS++ I  + KK      P  +RIFK E+ LEIWK
Sbjct: 16  AVMAGAVLLAACSNTPTIPPPSEVPLSKDAISLLAKKGMQSGSPIFVRIFKEESELEIWK 75

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP 127
           +  D  +   K Y IC WSG  GPK+  GD QAPEGFY +    +NPNSKY+LS N+G+P
Sbjct: 76  QRDDGRFYHFKTYPICNWSGEIGPKLTYGDRQAPEGFYSVTPGLMNPNSKYYLSFNLGYP 135

Query: 128 NEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFR 187
           N +D++ NRTG  +M+HG C SAGCYAM +  M+EIY + R++L+   Q+  Q+QA PFR
Sbjct: 136 NAYDRSWNRTGDSVMVHGNCRSAGCYAMTDALMEEIYGLSREALKA-GQTSFQVQALPFR 194

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           MT   M   +N+   ++W  LK G+DYFEK    P + +  ++YV  
Sbjct: 195 MTDARMAREKNSKWLTYWKTLKQGYDYFEKYRVPPNVVVCERRYVVG 241


>gi|49476284|ref|YP_034325.1| hypothetical protein BH16330 [Bartonella henselae str. Houston-1]
 gi|49239092|emb|CAF28395.1| hypothetical protein BH16330 [Bartonella henselae str. Houston-1]
          Length = 247

 Score =  314 bits (805), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 114/243 (46%), Positives = 154/243 (63%), Gaps = 5/243 (2%)

Query: 1   MTNRYNILLFALFI--FLNGCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           M  +  ++++ LF    L  C      S+  K E PL   +   M      P+ P ++R 
Sbjct: 1   MIFKRFLIIYVLFATGILTACEGRLPASIRAKVEQPLPREVQNRMVLYNVDPYAPIMMRF 60

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK ENI EIWK++    +VL+  Y IC WSG  GPK + GD Q PEGFY I  + +NP S
Sbjct: 61  FKEENIAEIWKQSRSGSFVLIARYDICKWSGQLGPKYKEGDFQTPEGFYTISASQMNPYS 120

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
           KY+LS NIGFPN +D+AH RTG++LM+HG C SAGCY+M++K M +IYA  RD+ RG  Q
Sbjct: 121 KYYLSFNIGFPNLYDQAHGRTGSNLMVHGSCFSAGCYSMSDKNMAQIYAFARDAFRG-GQ 179

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
              Q+QAFPFRMT  NM  + ++P+Y FW MLK G+D FEKN + P + +  K+YVF  G
Sbjct: 180 RKFQLQAFPFRMTDANMARHSSDPHYQFWMMLKKGYDLFEKNRKPPTVDVYEKRYVFNTG 239

Query: 237 QTI 239
           +T+
Sbjct: 240 KTV 242


>gi|182677537|ref|YP_001831683.1| hypothetical protein Bind_0542 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633420|gb|ACB94194.1| protein of unknown function DUF949 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 407

 Score =  314 bits (804), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 99/229 (43%), Positives = 144/229 (62%), Gaps = 3/229 (1%)

Query: 11  ALFIFLNGCH--HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           ++ +    C          K E P+    +  M+ + T+   P +IR +K E  LEIWK+
Sbjct: 14  SILVAFFACQQGAVAGGYSKGETPIPGATLALMRARDTTAEAPILIRTYKKEAELEIWKQ 73

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             +  +VLLK + IC WSG  GPK + GD QAPEGFY++G   +NPNS Y+LS ++G+PN
Sbjct: 74  ARNGRFVLLKTFPICRWSGQLGPKSQQGDRQAPEGFYWVGPKQMNPNSAYYLSFDVGYPN 133

Query: 129 EFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRM 188
            +DKAH  +G+ +M+HG C+SAGC+AM +K + EIYAI R++LRG  Q   Q QA+PFRM
Sbjct: 134 AYDKAHGGSGSYVMVHGTCSSAGCFAMTDKGVGEIYAIAREALRG-GQQAFQFQAYPFRM 192

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           T++NM  Y+ + N +FW  LK G D FE   +EP + + + +YVF   +
Sbjct: 193 TAQNMAKYRLDANIAFWRQLKEGSDRFEATGEEPLVSVASGRYVFSPSK 241


>gi|170748277|ref|YP_001754537.1| hypothetical protein Mrad2831_1859 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654799|gb|ACB23854.1| protein of unknown function DUF949 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 504

 Score =  314 bits (804), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 101/209 (48%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query: 25  LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA 84
              ++  P++   +  MQ K   P  P +IR FK E  +EIWKR  D  Y L+K Y IC 
Sbjct: 33  PSARSLAPIAPQTVALMQSKGMQPSDPILIRTFKKEAEMEIWKRGSDGRYALMKTYPICR 92

Query: 85  WSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
           WSG  GPK   GD QAPEGFY I    +NPNS Y+LS + GFPN  D+A+ RTG  LM+H
Sbjct: 93  WSGQLGPKTREGDRQAPEGFYTITPGLMNPNSSYYLSFDTGFPNAVDRANGRTGKYLMVH 152

Query: 145 GECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           G C+SAGC+AM +  + EIYA+ RD+  G  Q   Q Q++PFRMT++NM  ++N+PN +F
Sbjct: 153 GTCSSAGCFAMTDATIAEIYAVARDAFIG-GQRSFQFQSYPFRMTAENMAKFRNDPNIAF 211

Query: 205 WNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           W  LK G DYFE  H+EP +     +YVF
Sbjct: 212 WQNLKEGSDYFEALHEEPKVGQCGTKYVF 240


>gi|170742903|ref|YP_001771558.1| hypothetical protein M446_4794 [Methylobacterium sp. 4-46]
 gi|168197177|gb|ACA19124.1| protein of unknown function DUF949 [Methylobacterium sp. 4-46]
          Length = 518

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 102/212 (48%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
                +   P+ +  +  M +K  SP  P +IR FK E+ +E+WKR  D  Y LLK + I
Sbjct: 28  SGGSTRHLQPIPQKTVALMSQKGMSPGDPILIRAFKKESEMEVWKRGSDGRYALLKTFPI 87

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM 142
           C WSG  GPKI  GD QAPEGFY I    +NPNS Y+LS + GFPN FD+A+NRTG  LM
Sbjct: 88  CRWSGQLGPKIRQGDRQAPEGFYPITPGQMNPNSSYYLSFDTGFPNAFDRANNRTGTYLM 147

Query: 143 IHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNY 202
           +HG C+SAGC+AM ++ + EIYAI R++  G  Q   Q Q++PFRM ++N+  Y+N+PN 
Sbjct: 148 VHGTCSSAGCFAMTDEAIAEIYAIAREAFAG-GQRAFQFQSYPFRMNAENLAKYRNDPNM 206

Query: 203 SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
            FW  LK G DYFE  H+EP + +   +YVF 
Sbjct: 207 PFWKNLKEGSDYFEALHEEPRVGVCGTRYVFG 238


>gi|218529105|ref|YP_002419921.1| hypothetical protein Mchl_1094 [Methylobacterium chloromethanicum
           CM4]
 gi|240141940|ref|YP_002966450.1| hypothetical protein MexAM1_META2p0201 [Methylobacterium extorquens
           AM1]
 gi|254559780|ref|YP_003066875.1| hypothetical protein METDI1259 [Methylobacterium extorquens DM4]
 gi|218521408|gb|ACK81993.1| protein of unknown function DUF949 [Methylobacterium
           chloromethanicum CM4]
 gi|240011884|gb|ACS43109.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254267058|emb|CAX22871.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 357

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 93/218 (42%), Positives = 136/218 (62%), Gaps = 2/218 (0%)

Query: 19  CHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           C   R +   +   P+    +  M  K  SP  P ++R +K E+ +E+WKR  D +Y LL
Sbjct: 18  CQDGRYAASTRHLAPIPPATLALMSTKEMSPADPILMRAYKKESEIELWKRGADGKYALL 77

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           K Y +C WSG  GPK   GD QAPEGFY I   ++NPNS  +LS N+G+PNE+D++  RT
Sbjct: 78  KTYPMCRWSGQLGPKTREGDRQAPEGFYSITPASMNPNSSLYLSFNLGYPNEYDRSLGRT 137

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           GA LM+HG C+S GC+AM ++ + E+YA+VR++  G  Q  +Q Q++PFRMT +N+  ++
Sbjct: 138 GAHLMVHGSCSSRGCFAMTDEAISELYAVVREAFAG-GQHAVQFQSYPFRMTPENLARHR 196

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            +PN +FW  +K G D FE    EP + +   +YVF  
Sbjct: 197 QDPNIAFWMNIKEGSDRFEITKTEPVVGVAGARYVFDA 234


>gi|182679828|ref|YP_001833974.1| hypothetical protein Bind_2917 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635711|gb|ACB96485.1| protein of unknown function DUF949 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 545

 Score =  312 bits (800), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 95/225 (42%), Positives = 137/225 (60%), Gaps = 5/225 (2%)

Query: 17  NGC----HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
            GC            +A  PLS   +  M +  T+   P +IR +K E  LEIWK   D 
Sbjct: 49  AGCDEVMSPPGLSNARAHAPLSHKTLTLMSEHGTTSASPVLIRTYKKEAELEIWKMGADG 108

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
            Y  LK Y +C WSG  GPK+  GD Q PEGFY I    ++PNS Y+LS ++G+PN FD+
Sbjct: 109 RYKHLKTYPMCRWSGQLGPKMREGDRQVPEGFYAITPAQMHPNSHYYLSFDVGYPNTFDR 168

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
           A  R+G  +M+HG C+SAGC++M ++Q++EIYAIVR+   G  Q  IQ+Q++PFRMT++N
Sbjct: 169 AWGRSGGSIMVHGVCSSAGCFSMTDEQIEEIYAIVREGFAG-GQRAIQMQSYPFRMTAEN 227

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +  Y+ +PN +FW  LK G D+F+   QE  + + ++ Y+F    
Sbjct: 228 LAKYRLDPNIAFWRQLKEGADHFDLTRQEVIVGVCDRHYIFNALP 272


>gi|49474796|ref|YP_032838.1| hypothetical protein BQ13240 [Bartonella quintana str. Toulouse]
 gi|49240300|emb|CAF26782.1| hypothetical protein BQ13240 [Bartonella quintana str. Toulouse]
          Length = 247

 Score =  311 bits (798), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 111/242 (45%), Positives = 147/242 (60%), Gaps = 5/242 (2%)

Query: 1   MTNRYNILLFALFIF--LNGCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           MT         LF    L  C      S+  K E PL + +   M      P+ P ++R 
Sbjct: 1   MTFNRFFATCVLFAIGILTACKERLPASIRAKVEQPLPQEVQNKMVLHNIDPYAPIMMRF 60

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK EN+ EIWK++    +VL+  Y IC WSG  GPK + GD Q PEGFY I  + +NP S
Sbjct: 61  FKEENVAEIWKQSRSGPFVLVARYDICKWSGQLGPKYKEGDLQTPEGFYTISADQMNPYS 120

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
           KY+LS NIGFPN +D+ H RTG++LM+HG C S GCYAM +K M +IYA  RD+ RG  Q
Sbjct: 121 KYYLSFNIGFPNLYDQVHGRTGSNLMVHGSCFSVGCYAMGDKNMAQIYAFARDAFRG-GQ 179

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
              Q+QAFPFRMT+ NM  +  +P+Y FW MLK G+D+FE+N + P + +  K+YVF   
Sbjct: 180 KEFQLQAFPFRMTNANMARHSTDPHYQFWVMLKEGYDFFEENRKPPTVDVYKKRYVFSTN 239

Query: 237 QT 238
           +T
Sbjct: 240 KT 241


>gi|240851368|ref|YP_002972771.1| putative lipoprotein [Bartonella grahamii as4aup]
 gi|240268491|gb|ACS52079.1| putative lipoprotein [Bartonella grahamii as4aup]
          Length = 249

 Score =  311 bits (796), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 111/239 (46%), Positives = 152/239 (63%), Gaps = 5/239 (2%)

Query: 1   MTNRYNILLFALFI--FLNGCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           MT    + +  LF+   L  C      S+  K E PL + +   M      P+ P V+R 
Sbjct: 1   MTFSRFLAVCVLFVMGILAACGGRLPASIRAKVEQPLPQEIQNRMALYDIDPYAPIVMRF 60

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK EN+ E+WK++    ++L+  Y IC WSG  GPK + GD Q PEGFY I  N +NP S
Sbjct: 61  FKEENLAEVWKQSRSGPFILVARYGICKWSGKLGPKYKEGDLQTPEGFYTISANQMNPYS 120

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
           KY+LS NIGFPN +D+ + RTG++LM+HG C SAGCY+M++K M +IYA  RD+ +G  Q
Sbjct: 121 KYYLSFNIGFPNLYDQENGRTGSNLMVHGSCFSAGCYSMSDKNMAQIYAFARDAFKG-GQ 179

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              Q+QAFPFRMT  NM  + N+P+Y FW MLK G+D+FEKN Q P +++  K+YVF +
Sbjct: 180 REFQLQAFPFRMTEDNMLRHSNDPHYQFWVMLKKGYDFFEKNRQPPTVEVYGKRYVFNR 238


>gi|163869344|ref|YP_001610600.1| hypothetical protein Btr_2657 [Bartonella tribocorum CIP 105476]
 gi|161019047|emb|CAK02605.1| hypothetical protein BT_2657 [Bartonella tribocorum CIP 105476]
          Length = 249

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 109/240 (45%), Positives = 153/240 (63%), Gaps = 5/240 (2%)

Query: 1   MTNRYNILLFALFIF--LNGCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           MT    + +  LF+   L  C      S+  K E PL + +   M      P+ P V+R 
Sbjct: 1   MTFNSFLSVCVLFVIGILTACEGRLPASIRAKVEQPLPQEIQNRMALYDIDPYAPIVMRF 60

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK EN+ E+WK++    ++L+  Y IC WSG  GPK + GD Q PEGFY I  N +NP S
Sbjct: 61  FKEENVAEVWKQSRSGPFILVARYGICKWSGKLGPKYKEGDLQTPEGFYTITANQMNPYS 120

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
           KY+LS NIG+PN +D+ + RTG++LM+HG C SAGCY+M++K M +IYA  RD+ +G  Q
Sbjct: 121 KYYLSFNIGYPNLYDQENGRTGSNLMVHGSCFSAGCYSMSDKNMAQIYAFARDAFKG-GQ 179

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
              Q+QAFPFRMT  NM  + N+P+Y FW MLK G+D+FE+N Q P +++  K+Y+F +G
Sbjct: 180 RAFQLQAFPFRMTEDNMLRHGNDPHYPFWVMLKKGYDFFEENRQPPIVEVYGKRYIFNRG 239


>gi|188583325|ref|YP_001926770.1| hypothetical protein Mpop_4119 [Methylobacterium populi BJ001]
 gi|179346823|gb|ACB82235.1| protein of unknown function DUF949 [Methylobacterium populi BJ001]
          Length = 355

 Score =  309 bits (791), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 92/219 (42%), Positives = 137/219 (62%), Gaps = 2/219 (0%)

Query: 19  CHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           C   + +   +   P+    +  M  K  SP  P ++R +K E+ +E+WKR  D +Y LL
Sbjct: 18  CQDGQYAASTRHLAPIPPATLALMSAKGVSPADPILMRAYKKESEIELWKRGTDGKYALL 77

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           K Y +C WSG  GPK   GD QAPEGFY +   ++NPNS  +LS N+G+PNE+D++  RT
Sbjct: 78  KTYAMCRWSGQLGPKTREGDRQAPEGFYAVTPASMNPNSSLYLSFNLGYPNEYDRSLGRT 137

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           GA LM+HG C+S GC+AM ++ + E+YA+VR++  G  Q  +Q Q++PFRMT +N+  ++
Sbjct: 138 GAHLMVHGSCSSRGCFAMTDEVISELYAVVREAFAG-GQRAVQFQSYPFRMTPENLARHR 196

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PN +FW  LK G D FE    E  + + + +YVF  G
Sbjct: 197 QDPNIAFWRNLKEGSDRFEVTGAEQGVGVADGRYVFDAG 235


>gi|240139176|ref|YP_002963651.1| hypothetical protein MexAM1_META1p2599 [Methylobacterium extorquens
           AM1]
 gi|240009148|gb|ACS40374.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 356

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 92/219 (42%), Positives = 134/219 (61%), Gaps = 2/219 (0%)

Query: 19  CHHSR-SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           C   + +   +   P+    +  M  K  S   P ++R +K E+ +E+WKR  D  Y LL
Sbjct: 18  CQDGQYAASTRHLAPIPPATLALMSTKGVSAADPILMRAYKKESEIELWKRGADGRYALL 77

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           K Y +C WSG  GPK   GD QAPEGFY +   +LNPNS  +LS ++G+PNE+D++  RT
Sbjct: 78  KTYPMCRWSGQLGPKTREGDRQAPEGFYAVTPASLNPNSSLYLSFDLGYPNEYDRSLGRT 137

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           GA LM+HG C+S GC+AM ++ + E+YA+VR++  G  Q  +Q Q++PFRMT +N+  ++
Sbjct: 138 GAHLMVHGSCSSRGCFAMTDEAISELYAVVREAFAG-GQRAVQFQSYPFRMTPENLARHR 196

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PN +FW  LK G D FE    EP +     +YVF  G
Sbjct: 197 QDPNVAFWRNLKEGSDRFEVTWAEPVVGAAGGRYVFDAG 235


>gi|150376335|ref|YP_001312931.1| hypothetical protein Smed_4193 [Sinorhizobium medicae WSM419]
 gi|150030882|gb|ABR62998.1| protein of unknown function DUF949 [Sinorhizobium medicae WSM419]
          Length = 364

 Score =  308 bits (790), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 102/235 (43%), Positives = 147/235 (62%), Gaps = 2/235 (0%)

Query: 2   TNRYNILLFALFIFLNGCHHSRSL-IDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
                 L  +   FL+GC       + KA   LS+ ++  M KK+ SP  P ++RIFK E
Sbjct: 32  RMAKIGLALSAAAFLSGCLAMGLYDLSKAPPQLSKKVLAEMAKKKMSPNSPVLVRIFKKE 91

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           + LE+WK +    Y L K Y +C WSG  GPK + GD QAPEGFY++    LNPNS+Y++
Sbjct: 92  SELEVWKADASGTYALFKTYPMCRWSGKLGPKKKDGDRQAPEGFYHVSARMLNPNSQYYV 151

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           S N+G+PN  + A   TG  LM+HG C+SAGCYAM ++ + EIYAIV+ +L    Q H Q
Sbjct: 152 SFNLGYPNRLESALGYTGEALMVHGACSSAGCYAMTDRGVGEIYAIVQRAL-AAGQKHFQ 210

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           +QA+PFRMT++NM L++ +P+ +FW  LK G+D F  + ++P + +   +YVF  
Sbjct: 211 VQAYPFRMTTENMALHKGDPSMAFWKTLKQGYDAFAFSRRQPKVSVCGGRYVFNT 265


>gi|298291546|ref|YP_003693485.1| hypothetical protein Snov_1557 [Starkeya novella DSM 506]
 gi|296928057|gb|ADH88866.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 339

 Score =  308 bits (789), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 132/219 (60%), Gaps = 2/219 (0%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           GC  S    D+A+ P+   L+  M  K  SP  P ++RI+K E+ LEIWKR+    Y LL
Sbjct: 18  GCIGSD-YDDRADVPIPPKLMQQMAAKGMSPADPIMVRIYKRESELEIWKRDRSGRYALL 76

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
           K Y +C WSG  GPK   GD QAPEGFY +    +NP S+++L+ N+G+PN+ ++A   +
Sbjct: 77  KTYPMCRWSGRLGPKTREGDRQAPEGFYAVTPGLMNPRSQFYLAFNLGYPNQLEEALGYS 136

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           G+ LM+HG C SAGCYAM N  + E+YA+ R++L    Q   Q+QA PFRMT  N   ++
Sbjct: 137 GSALMVHGACTSAGCYAMTNDGIAEVYAVAREAL-AAGQPSFQVQALPFRMTPANFAEHR 195

Query: 198 NNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           ++PN +FW  LK G D F    Q P +     +Y F  G
Sbjct: 196 DDPNMAFWRNLKEGTDLFAVTRQPPNVAACGGRYRFTPG 234


>gi|312114367|ref|YP_004011963.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219496|gb|ADP70864.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 453

 Score =  307 bits (786), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 94/236 (39%), Positives = 135/236 (57%), Gaps = 9/236 (3%)

Query: 6   NILLFALFIFLNGC-------HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
              +  L + L GC         + + +  AE  L  +    +  K      P  IRIFK
Sbjct: 7   FASVAPLLLGLTGCLNLFGFGGDAENAVPPAERQLPASTQAMLAIKGMRTDAPIFIRIFK 66

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            E+ LE+WK   D  +   + Y ICAWSGT GPKI+TGD Q+PEGFY +    +NP S Y
Sbjct: 67  EESELEVWKLK-DGRFQHFRTYPICAWSGTLGPKIQTGDRQSPEGFYTVTRGQMNPRSNY 125

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
           +L+ NIG+PN  D+ +  TG+ LM+HG C S GCYAM +  ++EIY + R++     Q+ 
Sbjct: 126 YLAFNIGYPNVHDQVNGHTGSALMVHGNCKSVGCYAMTDAYIEEIYILAREAFDA-GQTK 184

Query: 179 IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
             +QA PFRMT+ NM  +++NP Y+FW  LK G+D FE + + P +++  KQY   
Sbjct: 185 FHVQALPFRMTAANMAKHRDNPWYAFWARLKEGYDSFEASGKPPIVKVCGKQYQVN 240


>gi|163853853|ref|YP_001641896.1| hypothetical protein Mext_4457 [Methylobacterium extorquens PA1]
 gi|163665458|gb|ABY32825.1| protein of unknown function DUF949 [Methylobacterium extorquens
           PA1]
          Length = 396

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 93/234 (39%), Positives = 140/234 (59%), Gaps = 2/234 (0%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           R  I        L    ++ +  DKA  P+    +  M  + T+   P V+R +K E+ +
Sbjct: 6   RTLIPGLVGLAILTA-SNTLARADKANAPIPAATLALMAARGTNAASPIVLRAYKKESEI 64

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
           E+WKRN    YV +K Y IC WSG  GPK ++GD Q PEGFY +  + +NPNS+Y+LS +
Sbjct: 65  EVWKRNASGRYVPIKTYPICRWSGQLGPKTKSGDRQTPEGFYTVAKSQMNPNSRYYLSFD 124

Query: 124 IGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
           +G+PN +D+AH  TG+ +M+HG C+S GC+AM +    E++AI R++  G  Q   Q Q+
Sbjct: 125 VGYPNAYDRAHGSTGSAVMVHGVCSSMGCFAMTDAVAGELFAIAREAFAG-GQGAFQFQS 183

Query: 184 FPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FPFRMT+ NM  ++ +PN +FW  LK G D FE   +EP + ++  +Y F   +
Sbjct: 184 FPFRMTAANMARHRTDPNIAFWRQLKEGSDRFEATGEEPAVSVVGGRYTFAPSR 237


>gi|218532798|ref|YP_002423614.1| hypothetical protein Mchl_4921 [Methylobacterium chloromethanicum
           CM4]
 gi|218525101|gb|ACK85686.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 406

 Score =  306 bits (785), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 93/234 (39%), Positives = 140/234 (59%), Gaps = 2/234 (0%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           R  I        L    ++ +  DKA  P+    +  M  + T+   P V+R +K E+ +
Sbjct: 16  RTLIPGLVGLAILTA-SNTLARADKANAPIPAATLALMAARGTNAASPIVLRAYKKESEI 74

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
           E+WKRN    YV +K Y IC WSG  GPK ++GD Q PEGFY +  + +NPNS+Y+LS +
Sbjct: 75  EVWKRNASGRYVPIKTYPICRWSGQLGPKTKSGDRQTPEGFYTVAKSQMNPNSRYYLSFD 134

Query: 124 IGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
           +G+PN +D+AH  TG+ +M+HG C+S GC+AM +    E++AI R++  G  Q   Q Q+
Sbjct: 135 VGYPNAYDRAHGSTGSAVMVHGVCSSMGCFAMTDAVAGELFAIAREAFAG-GQVAFQFQS 193

Query: 184 FPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FPFRMT+ NM  ++ +PN +FW  LK G D FE   +EP + + + +Y F   +
Sbjct: 194 FPFRMTAANMARHRTDPNIAFWRQLKEGSDRFEATGEEPAVSVTSGRYTFAPSR 247


>gi|121602349|ref|YP_988380.1| putative lipoprotein [Bartonella bacilliformis KC583]
 gi|120614526|gb|ABM45127.1| putative lipoprotein [Bartonella bacilliformis KC583]
          Length = 247

 Score =  305 bits (781), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 110/238 (46%), Positives = 148/238 (62%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFI-FLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M NR  ++   L    L  C    +   K+E PL +N++  M K     + P ++R FK 
Sbjct: 2   MLNRCFLVFLLLVTGILAACQGKFARHHKSEQPLPKNILNKMAKFNIDQYAPIMMRFFKE 61

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           ENI EIWK+N +  +VL+  Y IC WSG  GPK   GD QAPEGFY +  N +NP S Y+
Sbjct: 62  ENIAEIWKQNREGRFVLITHYSICKWSGKLGPKYREGDYQAPEGFYMVRPNQMNPRSNYY 121

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           LS NIGFPN +D+ + RTG+ LM+HG CASAGCY+MN+K M +IYA  RD+ RG  Q   
Sbjct: 122 LSFNIGFPNLYDQVNGRTGSYLMVHGGCASAGCYSMNDKNMAQIYAFARDAFRG-GQRGF 180

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            + AFPF MT  NM  ++ +P+Y FW MLK G+D+FEK  + P I++  K+Y+F    
Sbjct: 181 SLHAFPFHMTDANMARHRASPHYPFWKMLKEGYDFFEKYRKLPVIEVYEKRYIFRHPT 238


>gi|300024883|ref|YP_003757494.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526704|gb|ADJ25173.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 326

 Score =  304 bits (780), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 136/238 (57%), Gaps = 3/238 (1%)

Query: 4   RYNILLFALFIF--LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
           R N L   LF+   L   H +R+    A  PL      ++  K   P  P  IR+FK E+
Sbjct: 3   RANWLAAVLFLLGTLPALHAARAEEQAAAKPLPATTEAALLMKEIVPEAPVYIRVFKEES 62

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            LE+WK   +  Y L+K + IC W GT GPK   GD  +PEGFY      + P+SKY L+
Sbjct: 63  ELEVWKARPNGRYALVKTFPICNWGGTLGPKQTQGDRMSPEGFYAATPGGMKPDSKYHLA 122

Query: 122 INIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
            NIG+PN  D+A  RTGA +M+HG+C S GC+AM++K ++EIYA VRD+L    +  + +
Sbjct: 123 FNIGYPNALDRALGRTGAYIMVHGDCRSVGCFAMSDKLIEEIYAFVRDAL-AAGEPSVPV 181

Query: 182 QAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
             FPFRMT+ N++ + +NP  + W  LK  +D F +  + P + + +K+YV      +
Sbjct: 182 HVFPFRMTASNIKRHADNPARTTWAPLKQAYDDFAETREPPKVGMCSKRYVVNSLTPV 239


>gi|188584157|ref|YP_001927602.1| hypothetical protein Mpop_4971 [Methylobacterium populi BJ001]
 gi|179347655|gb|ACB83067.1| protein of unknown function DUF949 [Methylobacterium populi BJ001]
          Length = 400

 Score =  304 bits (780), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 94/231 (40%), Positives = 141/231 (61%), Gaps = 1/231 (0%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +L   +  + +    S +L DKA  P+    +  M  + T    P V+R +K E+ +E+W
Sbjct: 12  LLGGLIAAWTSMAWTSAALADKASAPIPAATLALMAARGTHAASPIVLRAYKKESEIEVW 71

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           KRN    YV +K Y IC WSG  GPK ++GD Q PEGFY +  + +NPNS+Y+LS +IG+
Sbjct: 72  KRNAAGRYVPIKTYPICRWSGQLGPKTKSGDRQTPEGFYTVAKSQMNPNSRYYLSFDIGY 131

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN +D+AH  TG+ +M+HG C+S GC+AM +    E+++I R++  G  QS  Q Q+FPF
Sbjct: 132 PNAYDRAHGSTGSAVMVHGICSSMGCFAMTDAVAGELFSIAREAFAG-GQSAFQFQSFPF 190

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           RMT+ NM  ++ +PN +FW  LK G D FE   +EP + +   +Y F   +
Sbjct: 191 RMTAANMARHRTDPNIAFWRQLKEGSDRFEATGEEPVVSVAGGRYAFAPSR 241


>gi|323137197|ref|ZP_08072276.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocystis sp. ATCC 49242]
 gi|322397555|gb|EFY00078.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocystis sp. ATCC 49242]
          Length = 407

 Score =  304 bits (779), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 1/217 (0%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
                  ++  P+    +  M+K  T+   P +IR +K E  LEIWK   D  YV LK +
Sbjct: 24  EDGGFSHRSLAPIPPETVALMEKVGTTKEAPMLIRAYKKEAELEIWKMRSDGRYVHLKTF 83

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGAD 140
            +C WSG  GPK   GD Q PEGFY I    +NPNS Y+LS N+G+PN+ D+A   +G  
Sbjct: 84  PMCRWSGQLGPKTREGDRQVPEGFYSITPAQMNPNSAYYLSFNVGYPNQLDRALGHSGGT 143

Query: 141 LMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNP 200
           +M+HG C+SAGC++M +KQ+ EIYAI R S  G  Q  IQ+Q++PF+MT++N+  ++ +P
Sbjct: 144 IMVHGACSSAGCFSMTDKQIAEIYAIARSSF-GGGQRAIQMQSYPFKMTAENLAKHRLDP 202

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           N  FW  LK G+D+FE   +EP +    + YVF    
Sbjct: 203 NIGFWKNLKEGNDHFEVTKEEPQVAFCGRHYVFNATP 239


>gi|296445739|ref|ZP_06887692.1| ErfK/YbiS/YcfS/YnhG family protein [Methylosinus trichosporium
           OB3b]
 gi|296256719|gb|EFH03793.1| ErfK/YbiS/YcfS/YnhG family protein [Methylosinus trichosporium
           OB3b]
          Length = 500

 Score =  304 bits (778), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 92/220 (41%), Positives = 137/220 (62%), Gaps = 2/220 (0%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
           C+ S  L  ++  P+    +  M++   +   PT+IR +K E+  +IWK+  D  YV LK
Sbjct: 26  CNDSG-LSQRSLQPIPPETLALMEQAGVTKESPTLIRSYKKESEFQIWKQRPDGRYVYLK 84

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG 138
            + +C WSG  GPK+  GD QAPEGFY I    +NPNS Y+LS N+G+PN +D+A    G
Sbjct: 85  TFPMCRWSGQLGPKVREGDRQAPEGFYSITPGQMNPNSSYYLSFNVGYPNAYDRALGHGG 144

Query: 139 ADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQN 198
             +M+HG C+SAGC++M + Q+ EIYAI+R S   N Q  IQ+Q++PF+MT++N+  ++ 
Sbjct: 145 GSIMVHGACSSAGCFSMTDHQISEIYAILRTSFN-NGQRAIQMQSYPFKMTAENLAKHRL 203

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           +P+  FW  LK G D+FE   +EP + +    YVF    T
Sbjct: 204 DPHIGFWKQLKNGSDHFETAWREPTVGVCGHHYVFDAAPT 243


>gi|240141307|ref|YP_002965787.1| hypothetical protein MexAM1_META1p4901 [Methylobacterium extorquens
           AM1]
 gi|240011284|gb|ACS42510.1| conserved hypothetical protein DUF949 [Methylobacterium extorquens
           AM1]
          Length = 382

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 90/219 (41%), Positives = 136/219 (62%), Gaps = 1/219 (0%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
             ++ +  DKA  P+    +  M  + T+   P V+R +K E+ +E+WKRN    YV +K
Sbjct: 6   ASNTLARADKANAPIPAATLALMAARGTNAASPIVLRAYKKESEIEVWKRNASGRYVPIK 65

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG 138
            Y IC WSG  GPK ++GD Q PEGFY +  + +NPNS+Y+LS ++G+PN +D+AH  TG
Sbjct: 66  TYPICRWSGQLGPKTKSGDRQTPEGFYTVAKSQMNPNSRYYLSFDVGYPNAYDRAHGSTG 125

Query: 139 ADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQN 198
           + +M+HG C+S GC+AM +    E++AI R++  G  Q   Q Q+FPFRMT+ NM  ++ 
Sbjct: 126 SAVMVHGVCSSMGCFAMTDAVAGELFAIAREAFAG-GQGAFQFQSFPFRMTAANMARHRT 184

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +PN +FW  LK G D FE   +EP + +   +Y F   +
Sbjct: 185 DPNIAFWRQLKEGSDRFEATGEEPAVSVAGGRYTFAPSR 223


>gi|159185697|ref|NP_357274.2| hypothetical protein Atu3332 [Agrobacterium tumefaciens str. C58]
 gi|159140831|gb|AAK90059.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 328

 Score =  303 bits (776), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 101/229 (44%), Positives = 146/229 (63%), Gaps = 2/229 (0%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEHP-LSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
            + A+   L  C        K + P LS  ++  M  K   P  P ++RIFK E+ LE+W
Sbjct: 3   AVVAIGGSLVACTSMGLDSVKKDPPKLSSKMMAQMSAKSMRPESPVLVRIFKQESELEVW 62

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           K +    Y LLK Y +C WSG  GPK++TGD QAPEGFY++    LNPNS+Y++S N+G+
Sbjct: 63  KVDKTGNYALLKAYPMCRWSGKLGPKMKTGDRQAPEGFYHVSAGMLNPNSQYYVSFNLGY 122

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN  + A   TG  LM+HG C+S+GCYAM ++Q+ EIYAIV  +L+G  Q   Q+QA+PF
Sbjct: 123 PNRLESALGYTGEALMVHGACSSSGCYAMTDQQVGEIYAIVARALQG-GQDRFQVQAYPF 181

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           RM+++NM  ++++PN  FW  LK G+DYFE   ++P + +  ++YVF  
Sbjct: 182 RMSARNMVAHRDDPNMPFWKTLKEGYDYFEVTRRQPKVSVCGRRYVFNS 230


>gi|332716121|ref|YP_004443587.1| hypothetical protein AGROH133_11230 [Agrobacterium sp. H13-3]
 gi|325062806|gb|ADY66496.1| hypothetical protein AGROH133_11230 [Agrobacterium sp. H13-3]
          Length = 351

 Score =  302 bits (775), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 100/231 (43%), Positives = 144/231 (62%), Gaps = 2/231 (0%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHP-LSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
              + A+   L  C        K + P LS  ++  M  K   P  P ++RIFK E+ LE
Sbjct: 24  IAAVVAIGSGLAACTSMGLDSVKKDPPKLSSKMMAQMSAKSMRPESPVLVRIFKQESELE 83

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +WK +    Y LLK Y +C WSG  GPK +TGD QAPEGFY++    LNPNS+Y++S N+
Sbjct: 84  VWKIDKTGNYALLKTYPMCRWSGKLGPKTKTGDRQAPEGFYHVSAGMLNPNSQYYVSFNL 143

Query: 125 GFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           G+PN  + A   TG  LM+HG C+S+GCYAM ++Q+ EIYA+V  +L+G  Q   Q+QA+
Sbjct: 144 GYPNRLESALGYTGEALMVHGACSSSGCYAMTDQQVGEIYAVVARALQG-GQDRFQVQAY 202

Query: 185 PFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           PFRM+++NM   +++PN  FW  LK G+DYFE   ++P + +  ++YVF  
Sbjct: 203 PFRMSARNMVANRDDPNMPFWKTLKEGYDYFEVTRRQPKVSVCGRRYVFNS 253


>gi|220925727|ref|YP_002501029.1| hypothetical protein Mnod_5898 [Methylobacterium nodulans ORS 2060]
 gi|219950334|gb|ACL60726.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 378

 Score =  302 bits (774), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 92/211 (43%), Positives = 137/211 (64%), Gaps = 1/211 (0%)

Query: 27  DKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWS 86
            K   PL    +  M  + T+P  P ++R +K E+ +E+WKR  D  +VLLK + IC WS
Sbjct: 33  PKHLLPLPATTLALMTARNTTPGAPILMRAYKKESEIEVWKRAADGRFVLLKSFPICRWS 92

Query: 87  GTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE 146
           G  GPK++ GD QAPEGFY +    +NPNS+Y+LS ++G+PN +D+AH  TG+ LM+HG 
Sbjct: 93  GQLGPKLKAGDRQAPEGFYTVRPQQMNPNSRYYLSFDVGYPNAYDRAHGGTGSALMVHGT 152

Query: 147 CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWN 206
           C+SAGC+AM ++Q+ EI+A+ R++  G  Q+  Q QAFPFRM ++N+  ++ +PN +FW 
Sbjct: 153 CSSAGCFAMTDRQVGEIFALAREAFAG-GQAAFQFQAFPFRMNAENLARHRQDPNIAFWR 211

Query: 207 MLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            LK G D FE   +EP + +   +Y F    
Sbjct: 212 QLKEGSDRFEATGREPLVSVAAGRYGFAPYP 242


>gi|254563816|ref|YP_003070911.1| hypothetical protein METDI5493 [Methylobacterium extorquens DM4]
 gi|254271094|emb|CAX27101.1| conserved hypothetical protein DUF949 [Methylobacterium extorquens
           DM4]
          Length = 381

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 90/219 (41%), Positives = 137/219 (62%), Gaps = 1/219 (0%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
             ++ +  DKA  P+    +  M  + T+   P V+R +K E+ +E+WKRN    YV +K
Sbjct: 6   ASNTLARADKANAPIPAATLALMTARGTNAASPIVLRAYKKESEIEVWKRNAAGRYVPIK 65

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG 138
            Y IC WSG  GPK ++GD Q PEGFY +  + +NPNS+Y+LS ++G+PN +D+AH  TG
Sbjct: 66  TYPICRWSGQLGPKTKSGDRQTPEGFYTVAKSQMNPNSRYYLSFDVGYPNAYDRAHGSTG 125

Query: 139 ADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQN 198
           + +M+HG C+S GC+AM +    E++AI R++  G  Q   Q Q+FPFRMT+ NM  ++ 
Sbjct: 126 SAVMVHGVCSSMGCFAMTDAVAGELFAIAREAFAG-GQGAFQFQSFPFRMTAANMARHRT 184

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +PN +FW  LK G D FE   +EP + + + +Y F   +
Sbjct: 185 DPNIAFWRQLKEGSDRFEATGEEPAVSVTSGRYTFAPSR 223


>gi|319409434|emb|CBI83083.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 249

 Score =  301 bits (771), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 102/235 (43%), Positives = 141/235 (60%), Gaps = 4/235 (1%)

Query: 4   RYNILLFALFI-FLNGCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           RY +  F L +  L  C      S+  K + PL + +   M +    P+ P ++R FK E
Sbjct: 5   RYFLSFFLLAVGILAACQERLPASIQAKVKQPLPKEIQHKMVEYNVDPYAPIMMRFFKEE 64

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           N  E+WK++    +VL+  Y IC WSG  GPK + GD Q PEGFY +  + +NP S+ +L
Sbjct: 65  NTAEVWKQDRTGRFVLVASYDICKWSGQLGPKYKEGDYQTPEGFYTVNASQMNPYSRRYL 124

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           S NIGFPN +D+AH RTG+ LM+HG C S GCYAM +  M +IYA  RD+ +G  Q   Q
Sbjct: 125 SFNIGFPNLYDQAHGRTGSYLMVHGGCTSVGCYAMTDNNMGQIYAFARDAFKG-GQKEFQ 183

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           +  FPFRMT  NM+ +++NP+Y FW MLK G+D FE       I +  K+YVF +
Sbjct: 184 LHTFPFRMTDANMERHRDNPHYPFWMMLKEGYDLFEAKRAPSKIDVYEKRYVFDR 238


>gi|90020858|ref|YP_526685.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Saccharophagus degradans
           2-40]
 gi|89950458|gb|ABD80473.1| protein of unknown function DUF949 [Saccharophagus degradans 2-40]
          Length = 238

 Score =  300 bits (769), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 94/230 (40%), Positives = 136/230 (59%), Gaps = 1/230 (0%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +LLF+  I  N    + +    A + +   LI ++ +K      P  IRIFK    LE+W
Sbjct: 10  LLLFSCAIAANNQLPTSARSIAAINKVEPALIKALSEKGLRYGAPIFIRIFKQSATLEVW 69

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
            +     + L K Y ICA SG  GPK+ +GD QAPEGFY++     NP SK+ LS N+G+
Sbjct: 70  LQAESGRFELFKAYDICAQSGRLGPKLRSGDRQAPEGFYFVNAQRFNPWSKFHLSFNLGY 129

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN +D+AH RTG+ LM+HG+C S GCYAM +  ++EIYA+ + SL    Q   ++  FPF
Sbjct: 130 PNAYDRAHGRTGSALMVHGDCVSIGCYAMTDSGIEEIYALAQKSLED-GQPFFRVHIFPF 188

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           R++ + ++  +NN  Y+FW  LK G DYFE+    P + + NK+YVF   
Sbjct: 189 RLSDEALERVKNNRWYTFWLNLKQGFDYFEQTKMPPNVNVQNKRYVFSAP 238


>gi|217979292|ref|YP_002363439.1| protein of unknown function DUF949 [Methylocella silvestris BL2]
 gi|217504668|gb|ACK52077.1| protein of unknown function DUF949 [Methylocella silvestris BL2]
          Length = 415

 Score =  300 bits (768), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 98/212 (46%), Positives = 140/212 (66%), Gaps = 1/212 (0%)

Query: 25  LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA 84
              K+E P+    +  M+ + T+P  P ++R FK E+ +E+WKRN    YV LK + IC 
Sbjct: 43  ASPKSEQPIPAATLALMEARDTTPDAPILMRAFKKESEIEVWKRNRSGRYVFLKSFPICR 102

Query: 85  WSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
           WSG  GPK+  GD Q+PEGFY +G   +NPNS Y+LS + GFPN +DKAH  +G+ LM+H
Sbjct: 103 WSGKLGPKVAQGDRQSPEGFYSVGPRQMNPNSAYYLSFDTGFPNAYDKAHGASGSALMVH 162

Query: 145 GECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           G C+SAGCYAM +K + EI+A+ R++LRG  Q+  Q QA+PF+MT++N+  Y+ +PN  F
Sbjct: 163 GTCSSAGCYAMTDKGVAEIFALAREALRG-GQNAFQFQAYPFKMTAQNLARYRADPNIGF 221

Query: 205 WNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           W  LK G D FE   +E  + ++N +YVF   
Sbjct: 222 WRQLKEGFDRFEATGEELGVGVVNGRYVFAPS 253


>gi|218662493|ref|ZP_03518423.1| hypothetical protein RetlI_25155 [Rhizobium etli IE4771]
          Length = 214

 Score =  297 bits (762), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 104/198 (52%), Positives = 140/198 (70%), Gaps = 1/198 (0%)

Query: 41  MQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQA 100
           M  K      P +IRIFK E  +EIWK   D  +  + +YKICAWSG  GPK++TGD QA
Sbjct: 1   MSAKGMDRNSPIMIRIFKEEGAMEIWKAKTDNRFDKIADYKICAWSGRLGPKVKTGDRQA 60

Query: 101 PEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQM 160
           PEGFY +   NLNPNSKY+L+IN GFPN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+
Sbjct: 61  PEGFYDLTRANLNPNSKYYLAINTGFPNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQV 120

Query: 161 QEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQ 220
            EIYA  RD+ +G  Q+ +Q+QAFPFRMT++NM  ++ + NY FW MLK+G+D FE   +
Sbjct: 121 LEIYAFARDAFKG-GQATVQLQAFPFRMTAENMVKHRLDSNYEFWKMLKVGYDNFEVTKR 179

Query: 221 EPFIQIINKQYVFFKGQT 238
            P + +  K+YVF +  T
Sbjct: 180 PPEVNVCEKKYVFNQQAT 197


>gi|170743408|ref|YP_001772063.1| hypothetical protein M446_5308 [Methylobacterium sp. 4-46]
 gi|168197682|gb|ACA19629.1| protein of unknown function DUF949 [Methylobacterium sp. 4-46]
          Length = 415

 Score =  297 bits (761), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 89/217 (41%), Positives = 132/217 (60%), Gaps = 1/217 (0%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
            ++ L  K   P+    +  M  + T+P  P ++R FK E  +E+W R  D  +  LK +
Sbjct: 34  PAKHLSAKHLAPIPGPTLALMAARGTAPGAPILMRAFKKEAEIEVWTRGADGRFAHLKTF 93

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGAD 140
            IC WSG  GPK  +GD QAPEGFY I    +NPNS+Y+LS ++G+PN +D+AH  TG+ 
Sbjct: 94  PICRWSGQLGPKRRSGDRQAPEGFYSIRPAQMNPNSRYYLSFDVGYPNAYDRAHGGTGSA 153

Query: 141 LMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNP 200
           LM+HG C+SAGC+AM + Q+ EI+A+ R++  G  Q+  Q QA+PFRM++  +  ++ +P
Sbjct: 154 LMVHGTCSSAGCFAMTDAQVSEIFALAREAFAG-GQAAFQFQAYPFRMSAAALARHRLDP 212

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           N  FW  LK G D FE   +EP + +   +Y F    
Sbjct: 213 NIDFWRQLKEGADRFEATGREPLVTVAGGRYAFAPYP 249


>gi|254500008|ref|ZP_05112161.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222441475|gb|EEE48152.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 345

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 3/237 (1%)

Query: 3   NRYNILLFALF-IFLNGC-HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R   +   +F + L GC   S  +  + E  +   +   M+ K      P  IRIFK E
Sbjct: 13  RRVLSVSMTIFTLLLAGCVGSSLEMESRGEIAIPYKVTALMRNKGVKGSDPVFIRIFKQE 72

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           + LE+WK+    +YVLLK Y++C WSG  GPK   GD QAPEG Y +    LNPNSKYFL
Sbjct: 73  SELEVWKKRRAGDYVLLKTYEMCRWSGDLGPKRAEGDRQAPEGIYEVTLGRLNPNSKYFL 132

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           S ++G+PN+ ++A   +G  LM+HG C+S+GC+A+ ++Q+ E+YA+VRD+LR   Q  +Q
Sbjct: 133 SFDLGYPNKLERAKGYSGTALMVHGACSSSGCFAITDEQITEVYALVRDALRA-GQPSVQ 191

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +Q+ PFRMT +N+  + +NPN SFW  LK     FE   + P  +    +Y F   +
Sbjct: 192 VQSLPFRMTPENLARHYDNPNLSFWLDLKEASTTFEVLRRPPEFRFCEGRYRFGAAK 248


>gi|13473087|ref|NP_104654.1| hypothetical protein mlr3577 [Mesorhizobium loti MAFF303099]
 gi|14023835|dbj|BAB50440.1| mlr3577 [Mesorhizobium loti MAFF303099]
          Length = 395

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 93/190 (48%), Positives = 126/190 (66%), Gaps = 1/190 (0%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  + RIFK E  LEIWK   +  Y ++  Y IC WSG  GPK   GD QAPEGFY
Sbjct: 1   MVRTSSVMARIFKEEGKLEIWKAKTNGRYDMVASYDICKWSGKLGPKYTEGDRQAPEGFY 60

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYA 165
            +  + +NP S Y LS NIGFPN +D+A+ RTG +LM+HG C+S+GCY+M + Q+++IYA
Sbjct: 61  TVRPSQMNPRSNYHLSFNIGFPNAYDRANGRTGQNLMVHGACSSSGCYSMTDAQIEQIYA 120

Query: 166 IVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQ 225
             RD+ +G  Q+  Q++AFPFRMT+ NM  Y+N+PNY FW MLK+G+D FE     P + 
Sbjct: 121 FGRDAFQG-GQTEFQVEAFPFRMTAANMARYRNDPNYEFWKMLKVGYDNFEVTKVPPKVD 179

Query: 226 IINKQYVFFK 235
           +  K+YVF +
Sbjct: 180 VCEKRYVFNQ 189


>gi|319899485|ref|YP_004159582.1| hypothetical protein BARCL_1352 [Bartonella clarridgeiae 73]
 gi|319403453|emb|CBI77024.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 231

 Score =  294 bits (754), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 107/219 (48%), Positives = 138/219 (63%), Gaps = 3/219 (1%)

Query: 18  GCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
            C      S   K E PL + +   M       + P ++R FK ENI EIWK+N    +V
Sbjct: 2   ACQERLPTSFRAKIEQPLPQEVFNKMAMYDIDQYAPIMMRFFKEENIAEIWKQNRSGVFV 61

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           L+  Y IC WSG  GPK   GD QAPEGFY I  N +NP SKY+LS NIGFPN +D+ H 
Sbjct: 62  LVISYNICKWSGQLGPKYREGDFQAPEGFYTIQANQMNPYSKYYLSFNIGFPNLYDRIHG 121

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           RTG+ +M+HG C+S GCY+MN++ M +IYA  RD+ RG  Q   Q+ AFPFRMT  NMQ 
Sbjct: 122 RTGSYIMVHGACSSVGCYSMNDRNMAQIYAFARDAFRG-GQKEFQLHAFPFRMTDANMQR 180

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  NP+Y FW MLK G+D+FE N + P I + +K+Y+F 
Sbjct: 181 HHANPHYKFWKMLKEGYDFFEINRKPPRISVYDKRYIFD 219


>gi|254470197|ref|ZP_05083601.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudovibrio sp. JE062]
 gi|211960508|gb|EEA95704.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Pseudovibrio sp. JE062]
          Length = 247

 Score =  294 bits (754), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 87/228 (38%), Positives = 129/228 (56%), Gaps = 2/228 (0%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           + +FA ++ L       + + K +      L   +  K      P  +R+FK E+ LE W
Sbjct: 21  LAVFATYLLLPYDLPGSANLTKVKEERLPALRADLTFKGMELGSPVFLRVFKEESRLEAW 80

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
            R+    Y   K ++IC +SG  GPK++ GD Q+PEGFY +    LNPNS+Y LS N+GF
Sbjct: 81  IRS-GETYHPYKSWEICKYSGDLGPKLKEGDGQSPEGFYNVSARQLNPNSQYHLSFNLGF 139

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN FD++  RTG+ LM+HG C S GCYAM N+ ++EIY +V  +L+   Q  + +  FPF
Sbjct: 140 PNTFDQSMGRTGSYLMVHGNCLSIGCYAMTNQHIEEIYLLVEAALQS-GQGTVPVHIFPF 198

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
            MT +N+  + ++  + FW  LK G+D FE+N   P +     QY F 
Sbjct: 199 EMTEENLSKHSSSKWHPFWRNLKQGYDLFEQNRIPPAVSAQEGQYQFT 246


>gi|294635173|ref|ZP_06713681.1| conserved hypothetical protein [Edwardsiella tarda ATCC 23685]
 gi|291091435|gb|EFE23996.1| conserved hypothetical protein [Edwardsiella tarda ATCC 23685]
          Length = 240

 Score =  293 bits (750), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 129/238 (54%), Gaps = 12/238 (5%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M+    +L   L + L  C  S S           +L+            P  I+IFK E
Sbjct: 1   MSKIVTLLAICLALPLAACKSSASESGSVPRSGVNSLL----------GSPVYIQIFKEE 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++ +  +  Y L+K + IC +SG  GPK   GD ++PEGFY I   +L P+S+Y+ 
Sbjct: 51  RQLELYAKVQNG-YQLVKRFPICKFSGGLGPKRTEGDFKSPEGFYQIDARHLKPDSRYYQ 109

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIG+PN +D+AH  +G  LMIHG+C S GCYAM N  + EIY  V+ + R N Q  + 
Sbjct: 110 AINIGYPNPYDQAHGYSGKYLMIHGDCVSVGCYAMTNAGISEIYRYVQSAFR-NGQMLVD 168

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           I  +PF MT +NMQ ++N+   +FW  L+ G+ YF ++   P + + + +YV      
Sbjct: 169 INIYPFHMTERNMQRHRNSSYINFWRELQPGYQYFAQHALPPQVNVQDGRYVVNAPLP 226


>gi|159185833|ref|NP_356981.2| hypothetical protein Atu3631 [Agrobacterium tumefaciens str. C58]
 gi|159140967|gb|AAK89766.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 379

 Score =  292 bits (748), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 94/190 (49%), Positives = 129/190 (67%), Gaps = 1/190 (0%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                P +IRIFK E  LEIWK   D  +  +  Y+ICAWSG  GPK++ GD QAPEGFY
Sbjct: 1   MDRNSPIMIRIFKEEGALEIWKARRDNRFEKIAGYEICAWSGKLGPKVKEGDRQAPEGFY 60

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYA 165
            +   +LNPNSKY+L+IN GFPN +D A+ R G +LMIHG C+S+GCY+M + Q+ EIY 
Sbjct: 61  NLTPAHLNPNSKYYLAINTGFPNRYDAANGRNGTNLMIHGACSSSGCYSMTDAQILEIYG 120

Query: 166 IVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQ 225
             RD+ +G  Q  +Q+QAFPFRMT++NM  ++ + +  FW MLK+G+D FE   + P + 
Sbjct: 121 FARDAFKG-GQKTVQLQAFPFRMTAENMARHRKSEHLEFWKMLKVGYDNFEVTKRPPDVN 179

Query: 226 IINKQYVFFK 235
           +  K+YVF +
Sbjct: 180 VCEKKYVFNQ 189


>gi|145600128|ref|YP_001164204.1| hypothetical protein YPDSF_2869 [Yersinia pestis Pestoides F]
 gi|145211824|gb|ABP41231.1| hypothetical protein YPDSF_2869 [Yersinia pestis Pestoides F]
          Length = 246

 Score =  291 bits (745), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 91/232 (39%), Positives = 133/232 (57%), Gaps = 10/232 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I    C  + S    A  P++    +S + K+        I+IFK E +LE+
Sbjct: 4   IALLFAMII----CLPAASFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERVLEL 55

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  EY L++ Y IC +SG  GPK   GD ++PEGFY I   +L P+S+++ +INIG
Sbjct: 56  YAK-LQGEYRLVQSYPICEFSGGLGPKRREGDFKSPEGFYRINTRHLKPDSQFYRAINIG 114

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +G  LMIHG C S GCYAM +  M EI+  VR +     Q  + I  +P
Sbjct: 115 FPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVRTAF-IFGQEKVDISIYP 173

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT +NMQ ++N+   +FW  L+ G+ YF KN   P + + N QYV     
Sbjct: 174 FRMTEQNMQRHRNSSYSNFWRQLQPGYTYFAKNRMPPPVSVSNGQYVLSPPP 225


>gi|51595236|ref|YP_069427.1| hypothetical protein YPTB0886 [Yersinia pseudotuberculosis IP
           32953]
 gi|153950202|ref|YP_001402128.1| hypothetical protein YpsIP31758_3169 [Yersinia pseudotuberculosis
           IP 31758]
 gi|186894254|ref|YP_001871366.1| hypothetical protein YPTS_0928 [Yersinia pseudotuberculosis PB1/+]
 gi|51588518|emb|CAH20126.1| putative exported protein [Yersinia pseudotuberculosis IP 32953]
 gi|152961697|gb|ABS49158.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           31758]
 gi|186697280|gb|ACC87909.1| protein of unknown function DUF949 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 246

 Score =  291 bits (745), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 91/232 (39%), Positives = 133/232 (57%), Gaps = 10/232 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I    C  + S    A  P++    +S + K+        I+IFK E +LE+
Sbjct: 4   IALLFAMII----CLPAASFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERVLEL 55

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  EY L++ Y IC +SG  GPK   GD ++PEGFY I   +L P+S+++ +INIG
Sbjct: 56  YAK-LQGEYRLVQSYPICEFSGGLGPKRREGDFKSPEGFYSINTRHLKPDSQFYRAINIG 114

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +G  LMIHG C S GCYAM +  M EI+  VR +     Q  + I  +P
Sbjct: 115 FPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVRTAF-IFGQEKVDISIYP 173

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT +NMQ ++N+   +FW  L+ G+ YF KN   P + + N QYV     
Sbjct: 174 FRMTEQNMQRHRNSSYSNFWRQLQPGYTYFAKNRMPPPVSVSNGQYVLSPPP 225


>gi|269138138|ref|YP_003294838.1| hypothetical protein ETAE_0782 [Edwardsiella tarda EIB202]
 gi|267983798|gb|ACY83627.1| hypothetical protein ETAE_0782 [Edwardsiella tarda EIB202]
          Length = 240

 Score =  291 bits (744), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 129/238 (54%), Gaps = 12/238 (5%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     +L   L + L  C  S S    A      +L+               I+IFK E
Sbjct: 1   MGKIVAMLAICLALPLAACKSSASESGTAPRSGVNSLL----------GSQVYIQIFKEE 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++ +  D +Y L+K + IC +SG  GPK   GD ++PEGFY I   +L P+S+Y+ 
Sbjct: 51  RQLELYAKVQD-KYQLVKSFPICKFSGGLGPKRTEGDFKSPEGFYQIDARHLKPDSRYYQ 109

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIG+PN FD++H  +G  LMIHG+C S GCYAM N  + EIY  V+ + R   Q+ + 
Sbjct: 110 AINIGYPNSFDQSHGYSGKYLMIHGDCVSVGCYAMTNDGISEIYRYVQSAFR-RGQTLVN 168

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           I  +PFRMT KNMQ ++N+    FW  L+ G+ YF ++   P + + + +YV      
Sbjct: 169 INIYPFRMTDKNMQRHRNSSYIGFWRQLQPGYQYFAQHALPPQVNVQDGRYVVNGPLP 226


>gi|258544108|ref|ZP_05704342.1| lipoprotein [Cardiobacterium hominis ATCC 15826]
 gi|258520616|gb|EEV89475.1| lipoprotein [Cardiobacterium hominis ATCC 15826]
          Length = 453

 Score =  291 bits (744), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 92/208 (44%), Positives = 130/208 (62%), Gaps = 1/208 (0%)

Query: 31  HPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG 90
            P +  L   ++ +      P  IRIFK E +LE+W +    EY L  +Y IC +SG  G
Sbjct: 34  RPPNPTLQDRLEARGFRFGAPAFIRIFKKEEVLEVWLQKDSGEYALFLDYPICIYSGELG 93

Query: 91  PKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASA 150
           PK   GD+Q+PEGFY +G   +NPNS+Y LS N+G+PN +D+AH  +G+ LM+HG+C S 
Sbjct: 94  PKTREGDKQSPEGFYAVGREAMNPNSQYHLSFNLGYPNAYDRAHGYSGSMLMVHGKCVSI 153

Query: 151 GCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKL 210
           GCYAM ++Q++EIY +V  +L+   Q ++++ AFPFRMT  N+  Y  +  Y FW MLK 
Sbjct: 154 GCYAMGDRQIEEIYTLVGSALQ-RGQPYVRVHAFPFRMTDANLAAYSEHRWYDFWRMLKP 212

Query: 211 GHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           G+DYFE+ HQ P I +I  QY       
Sbjct: 213 GYDYFERYHQPPEIDVIGGQYALSGRNP 240


>gi|90419248|ref|ZP_01227158.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336185|gb|EAS49926.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 362

 Score =  291 bits (744), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 92/224 (41%), Positives = 132/224 (58%), Gaps = 3/224 (1%)

Query: 12  LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVD 71
             I L       S+ + A   L+   +   ++  T P    ++RIFK E+ LE+W++  D
Sbjct: 43  TAITLLSIGGCVSITEDAYTDLAPATLAVAER--TRPEGSILMRIFKEESELEVWRQGAD 100

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFD 131
             Y L K + +C WSG  GPK   GD QAPEGFY +  + +NPNSKY  S N+G+PN+ +
Sbjct: 101 GRYALHKTHPMCRWSGRLGPKTADGDRQAPEGFYQVTASLMNPNSKYHRSFNLGYPNQLE 160

Query: 132 KAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSK 191
           +A   TG  LM+HG C+SAGC+AM +  + E+YA  + + R   QS  Q+Q+FPFRMT++
Sbjct: 161 RALGYTGDSLMVHGACSSAGCFAMTDNGVAEVYAEAQSAFRI-GQSDFQVQSFPFRMTAE 219

Query: 192 NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            M  +Q +PN  FW  LKLG+D FE   +EP +     +YVF  
Sbjct: 220 QMAKHQGDPNIEFWRNLKLGYDVFEVTRREPTVAACGGRYVFDA 263


>gi|123443424|ref|YP_001007397.1| hypothetical protein YE3221 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090385|emb|CAL13253.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 249

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 94/231 (40%), Positives = 138/231 (59%), Gaps = 10/231 (4%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWK 67
           ++FA+ I    C  + S    A  P++    +S + K+        I+IFK E  LE++ 
Sbjct: 3   IMFAMII----CLPAVSFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERTLELYA 54

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP 127
           R +  EY L++ Y+IC +SG  GPK   GD ++PEGFY I   +L P+SK++ +INIGFP
Sbjct: 55  R-LQGEYRLVQSYRICEFSGGLGPKRREGDFKSPEGFYTIDMRHLKPDSKFYRAINIGFP 113

Query: 128 NEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFR 187
           N++DK+   +G  LMIHG C S GCYAM +  M EI+  V+ +     Q  + I  +PFR
Sbjct: 114 NDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVQTAF-IFGQEKVDISIYPFR 172

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           MT +NMQ ++N+ +YSFW  L+ G+ YF KN   P + +IN QYV  +  T
Sbjct: 173 MTEQNMQRHRNSSDYSFWRQLQPGYAYFAKNRMPPSVSVINGQYVLSRPPT 223


>gi|318604536|emb|CBY26034.1| putative exported protein STY0357 [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 257

 Score =  290 bits (742), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 92/234 (39%), Positives = 138/234 (58%), Gaps = 10/234 (4%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
           +  ++FA+ I L     + S  + A         +S + K+        I+IFK E  LE
Sbjct: 8   FVTIMFAMIICLPAVSFTSSASEPA--------AVSKELKQQLLGSSVYIQIFKEERTLE 59

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           ++ R +  EY L++ Y+IC +SG  GPK   GD ++PEGFY I   +L P+SK++ +INI
Sbjct: 60  LYAR-LQGEYRLVQSYRICEFSGGLGPKRREGDFKSPEGFYTIDMRHLKPDSKFYRAINI 118

Query: 125 GFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           GFPN++DK+   +G  LMIHG C S GCYAM +  M EI+  V+ +     Q  + I  +
Sbjct: 119 GFPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVQTAF-IFGQEKVDISIY 177

Query: 185 PFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           PFRMT +NMQ ++N+ +Y+FW  L+ G++YF KN   P + +IN QYV  +  T
Sbjct: 178 PFRMTEQNMQRHRNSSDYNFWRQLQPGYEYFAKNRIPPSVSVINGQYVLSRPPT 231


>gi|170025523|ref|YP_001722028.1| hypothetical protein YPK_3306 [Yersinia pseudotuberculosis YPIII]
 gi|169752057|gb|ACA69575.1| protein of unknown function DUF949 [Yersinia pseudotuberculosis
           YPIII]
          Length = 246

 Score =  290 bits (742), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 91/232 (39%), Positives = 133/232 (57%), Gaps = 10/232 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I    C  + S    A  P++    +S + K+        I+IFK E +LE+
Sbjct: 4   IALLFAMII----CLPAASFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERVLEL 55

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  EY L++ Y IC +SG  GPK   GD ++PEGFY I   +L P+S+++ +INIG
Sbjct: 56  YAK-LQGEYRLVQSYPICEFSGGLGPKRREGDFKSPEGFYSINTRHLKPDSQFYRAINIG 114

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +G  LMIHG C S GCYAM +  M EI+  VR +     Q  + I  +P
Sbjct: 115 FPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVRTAF-IFGQEKVDISIYP 173

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT +NMQ ++N+   +FW  L+ G+ YF KN   P + + N QYV     
Sbjct: 174 FRMTKQNMQRHRNSSYSNFWRQLQPGYTYFAKNRMPPPVSVSNGQYVLSPPP 225


>gi|45440541|ref|NP_992080.1| hypothetical protein YP_0691 [Yersinia pestis biovar Microtus str.
           91001]
 gi|45435398|gb|AAS60957.1| putative exported protein [Yersinia pestis biovar Microtus str.
           91001]
          Length = 250

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 90/232 (38%), Positives = 133/232 (57%), Gaps = 10/232 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I    C  + S    A  P++    +S + K+        I+IFK E +LE+
Sbjct: 8   IALLFAMII----CLPAASFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERVLEL 59

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  EY L++ Y IC +SG  GPK   GD ++PEGFY I   +L P+S+++ +INIG
Sbjct: 60  YAK-LQGEYRLVQSYPICEFSGGLGPKRREGDFKSPEGFYRINTRHLKPDSQFYRAINIG 118

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +G  LMIHG C S GCYAM +  M EI+  VR +     Q  + I  +P
Sbjct: 119 FPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVRTAF-IFGQEKVDISIYP 177

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT +N+Q ++N+   +FW  L+ G+ YF KN   P + + N QYV     
Sbjct: 178 FRMTEQNIQRHRNSSYSNFWRQLQPGYTYFAKNRMPPPVSVSNGQYVLSPPP 229


>gi|108808723|ref|YP_652639.1| hypothetical protein YPA_2732 [Yersinia pestis Antiqua]
 gi|149364916|ref|ZP_01886951.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|162420212|ref|YP_001607663.1| hypothetical protein YpAngola_A3319 [Yersinia pestis Angola]
 gi|165926620|ref|ZP_02222452.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165936078|ref|ZP_02224648.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010974|ref|ZP_02231872.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212890|ref|ZP_02238925.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398650|ref|ZP_02304174.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421605|ref|ZP_02313358.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167467189|ref|ZP_02331893.1| hypothetical protein YpesF_04645 [Yersinia pestis FV-1]
 gi|218930268|ref|YP_002348143.1| hypothetical protein YPO3241 [Yersinia pestis CO92]
 gi|229838849|ref|ZP_04459008.1| secreted protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895999|ref|ZP_04511169.1| secreted protein [Yersinia pestis Pestoides A]
 gi|229899418|ref|ZP_04514561.1| secreted protein [Yersinia pestis biovar Orientalis str. India 195]
 gi|294504957|ref|YP_003569019.1| hypothetical protein YPZ3_2847 [Yersinia pestis Z176003]
 gi|108780636|gb|ABG14694.1| hypothetical protein YPA_2732 [Yersinia pestis Antiqua]
 gi|115348879|emb|CAL21835.1| putative exported protein [Yersinia pestis CO92]
 gi|149291329|gb|EDM41403.1| putative exported protein [Yersinia pestis CA88-4125]
 gi|162353027|gb|ABX86975.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165916223|gb|EDR34830.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165921548|gb|EDR38745.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165989974|gb|EDR42275.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205677|gb|EDR50157.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960524|gb|EDR56545.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051154|gb|EDR62562.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|229687820|gb|EEO79893.1| secreted protein [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695215|gb|EEO85262.1| secreted protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700922|gb|EEO88951.1| secreted protein [Yersinia pestis Pestoides A]
 gi|262363021|gb|ACY59742.1| hypothetical protein YPD4_2835 [Yersinia pestis D106004]
 gi|262366945|gb|ACY63502.1| hypothetical protein YPD8_2829 [Yersinia pestis D182038]
 gi|294355416|gb|ADE65757.1| hypothetical protein YPZ3_2847 [Yersinia pestis Z176003]
          Length = 246

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 90/232 (38%), Positives = 133/232 (57%), Gaps = 10/232 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I    C  + S    A  P++    +S + K+        I+IFK E +LE+
Sbjct: 4   IALLFAMII----CLPAASFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERVLEL 55

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  EY L++ Y IC +SG  GPK   GD ++PEGFY I   +L P+S+++ +INIG
Sbjct: 56  YAK-LQGEYRLVQSYPICEFSGGLGPKRREGDFKSPEGFYRINTRHLKPDSQFYRAINIG 114

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +G  LMIHG C S GCYAM +  M EI+  VR +     Q  + I  +P
Sbjct: 115 FPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVRTAF-IFGQEKVDISIYP 173

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT +N+Q ++N+   +FW  L+ G+ YF KN   P + + N QYV     
Sbjct: 174 FRMTEQNIQRHRNSSYSNFWRQLQPGYTYFAKNRMPPPVSVSNGQYVLSPPP 225


>gi|293392677|ref|ZP_06636996.1| hypothetical protein HMPREF0758_0332 [Serratia odorifera DSM 4582]
 gi|291424794|gb|EFE98004.1| hypothetical protein HMPREF0758_0332 [Serratia odorifera DSM 4582]
          Length = 258

 Score =  289 bits (740), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 93/234 (39%), Positives = 132/234 (56%), Gaps = 11/234 (4%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
                LLFA+   +       +     E P+ +  +            P  I+IFK E  
Sbjct: 1   MSRIALLFAMLFSMPMITACSASEQVPETPVVKQQL---------LGSPVYIQIFKEERK 51

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           LE++ + +  E+ L+  + IC +SG  GPK   GD ++PEGFY +   +L P+SKY+ +I
Sbjct: 52  LELYAK-MGNEFRLVNTFPICNYSGGLGPKRREGDFKSPEGFYSVDARHLKPDSKYYRAI 110

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN++D++   +GA LMIHGEC S GCYAM N  M EIY  V  +     QS + I 
Sbjct: 111 NIGFPNDYDRSQGYSGAYLMIHGECKSIGCYAMTNDYMDEIYRYVEAAF-AYGQSRVNIS 169

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT +N+Q ++++   SFW  LK G+DYF KNHQ P + + N QYV  K 
Sbjct: 170 IYPFRMTEQNLQRHRSSTYASFWRQLKPGYDYFVKNHQPPMMGVANGQYVLGKP 223


>gi|332160663|ref|YP_004297240.1| hypothetical protein YE105_C1041 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664893|gb|ADZ41537.1| hypothetical protein YE105_C1041 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862520|emb|CBX72677.1| uncharacterized protein yafK [Yersinia enterocolitica W22703]
          Length = 251

 Score =  289 bits (740), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 92/234 (39%), Positives = 138/234 (58%), Gaps = 10/234 (4%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
           +  ++FA+ I L     + S  + A         +S + K+        I+IFK E  LE
Sbjct: 8   FVTIMFAMIICLPAVSFTSSASEPA--------AVSKELKQQLLGSSVYIQIFKEERTLE 59

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           ++ R +  EY L++ Y+IC +SG  GPK   GD ++PEGFY I   +L P+SK++ +INI
Sbjct: 60  LYAR-LQGEYRLVQSYRICEFSGGLGPKRREGDFKSPEGFYTIDMRHLKPDSKFYRAINI 118

Query: 125 GFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           GFPN++DK+   +G  LMIHG C S GCYAM +  M EI+  V+ +     Q  + I  +
Sbjct: 119 GFPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDAYMDEIFNYVQTAF-IFGQEKVDISIY 177

Query: 185 PFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           PFRMT +NMQ ++N+ +Y+FW  L+ G++YF KN   P + +IN QYV  +  T
Sbjct: 178 PFRMTEQNMQRHRNSSDYNFWRQLQPGYEYFAKNRIPPSVSVINGQYVLSRPPT 231


>gi|146328753|ref|YP_001209058.1| lipoprotein [Dichelobacter nodosus VCS1703A]
 gi|146232223|gb|ABQ13201.1| hypothetical lipoprotein [Dichelobacter nodosus VCS1703A]
          Length = 248

 Score =  289 bits (739), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 92/248 (37%), Positives = 140/248 (56%), Gaps = 13/248 (5%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHP---LSENLI--------ISMQKKRTSPFHP 51
           NR  ++ F+L   ++ C      + + E P   L   +           ++ +      P
Sbjct: 2   NRLFLIFFSLLALIS-CRAPEQNVVREEAPFSRLPAGVQNWWNLPLARHLEVRGFQLGAP 60

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             +RIFK E +LE+W +  D  Y L +++ ICA+SG  GPK+  GD+QAPEG YY+G + 
Sbjct: 61  VFVRIFKEERVLELWLKKDDDRYHLYQKFPICAFSGQLGPKVRRGDKQAPEGIYYVGLSQ 120

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSL 171
           LNPNS++ L+ N+GFPN +D+AH  TG  LM+HG C S GCYAM ++Q++EIY I+  +L
Sbjct: 121 LNPNSRFHLAFNLGFPNLYDRAHGYTGDYLMVHGNCVSNGCYAMGDEQIEEIYQIIEAAL 180

Query: 172 RGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQY 231
             + Q  + +  FPF +T  N+  YQ +  Y FW MLK  +DYFE     P +Q+   +Y
Sbjct: 181 -WHGQPSVPVHIFPFPLTPANLAKYQYHRWYDFWQMLKPAYDYFEHYATPPVVQVNAGRY 239

Query: 232 VFFKGQTI 239
                 ++
Sbjct: 240 ELNHILSV 247


>gi|319406363|emb|CBI80004.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 231

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 106/219 (48%), Positives = 137/219 (62%), Gaps = 3/219 (1%)

Query: 18  GCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
            C      S   K    L   ++  M       + P ++R FK +NI EIWK+N    +V
Sbjct: 2   ACQERLPTSFKAKIAQSLPREILDKMAIHDIDQYAPIMMRFFKEDNIAEIWKQNRSGVFV 61

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           L+  Y IC WSG  GPK   GD QAPEGFY +  N +NP SKY+LS NIGFPN +D+ H 
Sbjct: 62  LVVSYDICKWSGQLGPKYREGDLQAPEGFYTVQENQMNPYSKYYLSFNIGFPNLYDQIHG 121

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           RTG+ LM+HG CAS GCY+MN++ M +IYA  RD+ RG  Q   Q+ AFPFRMT  NMQ 
Sbjct: 122 RTGSYLMVHGACASVGCYSMNDRNMAQIYAFARDAFRG-GQKEFQLHAFPFRMTDVNMQR 180

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +  +P+Y FW MLK G+D+FE+N + P I + NK+YVF 
Sbjct: 181 HHMSPHYEFWMMLKEGYDFFERNRKPPKITVYNKRYVFD 219


>gi|170747478|ref|YP_001753738.1| hypothetical protein Mrad2831_1046 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654000|gb|ACB23055.1| protein of unknown function DUF949 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 397

 Score =  287 bits (736), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 86/206 (41%), Positives = 130/206 (63%), Gaps = 2/206 (0%)

Query: 32  PLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           P+    +  M +K  +   P + R +K E+ +E+WK+     YV +K + IC WSG  GP
Sbjct: 32  PIPAATLALMAQKGVTAASPVLFRAYKKESEIEVWKKGAAG-YVYIKTFPICRWSGQLGP 90

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAG 151
           K  +GD Q PEGFY +    +NPNS Y+LS ++G+PN +D+AH  TG+ +M+HG C+S G
Sbjct: 91  KRRSGDRQTPEGFYSVPRRQMNPNSHYYLSFDVGYPNAYDRAHGGTGSAVMVHGICSSMG 150

Query: 152 CYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLG 211
           C+AM N  + EIYAI RD+L G  Q+  Q Q++PFRMT++NM  ++ +PN +FW  LK G
Sbjct: 151 CFAMTNGTVGEIYAIARDALNG-GQAAFQFQSYPFRMTAENMARHRTDPNIAFWRDLKAG 209

Query: 212 HDYFEKNHQEPFIQIINKQYVFFKGQ 237
            D FE + +E  + ++  +Y F   +
Sbjct: 210 SDRFEVSREELQVSVVAGRYAFAPAR 235


>gi|319404880|emb|CBI78481.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 231

 Score =  287 bits (736), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 137/218 (62%), Gaps = 3/218 (1%)

Query: 18  GCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
            C      S   K E  L   ++  M       + P ++R FK +NI EIWK+N    +V
Sbjct: 2   ACQERLPTSFKAKIEQSLPREILNKMAMNDIDQYAPIMMRFFKKDNIAEIWKQNRSGVFV 61

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           L+  Y IC WSG  GPK   GD QAPEGFY +  N +NP SKY+LS NIGFPN +D+ H 
Sbjct: 62  LVVSYDICKWSGQLGPKYREGDFQAPEGFYTVQENQMNPYSKYYLSFNIGFPNLYDQIHG 121

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           RTG+ LM+HG C+S GCY+MN++ M +IYA  RD+ +G  Q   Q+ AFPFRMT  NMQ 
Sbjct: 122 RTGSYLMVHGACSSVGCYSMNDRNMAQIYAFARDAFKG-GQKEFQLHAFPFRMTDANMQR 180

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           +  +P+Y FW MLK G+D+FE N + P I + +K+YVF
Sbjct: 181 HYTSPHYEFWMMLKEGYDFFETNRKPPKITVYDKRYVF 218


>gi|325498730|gb|EGC96589.1| hypothetical protein ECD227_2827 [Escherichia fergusonii ECD227]
          Length = 244

 Score =  287 bits (735), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 99/236 (41%), Positives = 137/236 (58%), Gaps = 7/236 (2%)

Query: 5   YNILLFALFIFL-----NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
             ILLFA+ I L         + +S+    E P+S + ++    K   P     IRIFK 
Sbjct: 7   LYILLFAVVIALGVHFFWPVPNEKSVFLPLEKPVSHSPVVQPS-KVIHPGDQLFIRIFKA 65

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 66  EDKLELWASANNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 125

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY  V  +L+   Q  +
Sbjct: 126 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQRVAQALKS-GQKSV 184

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y    
Sbjct: 185 PVHIFPFAMNDENMRQAQAWPEYNFWLMLKPGYDYFEKNRRLPIISVENRRYKITP 240


>gi|194432691|ref|ZP_03064976.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194418953|gb|EDX35037.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|332094988|gb|EGJ00027.1| hypothetical protein SB521682_0312 [Shigella boydii 5216-82]
 gi|332097308|gb|EGJ02289.1| hypothetical protein SD15574_0703 [Shigella dysenteriae 155-74]
          Length = 246

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 93/234 (39%), Positives = 135/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    QS +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQSSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMQRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|110804363|ref|YP_687883.1| hypothetical protein SFV_0304 [Shigella flexneri 5 str. 8401]
 gi|110613911|gb|ABF02578.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 246

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 133/234 (56%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + + N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVANGRYVVSKP 226


>gi|304558183|gb|ADM40847.1| hypothetical protein ETAF_0725 [Edwardsiella tarda FL6-60]
          Length = 234

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 12/232 (5%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +L   L + L  C  S S    A      +L+               I+IFK E  LE++
Sbjct: 1   MLAICLALPLAACKSSASESGTAPRSGVNSLL----------GSQVYIQIFKEERQLELY 50

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
            +  D +Y L+K + IC +SG  GPK   GD ++PEGFY I   +L P+S+Y+ +INIG+
Sbjct: 51  AKVQD-KYQLVKSFPICKFSGGLGPKRTEGDFKSPEGFYQIDARHLKPDSRYYQAINIGY 109

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN FD++H  +G  LMIHG+C S GCYAM N  + EIY  V+ + R   Q+ + I  +PF
Sbjct: 110 PNSFDQSHGYSGKYLMIHGDCVSVGCYAMTNDGISEIYRYVQSAFR-RGQTLVNINIYPF 168

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           RMT KNMQ ++N+    FW  L+ G+ YF ++   P + + + +YV      
Sbjct: 169 RMTDKNMQRHRNSSYIGFWRQLQPGYQYFAQHALPPQVNVQDGRYVVNGPLP 220


>gi|157369197|ref|YP_001477186.1| hypothetical protein Spro_0952 [Serratia proteamaculans 568]
 gi|157320961|gb|ABV40058.1| protein of unknown function DUF949 [Serratia proteamaculans 568]
          Length = 256

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 93/231 (40%), Positives = 133/231 (57%), Gaps = 11/231 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+   +       +     E P+ +  ++           P  I+IFK E  LE+
Sbjct: 4   IALLFAMLFSMPMITACSASEQVPEVPVVKQQLV---------GSPVYIQIFKEERTLEL 54

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  E+ L+  ++IC +SG  GPK   GD ++PEGFY +   +L P+SKY+ +INIG
Sbjct: 55  YAK-MGNEFRLVNSFQICNFSGGLGPKRREGDFKSPEGFYSVDARHLKPDSKYYRAINIG 113

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +GA LMIHGEC S GCYAM N  M EIY  V  +     QS I I  +P
Sbjct: 114 FPNDYDKSQGYSGAYLMIHGECKSIGCYAMTNTYMDEIYRYVEAAF-AYGQSRIDISIYP 172

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           FRMT KN++ + ++   +FW  LK G+DYF KNHQ P + + N QYV  + 
Sbjct: 173 FRMTDKNLKRHSSSSYIAFWRQLKPGYDYFVKNHQPPMVSVANGQYVLGQP 223


>gi|331664773|ref|ZP_08365678.1| putative inner membrane protein [Escherichia coli TA143]
 gi|331058021|gb|EGI30003.1| putative inner membrane protein [Escherichia coli TA143]
          Length = 239

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 94/243 (38%), Positives = 133/243 (54%), Gaps = 14/243 (5%)

Query: 1   MTNRYNILLFALFIFLN-------GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M  +  + +  L +F+           H   +    E P++ +L      K   P     
Sbjct: 1   MGRKGLLAIVLLSLFIAMIFQFFWPAPHDEHVFLPVEKPVAPSL------KIIHPGDQLF 54

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           IRI K E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LN
Sbjct: 55  IRILKAEDKLELWASTNNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLN 114

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           PNS+Y L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L  
Sbjct: 115 PNSRYHLAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS 174

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q  + +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y  
Sbjct: 175 -GQKSVPVHIFPFAMNEENMRQAQVWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKI 233

Query: 234 FKG 236
              
Sbjct: 234 SPT 236


>gi|284923183|emb|CBG36277.1| putative exported protein [Escherichia coli 042]
          Length = 239

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 94/244 (38%), Positives = 133/244 (54%), Gaps = 14/244 (5%)

Query: 1   MTNRYNILLFALFIFLN-------GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M  +  + +  L +F+           H   +    E P++ +L      K   P     
Sbjct: 1   MGRKGLLAIVLLSLFIAMIFQFFWPAPHDEHVFLPVEKPVAPSL------KIIHPGDQLF 54

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           IRI K E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LN
Sbjct: 55  IRILKAEDKLELWASTNNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKELLN 114

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           PNS+Y L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L  
Sbjct: 115 PNSRYHLAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS 174

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q  + +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y  
Sbjct: 175 -GQKSVPVHIFPFAMDEENMRQAQVWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKI 233

Query: 234 FKGQ 237
               
Sbjct: 234 SPTT 237


>gi|218547671|ref|YP_002381462.1| hypothetical protein EFER_0250 [Escherichia fergusonii ATCC 35469]
 gi|218355212|emb|CAQ87819.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 246

 Score =  286 bits (733), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 92/234 (39%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMQRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|205354181|ref|YP_002227982.1| hypothetical protein SG3168 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205273962|emb|CAR38967.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629302|gb|EGE35645.1| Putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 239

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 130/238 (54%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    E   L     ++   K   P     IRI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKTVASSLKIIHPGDQLFIRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWASANNKPYKLYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q  +
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKRV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMNDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|24111717|ref|NP_706227.1| hypothetical protein SF0274 [Shigella flexneri 2a str. 301]
 gi|30061843|ref|NP_836014.1| hypothetical protein S0295 [Shigella flexneri 2a str. 2457T]
 gi|24050497|gb|AAN41934.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040087|gb|AAP15820.1| hypothetical protein S0295 [Shigella flexneri 2a str. 2457T]
 gi|281599636|gb|ADA72620.1| hypothetical protein SFxv_0291 [Shigella flexneri 2002017]
 gi|332761624|gb|EGJ91904.1| hypothetical protein SF434370_0458 [Shigella flexneri 4343-70]
 gi|332761650|gb|EGJ91929.1| hypothetical protein SF274771_0338 [Shigella flexneri 2747-71]
 gi|332764441|gb|EGJ94674.1| hypothetical protein SFK671_0303 [Shigella flexneri K-671]
 gi|332768573|gb|EGJ98755.1| hypothetical protein SF293071_0385 [Shigella flexneri 2930-71]
 gi|333008739|gb|EGK28203.1| hypothetical protein SFK218_0538 [Shigella flexneri K-218]
 gi|333009705|gb|EGK29155.1| hypothetical protein SFVA6_0548 [Shigella flexneri VA-6]
 gi|333010776|gb|EGK30202.1| hypothetical protein SFK272_0599 [Shigella flexneri K-272]
 gi|333021274|gb|EGK40527.1| hypothetical protein SFK227_0257 [Shigella flexneri K-227]
 gi|333022083|gb|EGK41326.1| hypothetical protein SFK304_0403 [Shigella flexneri K-304]
          Length = 246

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 133/234 (56%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + + N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVANGRYVVSKP 226


>gi|156935266|ref|YP_001439182.1| hypothetical protein ESA_03118 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533520|gb|ABU78346.1| hypothetical protein ESA_03118 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 132/234 (56%), Gaps = 9/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   LL A+ + ++    + ++   +  P+        + K+     P  I+IFK E  
Sbjct: 1   MRKIALLIAMLL-VSCFSWASTVSSDSVTPI------KKELKQQLMGSPVYIQIFKEERT 53

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           LE++ + +  +Y LL  Y+IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +I
Sbjct: 54  LELYVK-MGEQYQLLDSYRICNYSGGLGPKRRQGDFKSPEGFYSVQRSQLKPDSRFYKAI 112

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN FD+A+   G  LMIHG C S GCYAM +K + EI+  V  +L    Q ++Q+ 
Sbjct: 113 NIGFPNAFDRANGYEGKYLMIHGACVSVGCYAMTDKNIDEIFQFVTGALV-FGQPNVQVS 171

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYF    Q P + ++N  YV  K 
Sbjct: 172 IYPFRMTDANMERHKYSYYIGFWKQLKPGYDYFMATRQPPVVSVVNGSYVVSKP 225


>gi|26246272|ref|NP_752311.1| hypothetical protein c0374 [Escherichia coli CFT073]
 gi|227884755|ref|ZP_04002560.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 83972]
 gi|300977425|ref|ZP_07173891.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301045870|ref|ZP_07193057.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|331656306|ref|ZP_08357268.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA206]
 gi|331681646|ref|ZP_08382279.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H299]
 gi|26106670|gb|AAN78855.1|AE016756_38 Hypothetical protein yafK precursor [Escherichia coli CFT073]
 gi|227838356|gb|EEJ48822.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Escherichia coli 83972]
 gi|300302120|gb|EFJ58505.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300409835|gb|EFJ93373.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|307552159|gb|ADN44934.1| probable membrane protein [Escherichia coli ABU 83972]
 gi|315295167|gb|EFU54502.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|315300869|gb|EFU60091.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|331054554|gb|EGI26563.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA206]
 gi|331080848|gb|EGI52013.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H299]
          Length = 246

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|319407839|emb|CBI81492.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 231

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 108/218 (49%), Positives = 138/218 (63%), Gaps = 3/218 (1%)

Query: 18  GCHH--SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
            C      S   K E  L   ++  M       + P ++R FK +NI EIWK+N    +V
Sbjct: 2   ACQERLPTSFKAKIEQSLPREILNKMAMYDIDQYAPIMMRFFKEDNIAEIWKQNRSGVFV 61

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           L+  Y IC WSG  GPK   GD QAPEGFY +  N +NP SKY+LS NIGFPN +D+ H 
Sbjct: 62  LVVSYGICKWSGQLGPKYREGDFQAPEGFYTVQENQMNPYSKYYLSFNIGFPNLYDQIHG 121

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           RTG+ LM+HG CAS GCY+MN++ M +IYA  RD+ RG  Q   Q+ AFPFRMT  NMQ 
Sbjct: 122 RTGSYLMVHGACASVGCYSMNDRNMAQIYAFARDAFRG-GQKEFQLHAFPFRMTDANMQR 180

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           +  NP+Y FW MLK G+D+FEKN + P I + +K+YVF
Sbjct: 181 HYTNPHYEFWMMLKEGYDFFEKNRKPPKITVYDKRYVF 218


>gi|15799929|ref|NP_285941.1| hypothetical protein Z0282 [Escherichia coli O157:H7 EDL933]
 gi|15829505|ref|NP_308278.1| hypothetical protein ECs0251 [Escherichia coli O157:H7 str. Sakai]
 gi|16128210|ref|NP_414759.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|74310866|ref|YP_309285.1| hypothetical protein SSON_0266 [Shigella sonnei Ss046]
 gi|82542817|ref|YP_406764.1| hypothetical protein SBO_0215 [Shigella boydii Sb227]
 gi|82775615|ref|YP_401962.1| hypothetical protein SDY_0250 [Shigella dysenteriae Sd197]
 gi|89107099|ref|AP_000879.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91209312|ref|YP_539298.1| hypothetical protein UTI89_C0264 [Escherichia coli UTI89]
 gi|110640461|ref|YP_668189.1| hypothetical protein ECP_0254 [Escherichia coli 536]
 gi|117622528|ref|YP_851441.1| hypothetical protein APECO1_1743 [Escherichia coli APEC O1]
 gi|157156909|ref|YP_001461413.1| hypothetical protein EcE24377A_0256 [Escherichia coli E24377A]
 gi|157159707|ref|YP_001457025.1| hypothetical protein EcHS_A0252 [Escherichia coli HS]
 gi|168750207|ref|ZP_02775229.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757252|ref|ZP_02782259.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168763465|ref|ZP_02788472.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770022|ref|ZP_02795029.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776136|ref|ZP_02801143.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168782984|ref|ZP_02807991.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789696|ref|ZP_02814703.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168800338|ref|ZP_02825345.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|170021388|ref|YP_001726342.1| hypothetical protein EcolC_3396 [Escherichia coli ATCC 8739]
 gi|170079853|ref|YP_001729173.1| hypothetical protein ECDH10B_0206 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170680694|ref|YP_001742344.1| hypothetical protein EcSMS35_0235 [Escherichia coli SMS-3-5]
 gi|187731026|ref|YP_001879020.1| hypothetical protein SbBS512_E0219 [Shigella boydii CDC 3083-94]
 gi|188494558|ref|ZP_03001828.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|191165732|ref|ZP_03027571.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|191171355|ref|ZP_03032904.1| conserved hypothetical protein [Escherichia coli F11]
 gi|193063243|ref|ZP_03044334.1| conserved hypothetical protein [Escherichia coli E22]
 gi|193068636|ref|ZP_03049597.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194427590|ref|ZP_03060138.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194438191|ref|ZP_03070283.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|195938627|ref|ZP_03084009.1| hypothetical protein EscherichcoliO157_19732 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808317|ref|ZP_03250654.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813045|ref|ZP_03254374.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208818968|ref|ZP_03259288.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400375|ref|YP_002268852.1| hypothetical protein ECH74115_0267 [Escherichia coli O157:H7 str.
           EC4115]
 gi|209917436|ref|YP_002291520.1| hypothetical protein ECSE_0245 [Escherichia coli SE11]
 gi|215485377|ref|YP_002327808.1| hypothetical protein E2348C_0221 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324922|ref|ZP_03441006.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218552829|ref|YP_002385742.1| hypothetical protein ECIAI1_0264 [Escherichia coli IAI1]
 gi|218557182|ref|YP_002390095.1| hypothetical protein ECS88_0261 [Escherichia coli S88]
 gi|218688119|ref|YP_002396331.1| hypothetical protein ECED1_0258 [Escherichia coli ED1a]
 gi|218693708|ref|YP_002401375.1| hypothetical protein EC55989_0248 [Escherichia coli 55989]
 gi|218698832|ref|YP_002406461.1| hypothetical protein ECIAI39_0428 [Escherichia coli IAI39]
 gi|218703497|ref|YP_002411016.1| hypothetical protein ECUMN_0245 [Escherichia coli UMN026]
 gi|237707757|ref|ZP_04538238.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238899616|ref|YP_002925412.1| hypothetical protein BWG_0210 [Escherichia coli BW2952]
 gi|253774752|ref|YP_003037583.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160340|ref|YP_003043448.1| hypothetical protein ECB_00219 [Escherichia coli B str. REL606]
 gi|254791383|ref|YP_003076220.1| secreted protein [Escherichia coli O157:H7 str. TW14359]
 gi|256020199|ref|ZP_05434064.1| secreted protein [Shigella sp. D9]
 gi|256024132|ref|ZP_05437997.1| secreted protein [Escherichia sp. 4_1_40B]
 gi|260842470|ref|YP_003220248.1| hypothetical protein ECO103_0240 [Escherichia coli O103:H2 str.
           12009]
 gi|260853439|ref|YP_003227330.1| hypothetical protein ECO26_0240 [Escherichia coli O26:H11 str.
           11368]
 gi|260866384|ref|YP_003232786.1| hypothetical protein ECO111_0246 [Escherichia coli O111:H- str.
           11128]
 gi|261223721|ref|ZP_05938002.1| secreted protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255870|ref|ZP_05948403.1| hypothetical protein EscherichiacoliO157EcO_08563 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281068|ref|YP_003497886.1| hypothetical protein G2583_0260 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293403327|ref|ZP_06647418.1| yafK protein [Escherichia coli FVEC1412]
 gi|293408342|ref|ZP_06652181.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293413502|ref|ZP_06656151.1| yafK protein [Escherichia coli B185]
 gi|293418341|ref|ZP_06660776.1| yafK protein [Escherichia coli B088]
 gi|297516867|ref|ZP_06935253.1| hypothetical protein EcolOP_04451 [Escherichia coli OP50]
 gi|298378939|ref|ZP_06988820.1| yafK protein [Escherichia coli FVEC1302]
 gi|300817300|ref|ZP_07097518.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300823437|ref|ZP_07103567.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300896713|ref|ZP_07115223.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300902530|ref|ZP_07120508.1| hypothetical protein HMPREF9536_00702 [Escherichia coli MS 84-1]
 gi|300919505|ref|ZP_07136003.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300921963|ref|ZP_07138109.1| hypothetical protein HMPREF9548_00243 [Escherichia coli MS 182-1]
 gi|300929530|ref|ZP_07144996.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300936093|ref|ZP_07151034.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300947280|ref|ZP_07161483.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300955698|ref|ZP_07168048.1| hypothetical protein HMPREF9547_01562 [Escherichia coli MS 175-1]
 gi|300991167|ref|ZP_07179510.1| hypothetical protein HMPREF9553_03801 [Escherichia coli MS 200-1]
 gi|301019115|ref|ZP_07183319.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|301302026|ref|ZP_07208159.1| hypothetical protein HMPREF9347_00593 [Escherichia coli MS 124-1]
 gi|301325431|ref|ZP_07218917.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301646781|ref|ZP_07246635.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|306813332|ref|ZP_07447525.1| hypothetical protein ECNC101_15507 [Escherichia coli NC101]
 gi|307136829|ref|ZP_07496185.1| hypothetical protein EcolH7_01679 [Escherichia coli H736]
 gi|307315226|ref|ZP_07594805.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli W]
 gi|309787090|ref|ZP_07681702.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309797867|ref|ZP_07692249.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|312964717|ref|ZP_07778968.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312970348|ref|ZP_07784529.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331640684|ref|ZP_08341831.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H736]
 gi|331645390|ref|ZP_08346494.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli M605]
 gi|331651155|ref|ZP_08352180.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli M718]
 gi|331661622|ref|ZP_08362545.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA143]
 gi|331666518|ref|ZP_08367392.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA271]
 gi|331671775|ref|ZP_08372571.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA280]
 gi|331675908|ref|ZP_08376625.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H591]
 gi|332281361|ref|ZP_08393774.1| conserved hypothetical protein [Shigella sp. D9]
 gi|76365082|sp|P0AA99|YAFK_ECOLI RecName: Full=Putative L,D-transpeptidase YafK; Flags: Precursor
 gi|90101608|sp|P0AAA0|YAFK_ECO57 RecName: Full=Putative L,D-transpeptidase YafK; Flags: Precursor
 gi|12512995|gb|AAG54549.1|AE005201_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|984580|dbj|BAA07586.1| YafK [Escherichia coli W3110]
 gi|1552794|gb|AAB08646.1| hypothetical [Escherichia coli]
 gi|1786418|gb|AAC73328.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|4902960|dbj|BAA77894.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13359708|dbj|BAB33674.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|59889755|emb|CAH19110.1| Hypothetical exported protein [Escherichia coli]
 gi|73854343|gb|AAZ87050.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81239763|gb|ABB60473.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81244228|gb|ABB64936.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91070886|gb|ABE05767.1| probable membrane protein [Escherichia coli UTI89]
 gi|110342053|gb|ABG68290.1| putative periplasmic protein [Escherichia coli 536]
 gi|115511652|gb|ABI99726.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157065387|gb|ABV04642.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157078939|gb|ABV18647.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169756316|gb|ACA79015.1| protein of unknown function DUF949 [Escherichia coli ATCC 8739]
 gi|169887688|gb|ACB01395.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170518412|gb|ACB16590.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187428018|gb|ACD07292.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|187768412|gb|EDU32256.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015594|gb|EDU53716.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489757|gb|EDU64860.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|188999628|gb|EDU68614.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355746|gb|EDU74165.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361102|gb|EDU79521.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366356|gb|EDU84772.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370756|gb|EDU89172.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189377308|gb|EDU95724.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|190904239|gb|EDV63949.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|190908289|gb|EDV67879.1| conserved hypothetical protein [Escherichia coli F11]
 gi|192931151|gb|EDV83754.1| conserved hypothetical protein [Escherichia coli E22]
 gi|192957999|gb|EDV88441.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|194414360|gb|EDX30634.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194422855|gb|EDX38850.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|208728118|gb|EDZ77719.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734322|gb|EDZ83009.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739091|gb|EDZ86773.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161775|gb|ACI39208.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209745414|gb|ACI71014.1| hypothetical protein ECs0251 [Escherichia coli]
 gi|209745416|gb|ACI71015.1| hypothetical protein ECs0251 [Escherichia coli]
 gi|209745418|gb|ACI71016.1| hypothetical protein ECs0251 [Escherichia coli]
 gi|209745420|gb|ACI71017.1| hypothetical protein ECs0251 [Escherichia coli]
 gi|209745422|gb|ACI71018.1| hypothetical protein ECs0251 [Escherichia coli]
 gi|209910695|dbj|BAG75769.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263449|emb|CAS07769.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217321143|gb|EEC29567.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218350440|emb|CAU96127.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218359597|emb|CAQ97138.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218363951|emb|CAR01616.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218368818|emb|CAR16566.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218425683|emb|CAR06473.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218430594|emb|CAR11460.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222032074|emb|CAP74813.1| Uncharacterized protein yafK [Escherichia coli LF82]
 gi|226898967|gb|EEH85226.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|238860270|gb|ACR62268.1| conserved protein [Escherichia coli BW2952]
 gi|242376055|emb|CAQ30740.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253325796|gb|ACT30398.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972241|gb|ACT37912.1| hypothetical protein ECB_00219 [Escherichia coli B str. REL606]
 gi|253976450|gb|ACT42120.1| hypothetical protein ECD_00219 [Escherichia coli BL21(DE3)]
 gi|254590783|gb|ACT70144.1| secreted protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752088|dbj|BAI23590.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257757617|dbj|BAI29114.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257762740|dbj|BAI34235.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260450580|gb|ACX41002.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli DH1]
 gi|281177441|dbj|BAI53771.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284920018|emb|CBG33074.1| putative exported protein [Escherichia coli 042]
 gi|290760941|gb|ADD54902.1| hypothetical protein G2583_0260 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324869|gb|EFE64284.1| yafK protein [Escherichia coli B088]
 gi|291429180|gb|EFF02200.1| yafK protein [Escherichia coli FVEC1412]
 gi|291433560|gb|EFF06533.1| yafK protein [Escherichia coli B185]
 gi|291471520|gb|EFF14003.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294492959|gb|ADE91715.1| conserved hypothetical protein [Escherichia coli IHE3034]
 gi|298280052|gb|EFI21556.1| yafK protein [Escherichia coli FVEC1302]
 gi|300305605|gb|EFJ60125.1| hypothetical protein HMPREF9553_03801 [Escherichia coli MS 200-1]
 gi|300317449|gb|EFJ67233.1| hypothetical protein HMPREF9547_01562 [Escherichia coli MS 175-1]
 gi|300359433|gb|EFJ75303.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300399374|gb|EFJ82912.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300405401|gb|EFJ88939.1| hypothetical protein HMPREF9536_00702 [Escherichia coli MS 84-1]
 gi|300413399|gb|EFJ96709.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300421633|gb|EFK04944.1| hypothetical protein HMPREF9548_00243 [Escherichia coli MS 182-1]
 gi|300453081|gb|EFK16701.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300458742|gb|EFK22235.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300462529|gb|EFK26022.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300524055|gb|EFK45124.1| conserved hypothetical protein [Escherichia coli MS 119-7]
 gi|300530276|gb|EFK51338.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300842578|gb|EFK70338.1| hypothetical protein HMPREF9347_00593 [Escherichia coli MS 124-1]
 gi|300847729|gb|EFK75489.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|301075016|gb|EFK89822.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|305854095|gb|EFM54534.1| hypothetical protein ECNC101_15507 [Escherichia coli NC101]
 gi|306905407|gb|EFN35944.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli W]
 gi|307628272|gb|ADN72576.1| hypothetical protein UM146_16085 [Escherichia coli UM146]
 gi|308118551|gb|EFO55813.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|308924668|gb|EFP70163.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|310336997|gb|EFQ02135.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312290738|gb|EFR18616.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312944850|gb|ADR25677.1| hypothetical protein NRG857_01235 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315059459|gb|ADT73786.1| conserved protein [Escherichia coli W]
 gi|315134909|dbj|BAJ42068.1| hypothetical protein ECDH1ME8569_0212 [Escherichia coli DH1]
 gi|315253705|gb|EFU33673.1| putative lipoprotein [Escherichia coli MS 85-1]
 gi|315287788|gb|EFU47190.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315616857|gb|EFU97474.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320174233|gb|EFW49395.1| hypothetical protein SDB_03258 [Shigella dysenteriae CDC 74-1112]
 gi|320186546|gb|EFW61273.1| hypothetical protein SGF_01254 [Shigella flexneri CDC 796-83]
 gi|320190225|gb|EFW64875.1| hypothetical protein ECoD_01636 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197292|gb|EFW71908.1| hypothetical protein EcoM_00488 [Escherichia coli WV_060327]
 gi|320201157|gb|EFW75740.1| hypothetical protein ECoL_01583 [Escherichia coli EC4100B]
 gi|320638272|gb|EFX08000.1| hypothetical protein ECO5101_15460 [Escherichia coli O157:H7 str.
           G5101]
 gi|320643553|gb|EFX12720.1| hypothetical protein ECO9389_09877 [Escherichia coli O157:H- str.
           493-89]
 gi|320648968|gb|EFX17566.1| hypothetical protein ECO2687_16241 [Escherichia coli O157:H- str. H
           2687]
 gi|320654668|gb|EFX22669.1| hypothetical protein ECO7815_10427 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660236|gb|EFX27746.1| hypothetical protein ECO5905_08953 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665485|gb|EFX32547.1| hypothetical protein ECOSU61_12655 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323158023|gb|EFZ44124.1| hypothetical protein ECEPECA14_0131 [Escherichia coli EPECa14]
 gi|323160311|gb|EFZ46264.1| hypothetical protein ECE128010_3457 [Escherichia coli E128010]
 gi|323169550|gb|EFZ55222.1| hypothetical protein SS53G_0154 [Shigella sonnei 53G]
 gi|323171030|gb|EFZ56679.1| hypothetical protein ECLT68_4353 [Escherichia coli LT-68]
 gi|323178524|gb|EFZ64102.1| hypothetical protein ECOK1180_3037 [Escherichia coli 1180]
 gi|323181517|gb|EFZ66937.1| hypothetical protein ECOK1357_5081 [Escherichia coli 1357]
 gi|323191507|gb|EFZ76768.1| hypothetical protein ECRN5871_0177 [Escherichia coli RN587/1]
 gi|323379983|gb|ADX52251.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli KO11]
 gi|323938769|gb|EGB35015.1| ykud domain-containing protein [Escherichia coli E1520]
 gi|323943343|gb|EGB39496.1| ykud domain-containing protein [Escherichia coli E482]
 gi|323945376|gb|EGB41430.1| ykud domain-containing protein [Escherichia coli H120]
 gi|323952649|gb|EGB48518.1| ykud domain-containing protein [Escherichia coli H252]
 gi|323958685|gb|EGB54386.1| ykud domain-containing protein [Escherichia coli H263]
 gi|323965208|gb|EGB60666.1| ykud domain-containing protein [Escherichia coli M863]
 gi|323972404|gb|EGB67611.1| ykud domain-containing protein [Escherichia coli TA007]
 gi|323975957|gb|EGB71051.1| ykud domain-containing protein [Escherichia coli TW10509]
 gi|324010196|gb|EGB79415.1| hypothetical protein HMPREF9532_00019 [Escherichia coli MS 57-2]
 gi|324015561|gb|EGB84780.1| hypothetical protein HMPREF9533_00340 [Escherichia coli MS 60-1]
 gi|324019964|gb|EGB89183.1| hypothetical protein HMPREF9542_01343 [Escherichia coli MS 117-3]
 gi|324115590|gb|EGC09529.1| ykud domain-containing protein [Escherichia coli E1167]
 gi|326338772|gb|EGD62591.1| ErfK/YbiS/YcfS/YnhG family protein [Escherichia coli O157:H7 str.
           1044]
 gi|326342441|gb|EGD66221.1| hypothetical protein ECF_02950 [Escherichia coli O157:H7 str. 1125]
 gi|327254523|gb|EGE66139.1| hypothetical protein ECSTEC7V_0277 [Escherichia coli STEC_7v]
 gi|330910067|gb|EGH38577.1| putative exported protein [Escherichia coli AA86]
 gi|331040058|gb|EGI12266.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H736]
 gi|331045552|gb|EGI17678.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli M605]
 gi|331050896|gb|EGI22948.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli M718]
 gi|331060044|gb|EGI32008.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA143]
 gi|331065742|gb|EGI37626.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA271]
 gi|331070764|gb|EGI42123.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli TA280]
 gi|331076468|gb|EGI47745.1| ErfK/YbiS/YcfS/YnhG superfamily protein [Escherichia coli H591]
 gi|332093730|gb|EGI98785.1| hypothetical protein SB359474_2408 [Shigella boydii 3594-74]
 gi|332103713|gb|EGJ07059.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332341577|gb|AEE54911.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 246

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|16766575|ref|NP_462190.1| inner membrane protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|62181788|ref|YP_218205.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|167990158|ref|ZP_02571258.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|197263468|ref|ZP_03163542.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|16421836|gb|AAL22149.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62129421|gb|AAX67124.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|197241723|gb|EDY24343.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|205331143|gb|EDZ17907.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261248443|emb|CBG26280.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995473|gb|ACY90358.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159827|emb|CBW19346.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914303|dbj|BAJ38277.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225961|gb|EFX51015.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322716275|gb|EFZ07846.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323131637|gb|ADX19067.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990135|gb|AEF09118.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 239

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 130/238 (54%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    E   L     ++   K   P     IRI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKPVASSLKIIHPGDQLFIRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWASANNKPYKLYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q  +
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKSV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMNDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|152968812|ref|YP_001333921.1| hypothetical protein KPN_00238 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893215|ref|YP_002917949.1| hypothetical protein KP1_1082 [Klebsiella pneumoniae NTUH-K2044]
 gi|262044042|ref|ZP_06017122.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330005719|ref|ZP_08305359.1| hypothetical protein HMPREF9538_03043 [Klebsiella sp. MS 92-3]
 gi|150953661|gb|ABR75691.1| hypothetical protein KPN_00238 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238545531|dbj|BAH61882.1| hypothetical protein KP1_1082 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259038614|gb|EEW39805.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328536141|gb|EGF62528.1| hypothetical protein HMPREF9538_03043 [Klebsiella sp. MS 92-3]
          Length = 246

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 131/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+ + L     +  L        S    +S + K+     P  I IFK E +
Sbjct: 1   MRKIALFIAMLL-LPCVSFAGLLSS-----NSPTTPVSKEYKQQLMGSPVYIEIFKEERM 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  Y+IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +I
Sbjct: 55  LDLYVK-MGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYNVTRSQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM +  + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT+ NM+ ++ +    FW  LK G+DYF++ H+ P + + + +YV  K 
Sbjct: 173 IYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPVVSVTDGRYVVSKP 226


>gi|206580035|ref|YP_002240293.1| hypothetical protein KPK_4495 [Klebsiella pneumoniae 342]
 gi|288936999|ref|YP_003441058.1| ErfK/YbiS/YcfS/YnhG family protein [Klebsiella variicola At-22]
 gi|290509937|ref|ZP_06549307.1| hypothetical protein HMPREF0485_01707 [Klebsiella sp. 1_1_55]
 gi|206569093|gb|ACI10869.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
 gi|288891708|gb|ADC60026.1| ErfK/YbiS/YcfS/YnhG family protein [Klebsiella variicola At-22]
 gi|289776653|gb|EFD84651.1| hypothetical protein HMPREF0485_01707 [Klebsiella sp. 1_1_55]
          Length = 246

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 131/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+ + L     +  L        S    +S + K+     P  I IFK E +
Sbjct: 1   MRKIALFIAMLL-LPCVSFAGLLSS-----NSPTTPVSKEYKQQLMGSPVYIEIFKEERM 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  Y+IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +I
Sbjct: 55  LDLYVK-MGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYSVTRSQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM +  + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT+ NM+ ++ +    FW  LK G+DYF++ H+ P + + + +YV  K 
Sbjct: 173 IYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPIVSVTDGRYVVSKP 226


>gi|323963534|gb|EGB59092.1| ykud domain-containing protein [Escherichia coli H489]
          Length = 246

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGDQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|270263442|ref|ZP_06191711.1| hypothetical protein SOD_e00660 [Serratia odorifera 4Rx13]
 gi|270042326|gb|EFA15421.1| hypothetical protein SOD_e00660 [Serratia odorifera 4Rx13]
          Length = 255

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 91/231 (39%), Positives = 135/231 (58%), Gaps = 11/231 (4%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+   +       +     E P+ +  ++           P  I+IFK E  LE+
Sbjct: 4   IALLFAMLFSMPMITACSASEQVPEAPVVKQQLV---------GSPVYIQIFKEERTLEL 54

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           + + +  E+ L+  ++IC +SG  GPK   GD ++PEGFY +   +L P+SKY+ +INIG
Sbjct: 55  YAK-MGNEFRLVNSFRICNFSGGLGPKRREGDFKSPEGFYSVDARHLKPDSKYYRAINIG 113

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++DK+   +GA LMIHGEC S GCYAM N  M EIY  V  +     Q+ I I  +P
Sbjct: 114 FPNDYDKSQGYSGAYLMIHGECKSIGCYAMTNTYMDEIYRYVEAAF-AYGQNRIDISIYP 172

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           FRMT +N++ ++++ + +FWN LK G+DYF KNH  P + + N QYV  + 
Sbjct: 173 FRMTEQNLKRHRSSSDIAFWNQLKPGYDYFVKNHLPPVVSVSNGQYVLGQP 223


>gi|315121782|ref|YP_004062271.1| hypothetical protein CKC_00160 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495184|gb|ADR51783.1| hypothetical protein CKC_00160 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 212

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 153/209 (73%), Positives = 187/209 (89%)

Query: 25  LIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA 84
           ++DKAE+PL ++L+  M+KK+TSP+HP++IRIFK ENILEIWK   DA+Y+LLK+YKICA
Sbjct: 1   MVDKAEYPLPKSLVRYMEKKKTSPYHPSLIRIFKEENILEIWKYTYDAQYILLKQYKICA 60

Query: 85  WSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
           WSG  GPKIETGD Q+PEGFYYIGWNNLNPNSKY+LSINIGFPNEFD+ HNRTG D+MIH
Sbjct: 61  WSGIIGPKIETGDRQSPEGFYYIGWNNLNPNSKYYLSINIGFPNEFDREHNRTGTDIMIH 120

Query: 145 GECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           G C+SAGCYAMN+KQ+ EIYAI+RDSLRG MQS+IQ+QAFPFRMT +NM+ YQ +P+Y F
Sbjct: 121 GGCSSAGCYAMNDKQILEIYAIIRDSLRGKMQSYIQVQAFPFRMTQENMKRYQTHPDYFF 180

Query: 205 WNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           WN+LK+G+DYFE NH EP +Q++NKQYVF
Sbjct: 181 WNILKIGYDYFENNHLEPIVQVLNKQYVF 209


>gi|260596636|ref|YP_003209207.1| hypothetical protein CTU_08440 [Cronobacter turicensis z3032]
 gi|260215813|emb|CBA28269.1| Uncharacterized protein yafK [Cronobacter turicensis z3032]
          Length = 256

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 131/234 (55%), Gaps = 9/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   LL A+ + ++    + ++   +  P+        + K+     P  I+IFK E  
Sbjct: 12  MRKIALLIAMLL-VSCFSWASTVSSDSVTPI------KKELKQQLMGSPVYIQIFKEERK 64

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           LE++ + +  +Y LL  Y IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +I
Sbjct: 65  LELYVK-MGEQYQLLDSYNICNYSGGLGPKRRQGDFKSPEGFYSVQRSQLKPDSRFYKAI 123

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN FD+A+   G  LMIHG C S GCYAM +K + EI+  V  +L    Q ++Q+ 
Sbjct: 124 NIGFPNAFDRANGYEGKYLMIHGACVSVGCYAMTDKNIDEIFQFVTGALV-FGQPNVQVS 182

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYF    Q P + ++N  YV  K 
Sbjct: 183 IYPFRMTDANMERHKYSYYIGFWKQLKPGYDYFMTTRQPPVVSVVNGSYVVSKP 236


>gi|170767696|ref|ZP_02902149.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170123184|gb|EDS92115.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 246

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 92/236 (38%), Positives = 133/236 (56%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     IL     + L  C     L+  +    S    +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFIL----AMLLIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q
Sbjct: 112 AINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKYSNFKDFWEQLKPGYDYFEQTRKPPIVSVVNGRYVVSKP 226


>gi|198245601|ref|YP_002217251.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|207858527|ref|YP_002245178.1| hypothetical protein SEN3112 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|197940117|gb|ACH77450.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|206710330|emb|CAR34688.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326625028|gb|EGE31373.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 239

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 130/238 (54%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    E   L     ++   K   P     IRI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKPVASSLKIIHPGDQLFIRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWASANNKPYKLYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q  +
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKRV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMNDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|224582153|ref|YP_002635951.1| hypothetical protein SPC_0323 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224466680|gb|ACN44510.1| hypothetical protein SPC_0323 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 245

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 90/236 (38%), Positives = 130/236 (55%), Gaps = 11/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+       S    +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLMPCVSFAGLLSS-----SPVTPVSKEYKQQLMGSPVYIQIFKEE 51

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ 
Sbjct: 52  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYK 110

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q
Sbjct: 111 AINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV-FGQPSVQ 169

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++ +YV  K 
Sbjct: 170 VSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKP 225


>gi|283784004|ref|YP_003363869.1| lipoprotein [Citrobacter rodentium ICC168]
 gi|282947458|emb|CBG87005.1| putative lipoprotein [Citrobacter rodentium ICC168]
          Length = 246

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 131/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+   L  C     L+  +    S    IS + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAML--LIPCVSFAGLLGSS----SPTTPISKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + +++ +YV  K 
Sbjct: 173 IYPFRMTDANMQRHKYSYYKDFWTQLKPGYDYFEQTRKPPTVSVVDGRYVVSKP 226


>gi|152992424|ref|YP_001358145.1| hypothetical protein SUN_0830 [Sulfurovum sp. NBC37-1]
 gi|151424285|dbj|BAF71788.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 294

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 132/201 (65%), Gaps = 2/201 (0%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           L  ++            IRIFK E +LE+W +  D EY LLKEYKICA+SG  GPK++ G
Sbjct: 95  LKEALSHAGARVGDAVFIRIFKREALLEVWIKK-DGEYKLLKEYKICAYSGRLGPKLKEG 153

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMN 156
           D QAPEGFY +    LNP+SK+ LS N+G+PN +D+A+ RTGA LM+HG C S GCYAM 
Sbjct: 154 DRQAPEGFYSVNRGRLNPHSKFHLSFNLGYPNAYDRAYGRTGAYLMVHGNCVSIGCYAMT 213

Query: 157 NKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFE 216
           + +++EIY +V ++L+   Q  +Q+  +PFRMT +NM  Y +   YSFW  LK G+DYFE
Sbjct: 214 DAKIEEIYMLVEEALK-KGQKRVQVHIYPFRMTPENMAAYSHYRWYSFWQNLKEGYDYFE 272

Query: 217 KNHQEPFIQIINKQYVFFKGQ 237
             H  P I + NK+Y+  + +
Sbjct: 273 AEHLPPKISVENKRYIIGESE 293


>gi|309700456|emb|CBI99749.1| putative exported protein [Escherichia coli ETEC H10407]
          Length = 246

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDTNMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|218550430|ref|YP_002384221.1| hypothetical protein EFER_3124 [Escherichia fergusonii ATCC 35469]
 gi|218357971|emb|CAQ90617.1| conserved Hypothetical protein [Escherichia fergusonii ATCC 35469]
          Length = 246

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 98/236 (41%), Positives = 136/236 (57%), Gaps = 7/236 (2%)

Query: 5   YNILLFALFIFL-----NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
             ILLFA+ I L         + +S+    E P+S + ++    K   P     IRI K 
Sbjct: 9   LYILLFAVVIALGVHFFWPVPNEKSVFLPLEKPVSHSPVVQPS-KVIHPGDQLFIRILKA 67

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 68  EDKLELWASANNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 127

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY  V  +L+   Q  +
Sbjct: 128 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQRVAQALKS-GQKSV 186

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y    
Sbjct: 187 PVHIFPFAMNDENMRQAQAWPEYNFWLMLKPGYDYFEKNRRLPIISVENRRYKITP 242


>gi|320178956|gb|EFW53918.1| hypothetical protein SGB_03903 [Shigella boydii ATCC 9905]
          Length = 246

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 94/234 (40%), Positives = 136/234 (58%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    QS +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQSSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LKLG+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMQRHKYSNFKDFWEQLKLGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|161616283|ref|YP_001590248.1| hypothetical protein SPAB_04088 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365647|gb|ABX69415.1| hypothetical protein SPAB_04088 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 239

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 131/238 (55%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    E   L     ++   K   P     IRI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKPVASSLKIIHPGDQLFIRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWVSANNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q ++
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKNV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMDDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|283834482|ref|ZP_06354223.1| putative lipoprotein [Citrobacter youngae ATCC 29220]
 gi|291070029|gb|EFE08138.1| putative lipoprotein [Citrobacter youngae ATCC 29220]
          Length = 246

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 129/236 (54%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+       S    +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLLPCVSFAGLLSSN----SPTAPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +    L P+S+++ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVQRGQLKPDSRFYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q
Sbjct: 112 AINIGFPNAYDRAHGYEGKYLMIHGACVSVGCYAMTDNGIDEIFQFVTGALV-FGQPSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + ++N +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKFSYYKDFWAQLKPGYDYFEQTHKPPTVSVVNGRYVISKP 226


>gi|307132284|ref|YP_003884300.1| hypothetical protein Dda3937_04297 [Dickeya dadantii 3937]
 gi|306529813|gb|ADM99743.1| conserved protein [Dickeya dadantii 3937]
          Length = 241

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 92/232 (39%), Positives = 133/232 (57%), Gaps = 9/232 (3%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWK 67
           L  A+   L     S S  ++   P +E               P  I+IFK E ILE++ 
Sbjct: 6   LSLAMLFVLPSVAISNSYANQVSPPATETTQQV-------AGSPVYIQIFKEERILELYA 58

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP 127
           R    EY L++ Y IC +SG  GPK+  GD ++PEGFY +    L P+S Y+ +IN+GFP
Sbjct: 59  R-TGNEYKLVQSYPICKYSGGLGPKMTEGDFKSPEGFYQVDLKQLKPDSHYYRAINVGFP 117

Query: 128 NEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFR 187
           NE+D+AH  +G  LMIHGEC S GCYAM N+ + EIY  V  +LR N Q  +++  +PFR
Sbjct: 118 NEYDRAHGYSGRYLMIHGECVSIGCYAMTNQYIAEIYTYVEKALR-NGQQKVELAIYPFR 176

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           M  +NM+ +  +  Y FW+ L+ G+ YF + HQ P + ++N QYV  +   +
Sbjct: 177 MNEQNMKRHSRSTYYKFWSQLQPGYAYFNRTHQPPAVSVLNGQYVVNQPAPV 228


>gi|296101420|ref|YP_003611566.1| hypothetical protein ECL_01056 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055879|gb|ADF60617.1| hypothetical protein ECL_01056 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 246

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 130/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+   L  C     L+       S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAML--LIPCVSFAGLLSSN----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ +I
Sbjct: 55  LDLFVK-MGETYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYNVQRNQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN FD+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q ++Q+ 
Sbjct: 114 NIGFPNAFDRAHGYEGKYLMIHGACVSIGCYAMTDSGIDEIFQFVTGALV-FGQPNVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM  ++ +    FW  LK G+DYFE+ H+ P + +++ +YV  K 
Sbjct: 173 IYPFRMTDANMARHKYSYYADFWKQLKPGYDYFEQTHKPPVVSVVDGRYVVSKP 226


>gi|238755088|ref|ZP_04616435.1| hypothetical protein yruck0001_22810 [Yersinia ruckeri ATCC 29473]
 gi|238706648|gb|EEP99018.1| hypothetical protein yruck0001_22810 [Yersinia ruckeri ATCC 29473]
          Length = 240

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 93/227 (40%), Positives = 134/227 (59%), Gaps = 6/227 (2%)

Query: 10  FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRN 69
             L + L  C  + S+   A  P++       + K+        I+IFK E  LE++ R 
Sbjct: 4   ITLLLALIICLPAVSVTSSASEPVTMA----KELKQQLLGSSVYIQIFKEERTLELYAR- 58

Query: 70  VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE 129
           +  EY LL+ Y+IC +SG  GPK   GD ++PEGFY I   +L P+SK++ +INIGFPN+
Sbjct: 59  LQGEYRLLQSYRICNFSGGLGPKRREGDFKSPEGFYSIDMQHLKPDSKFYRAINIGFPND 118

Query: 130 FDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMT 189
           FDK+   +G  LMIHG+C S GCYAM +  M EI+  V+ +   N QS + I  +PFRMT
Sbjct: 119 FDKSQGYSGKYLMIHGDCQSIGCYAMTDAYMDEIFNYVKMAF-INGQSKVDISIYPFRMT 177

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +NMQ ++N+   +FW  L+ G+ YF KN   P + +IN QYV  + 
Sbjct: 178 EQNMQRHRNSTYINFWRQLQPGYTYFAKNRMPPPVGVINGQYVINRP 224


>gi|301019012|ref|ZP_07183228.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|299882417|gb|EFI90628.1| conserved hypothetical protein [Escherichia coli MS 196-1]
          Length = 246

 Score =  284 bits (728), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 134/234 (57%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+   L  C     L+  +    S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAML--LIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQHNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|168231886|ref|ZP_02656944.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|194469493|ref|ZP_03075477.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|197248083|ref|YP_002148204.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|194455857|gb|EDX44696.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|197211786|gb|ACH49183.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|205333905|gb|EDZ20669.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
          Length = 239

 Score =  284 bits (728), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 95/238 (39%), Positives = 130/238 (54%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEH-PLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    EH  L     +    K   P     IRI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEHIYLPVEKPVVSSLKIIHPGDQLFIRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWASANNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q  +
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKSV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  KNM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMNDKNMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|253689656|ref|YP_003018846.1| ErfK/YbiS/YcfS/YnhG family protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251756234|gb|ACT14310.1| ErfK/YbiS/YcfS/YnhG family protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 244

 Score =  284 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 97/234 (41%), Positives = 134/234 (57%), Gaps = 6/234 (2%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   L FA+  FL     + +  + A         I+ + K+     P  I+IFK E I
Sbjct: 1   MQKIALSFAMLFFLPSLVVTSAASETA----PPLAPIAKELKQQLLGSPIYIQIFKEERI 56

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
            E++ + V  EY LL +Y IC +SG  GPK   GD ++PEGFY +    L P+S+Y+ +I
Sbjct: 57  FELYAK-VGNEYRLLDQYPICKYSGGLGPKRVEGDLKSPEGFYQVDLRQLKPDSQYYRAI 115

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN++DK+   +G  LMIHGEC S GCYAM N  M EIY     +LR N Q  I I 
Sbjct: 116 NIGFPNDYDKSQGYSGRYLMIHGECVSVGCYAMTNTYMDEIYRYAEAALR-NGQPKIDIA 174

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT +NMQ ++N+   SFW  L+ G+ YF +++Q P I + N QYV    
Sbjct: 175 IYPFRMTEQNMQRHRNSTYASFWKQLQPGYAYFNQHNQPPAITVFNGQYVVNPP 228


>gi|324115247|gb|EGC09211.1| ykud domain-containing protein [Escherichia fergusonii B253]
          Length = 246

 Score =  284 bits (727), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 97/236 (41%), Positives = 135/236 (57%), Gaps = 7/236 (2%)

Query: 5   YNILLFALFIFL-----NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
             ILLFA+ I L         + +S+    E P+S + ++    K         IRI K 
Sbjct: 9   LYILLFAVVIALGVHFFWPVPNEKSVFLPLEKPVSHSPVVQPS-KVIHHGDQLFIRILKA 67

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 68  EDKLELWASANNKPYELYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 127

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY  V  +L+   Q  +
Sbjct: 128 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQRVAQALKS-GQKSV 186

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y    
Sbjct: 187 PVHIFPFAMNDENMRQAQAWPEYNFWLMLKPGYDYFEKNRRLPIISVENRRYKITP 242


>gi|224585075|ref|YP_002638874.1| inner membrane protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469603|gb|ACN47433.1| putative inner membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 239

 Score =  284 bits (726), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 129/238 (54%), Gaps = 2/238 (0%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  +  + +  L +F+        L    E   L     ++   K   P      RI K 
Sbjct: 1   MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKPVASSLKIIHPGDQLFTRILKA 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E+ LE+W    +  Y L K + ICAWSG  GPK + GD ++PEGFY      LNPNS+Y 
Sbjct: 61  EDKLELWASANNKPYKLYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYH 120

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
           L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L    Q  +
Sbjct: 121 LAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS-GQKSV 179

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y      
Sbjct: 180 PVHIFPFTMNDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTT 237


>gi|218706781|ref|YP_002414300.1| hypothetical protein ECUMN_3641 [Escherichia coli UMN026]
 gi|293406771|ref|ZP_06650697.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298382511|ref|ZP_06992108.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|300897922|ref|ZP_07116301.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|218433878|emb|CAR14795.1| conserved Hypothetical protein [Escherichia coli UMN026]
 gi|291426777|gb|EFE99809.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298277651|gb|EFI19167.1| conserved hypothetical protein [Escherichia coli FVEC1302]
 gi|300358352|gb|EFJ74222.1| conserved hypothetical protein [Escherichia coli MS 198-1]
          Length = 239

 Score =  284 bits (726), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 94/244 (38%), Positives = 132/244 (54%), Gaps = 14/244 (5%)

Query: 1   MTNRYNILLFALFIFLN-------GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV 53
           M  +  + +  L +F+           H   +    E P++ +L      K   P     
Sbjct: 1   MGRKGLLAIVLLSLFIAMIFQFFWPAPHDEHVFLPVEKPVAPSL------KIIHPGDQLF 54

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           IRI K E+ LE+W    +  Y L K   ICAWSG  GPK + GD ++PEGFY      LN
Sbjct: 55  IRILKAEDKLELWASTNNKPYELYKTRTICAWSGGLGPKHKQGDGKSPEGFYATNKELLN 114

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
           PNS+Y L+ NIG+PN +D+A+  TG  +M+HG C SAGCYAM +  ++EIY +V  +L  
Sbjct: 115 PNSRYHLAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNS 174

Query: 174 NMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             Q  + +  FPF M  +NM+  Q  P Y+FW MLK G+DYFEKN + P I + N++Y  
Sbjct: 175 -GQKSVPVHIFPFAMDEENMRQAQVWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKI 233

Query: 234 FKGQ 237
               
Sbjct: 234 SPTT 237


>gi|311280788|ref|YP_003943019.1| ErfK/YbiS/YcfS/YnhG family protein [Enterobacter cloacae SCF1]
 gi|308749983|gb|ADO49735.1| ErfK/YbiS/YcfS/YnhG family protein [Enterobacter cloacae SCF1]
          Length = 246

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 88/234 (37%), Positives = 131/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+   L  C     L+       S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAML--LIPCVSFAGLLSSN----SPTTPVSKEFKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  YKIC +SG  GPK   GD ++PEGFY +    L P+S+++ +I
Sbjct: 55  LDLYVK-MGETYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVTREQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    QS++Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGACVSIGCYAMTDSGIDEIFQFVTGALV-FGQSNVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM+ ++ +    FW+ LK G+DYF + H+ P + +++ +YV  K 
Sbjct: 173 IYPFRMTDANMERHKFSFYKDFWSQLKPGYDYFAQTHKPPMVSVVDGRYVVSKP 226


>gi|261340937|ref|ZP_05968795.1| conserved hypothetical protein [Enterobacter cancerogenus ATCC
           35316]
 gi|288316795|gb|EFC55733.1| conserved hypothetical protein [Enterobacter cancerogenus ATCC
           35316]
          Length = 246

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 89/234 (38%), Positives = 130/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+   L  C     L+       S    IS + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAML--LIPCVSFAGLLSSN----SSTTPISKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  YKIC +SG  GPK   GD ++PEGFY +  + L P+S+++ +I
Sbjct: 55  LDLYVK-MGETYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYNVQRSQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN FD+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q ++Q+ 
Sbjct: 114 NIGFPNAFDRAHGYEGKYLMIHGACVSVGCYAMTDTGIDEIFQFVTGALV-FGQPNVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM  ++ +    FW  LK G+DYFE+ H+ P + +++ +Y+  K 
Sbjct: 173 IYPFRMTDANMARHKYSYYADFWKQLKPGYDYFEQTHKPPVVSVVDGRYLVSKP 226


>gi|317493141|ref|ZP_07951564.1| ykud domain-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918801|gb|EFV40137.1| ykud domain-containing protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 241

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 90/236 (38%), Positives = 136/236 (57%), Gaps = 12/236 (5%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     +L     + L  C  S S   +   PL +  +            P  I+IFK E
Sbjct: 1   MGKIIALLAVFFVLPLTSCSSSASEQAQ-NTPLVKQQL---------LGSPVYIQIFKEE 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++ +  D +Y L++ + IC +SG  GPK   GD ++PEGFY +   +L PNSK++ 
Sbjct: 51  RKLELFAKVQD-KYQLVQSFNICKFSGGLGPKRTEGDFKSPEGFYQVDARHLKPNSKFYQ 109

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIG+PN +D+AH  +G  LMIHG+C S GCYAM N+ + +IY  V+ + R N Q+ + 
Sbjct: 110 AINIGYPNAYDQAHGYSGKYLMIHGDCVSIGCYAMTNEGISQIYTYVQSAFR-NGQTLVN 168

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           I  +PFRMT +NMQ ++N+    FW  L+ G+ YF ++HQ P + ++N QYV  + 
Sbjct: 169 INIYPFRMTEQNMQRHRNSDYLPFWKQLQPGYAYFNEHHQPPMVNVVNGQYVVNRP 224


>gi|50122394|ref|YP_051561.1| hypothetical protein ECA3471 [Pectobacterium atrosepticum SCRI1043]
 gi|49612920|emb|CAG76370.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 244

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 96/234 (41%), Positives = 135/234 (57%), Gaps = 6/234 (2%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   L FA+  FL     S  +   A         I+ + K+     P  I+IFK E I
Sbjct: 1   MQKIALSFAMLFFL----PSLVVTSAASEIAPPLAPIAKELKQQLLGSPIYIQIFKEERI 56

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
            E++ + V  EY LL++Y IC +SG  GPK   GD ++PEGFY +    L P+S+Y+ +I
Sbjct: 57  FELYAK-VGNEYRLLEQYPICKYSGGLGPKRVEGDLKSPEGFYQVDLRQLKPDSQYYRAI 115

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN++DK+   +G  LMIHGEC S GCYAM N  M EIY     +LR + Q+ I I 
Sbjct: 116 NIGFPNDYDKSQGYSGRYLMIHGECVSVGCYAMTNNYMDEIYRYADAALR-HGQAKIDIA 174

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT +NMQ ++++   SFW  L+ G+ YF +++Q P I + N QYV    
Sbjct: 175 IYPFRMTEQNMQRHRSSTYASFWKQLQPGYTYFNQHNQPPAITVFNGQYVVNPP 228


>gi|227113590|ref|ZP_03827246.1| hypothetical protein PcarbP_11527 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 244

 Score =  282 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 96/234 (41%), Positives = 133/234 (56%), Gaps = 6/234 (2%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   L FA+  FL     S  +   A         I+ + K+     P  I+IFK E I
Sbjct: 1   MQKIALSFAMLFFL----PSLVVTSAASEIAPPLAPIAKELKQQLLGSPIYIQIFKEERI 56

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
            E++ + V  EY LL +Y IC +SG  GPK   GD ++PEGFY +    L P+S+Y+ +I
Sbjct: 57  FELYAK-VGNEYRLLDQYPICKYSGGLGPKRVEGDLKSPEGFYQVDLRQLKPDSQYYRAI 115

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN++DK+   +G  LMIHGEC S GCYAM N  M EIY     +LR N Q+ I I 
Sbjct: 116 NIGFPNDYDKSQGYSGRYLMIHGECVSVGCYAMTNTYMDEIYRYAEAALR-NGQAKIDIA 174

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT +NM  ++N+   SFW  L+ G+ YF +++Q P + + N QYV    
Sbjct: 175 IYPFRMTEQNMHRHRNSTYASFWKQLQPGYAYFNQHNQPPAVTVFNGQYVVNPP 228


>gi|324111217|gb|EGC05200.1| ykud domain-containing protein [Escherichia fergusonii B253]
 gi|325496147|gb|EGC94006.1| hypothetical protein ECD227_0244 [Escherichia fergusonii ECD227]
          Length = 246

 Score =  282 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 133/234 (56%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L+ A+ +       S      +  P+S+      + K+     P  I+IFK E  
Sbjct: 1   MRKIALILAMLLIPCVSFASLLGSSSSTTPVSK------EYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +I
Sbjct: 55  LDLYVK-MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 173 IYPFRMTDANMQRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|300024683|ref|YP_003757294.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526504|gb|ADJ24973.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 295

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 85/208 (40%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 29  AEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGT 88
              P        + ++      P ++RIFK E  LE+W +  D  +     Y IC WSG 
Sbjct: 73  PGQPDLARFSERLAEQGLKEGAPVLVRIFKREFELELWMQ-RDGAFRRFATYPICRWSGW 131

Query: 89  FGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA 148
            GPK+  GD QAPEGFY +  + LNPNS++F S N+G+PN FD+A  RTG+ +M+HG C 
Sbjct: 132 LGPKLVEGDRQAPEGFYTVEASALNPNSRWFRSFNLGYPNAFDRAQGRTGSLIMVHGGCG 191

Query: 149 SAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNML 208
           S GC+AM N QM EI+ +V  +L G  Q   Q+Q +PFRM+   ++ +  +P+ +FW  L
Sbjct: 192 SIGCFAMTNGQMAEIWRLVTAAL-GGGQKRFQVQVYPFRMSEAELKAHAKDPDIAFWRDL 250

Query: 209 KLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           K GHD FE N   P + +   +Y F  G
Sbjct: 251 KAGHDLFEANAVPPTVSVCKGRYQFQAG 278


>gi|315499814|ref|YP_004088617.1| hypothetical protein Astex_2828 [Asticcacaulis excentricus CB 48]
 gi|315417826|gb|ADU14466.1| hypothetical protein Astex_2828 [Asticcacaulis excentricus CB 48]
          Length = 240

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 80/199 (40%), Positives = 130/199 (65%), Gaps = 2/199 (1%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           +  ++ +       P +IRIFK  + LE+W ++   +Y L K ++IC+WSG+ GPK + G
Sbjct: 44  IRAALTRNDLQLGQPILIRIFKETDELELWVKS-GGKYRLYKTFRICSWSGSLGPKKKEG 102

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMN 156
           D Q+PEGFY +    + P+S+Y L+ N+G+PN FD+A+ R G+ LM+HG+CAS GCYAM 
Sbjct: 103 DGQSPEGFYTVSRGQMKPDSQYHLAFNLGYPNAFDRANGRIGSYLMVHGKCASIGCYAMT 162

Query: 157 NKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFE 216
           +K ++EI+ I  ++L+G  Q+  Q+  +PFRMT  +++ +  +P   FW  LK G+D FE
Sbjct: 163 DKGIEEIWLIADEALKG-GQTAFQVHVYPFRMTDAHIKRHVGSPWLGFWTDLKAGYDRFE 221

Query: 217 KNHQEPFIQIINKQYVFFK 235
           +NH +  + ++NK+Y    
Sbjct: 222 QNHSDLNVTVVNKRYRVTP 240


>gi|291616432|ref|YP_003519174.1| YafK [Pantoea ananatis LMG 20103]
 gi|291151462|gb|ADD76046.1| YafK [Pantoea ananatis LMG 20103]
 gi|327392872|dbj|BAK10294.1| lipoprotein YafK [Pantoea ananatis AJ13355]
          Length = 266

 Score =  281 bits (720), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 132/234 (56%), Gaps = 8/234 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I L     + +       P+ +   +S + K+     P  I+IFK E  LE+
Sbjct: 24  IALLFAM-ILLPALSMAMTP-----EPVQQLAPVSKELKKQLIGTPVYIQIFKEERTLEL 77

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  EY LL  Y+IC +SG  GPK   GD ++PEGFY +  N L P+S+++ +INIG
Sbjct: 78  Y-GKIGNEYRLLDTYRICNFSGGLGPKRREGDFKSPEGFYSVKMNQLKPDSRFYRAINIG 136

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++D+    +G  LMIHG+C S GCYAM N  M +I+  V  +LR N Q  + I  +P
Sbjct: 137 FPNQYDRDQGYSGNYLMIHGDCKSIGCYAMTNAYMDQIFTYVNAALR-NGQQEVNIAIYP 195

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           FRMT  NMQ ++ +    FW  L+ G+ YF + HQ P + + + +YV      I
Sbjct: 196 FRMTESNMQRHRYSTYADFWKQLQPGYAYFAQYHQPPTVNVASGRYVMNSSPVI 249


>gi|157147183|ref|YP_001454502.1| hypothetical protein CKO_02961 [Citrobacter koseri ATCC BAA-895]
 gi|157084388|gb|ABV14066.1| hypothetical protein CKO_02961 [Citrobacter koseri ATCC BAA-895]
          Length = 246

 Score =  281 bits (718), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 130/236 (55%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+  +         +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLIPCVSFAGLLSSSSP----TTPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRFYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    QS +Q
Sbjct: 112 AINIGFPNAYDRAHGYEGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTGALV-FGQSSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + +++ +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKYSYYKDFWTQLKPGYDYFEQTRKPPTVSVVDGRYVVSKP 226


>gi|312112882|ref|YP_004010478.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218011|gb|ADP69379.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 288

 Score =  281 bits (718), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 92/228 (40%), Positives = 121/228 (53%), Gaps = 7/228 (3%)

Query: 14  IFLNGCHHSRSLIDKAEHPLSE-----NLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           I L      R L  K   PL        L   + +K      P  IRIFK E  LE+W R
Sbjct: 42  IRLAAHDAQRVLYAKLGWPLPGTPDLGRLNERLAEKGLERGAPVFIRIFKRERELELWMR 101

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             D+ +VL   Y +C  SG  GPK+  GD QAPEGFY +G + LNPNS Y  S N+G+PN
Sbjct: 102 GGDS-FVLFASYPVCRHSGGLGPKLREGDRQAPEGFYTVGRSQLNPNSAYRRSFNLGYPN 160

Query: 129 EFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRM 188
            +D A+ RTG+ LM+HG C S GCYAM +  + EI+ +V  +L    Q       FPFRM
Sbjct: 161 LYDAANGRTGSFLMVHGACLSVGCYAMTDPVIDEIWELVTAALD-RGQKRFSAHVFPFRM 219

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  ++ ++   P   FW  LK G+D FE +   P I +  K+YV   G
Sbjct: 220 SEAHLAIHDRAPWGEFWRDLKRGYDLFEASRTPPRIGVCAKRYVARSG 267


>gi|313646642|gb|EFS11101.1| hypothetical protein SF2457T_4830 [Shigella flexneri 2a str. 2457T]
          Length = 237

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 88/223 (39%), Positives = 129/223 (57%), Gaps = 6/223 (2%)

Query: 14  IFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
           + L  C     L+  +    S    +S + K+     P  I+IFK E  L+++ + +  +
Sbjct: 1   MLLIPCVSFAGLLGSS----SSTTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK-MGEQ 55

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA 133
           Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+Y+ +INIGFPN +D+A
Sbjct: 56  YQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAINIGFPNAYDRA 115

Query: 134 HNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNM 193
           H   G  LMIHG+C S GCYAM N+ + EI+  V  +L    Q  +Q+  +PFRMT  NM
Sbjct: 116 HGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV-FGQPSVQVSIYPFRMTDANM 174

Query: 194 QLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           + ++ +    FW  LK G+DYFE+  + P + + N +YV  K 
Sbjct: 175 KRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVANGRYVVSKP 217


>gi|251788530|ref|YP_003003251.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya zeae Ech1591]
 gi|247537151|gb|ACT05772.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya zeae Ech1591]
          Length = 241

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 92/229 (40%), Positives = 137/229 (59%), Gaps = 9/229 (3%)

Query: 10  FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRN 69
            A+   L     + S  +    PLS    ++ + K+     P  I+IFK E +LE++   
Sbjct: 8   LAMLFILPSVAINSSYAN----PLSP---VATETKQQVTGSPVYIQIFKEERVLELYAM- 59

Query: 70  VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE 129
           +  EY L++ Y IC +SG  GPK+  GD ++PEGFY +    L P+S Y+ +IN+GFPNE
Sbjct: 60  IGGEYKLVQSYPICKYSGGLGPKMTEGDFKSPEGFYQVDLRQLKPDSHYYRAINVGFPNE 119

Query: 130 FDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMT 189
           +D+AH  +G  LMIHGEC S GCYAM NK ++EIY  V  +LR N Q  +++  +PFRMT
Sbjct: 120 YDRAHGYSGRYLMIHGECVSIGCYAMTNKYIEEIYTYVEKALR-NGQQKVELAIYPFRMT 178

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
            +NM+ +  +  Y FW+ L+ G+ YF + HQ P + ++N QYV  +   
Sbjct: 179 EQNMKRHSRSNYYKFWSQLQPGYAYFNRTHQPPAVSVLNGQYVVNQSSP 227


>gi|295096900|emb|CBK85990.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 246

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 89/234 (38%), Positives = 127/234 (54%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+ +                   S    +S + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAMLLI------PCMSFAGLLGSNSSTTPVSKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ +I
Sbjct: 55  LDLFVK-MGETYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYNVQRNQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN FD+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q ++Q+ 
Sbjct: 114 NIGFPNAFDRAHGYEGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTGALV-FGQPNVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NM  ++ +    FW  LK G+DYFE+ H+ P + I+N +YV  K 
Sbjct: 173 IYPFRMTDANMARHKYSVYTDFWKQLKPGYDYFEQTHKPPVVSIVNGRYVVSKP 226


>gi|261822679|ref|YP_003260785.1| ErfK/YbiS/YcfS/YnhG family protein [Pectobacterium wasabiae WPP163]
 gi|261606692|gb|ACX89178.1| ErfK/YbiS/YcfS/YnhG family protein [Pectobacterium wasabiae WPP163]
          Length = 244

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 95/234 (40%), Positives = 134/234 (57%), Gaps = 6/234 (2%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   L FA+  FL     + +  + +         I+ + K+     P  I+IFK E I
Sbjct: 1   MQKIALSFAMLFFLPSLVVTSAASETS----PPLAPIAKELKQQLLGSPIYIQIFKEERI 56

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
            E++ + V  EY LL++Y IC +SG  GPK   GD ++PEGFY +    L P+S Y+ +I
Sbjct: 57  FELYAK-VGNEYRLLEQYPICKYSGGLGPKRVEGDLKSPEGFYQVDLRQLKPDSHYYRAI 115

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN++DK+   +G  LMIHGEC S GCYAM N  M  IY     +LR N Q+ I I 
Sbjct: 116 NIGFPNDYDKSQGYSGRYLMIHGECVSVGCYAMTNNYMDVIYRYAEAALR-NGQAKIDIA 174

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT +NMQ ++N+   SFW  L+ G+ YF +++Q P I + N QYV    
Sbjct: 175 IYPFRMTEQNMQRHRNSTYASFWKQLQPGYAYFNQHNQPPAITVFNGQYVVNPP 228


>gi|146310424|ref|YP_001175498.1| hypothetical protein Ent638_0761 [Enterobacter sp. 638]
 gi|145317300|gb|ABP59447.1| protein of unknown function DUF949 [Enterobacter sp. 638]
          Length = 246

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 131/234 (55%), Gaps = 8/234 (3%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   L  A+   L  C     L+       S    IS + K+     P  I+IFK E  
Sbjct: 1   MRKIALFIAML--LIPCLSFAGLLSSN----SSTTPISKEYKQQLMGSPVYIQIFKEERT 54

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L+++ + +   Y LL  YKIC++SG  GPK   GD ++PEGFY +  N L P+S+++ +I
Sbjct: 55  LDLFVK-MGETYQLLDSYKICSYSGGLGPKQRQGDFKSPEGFYTVQRNQLKPDSRFYKAI 113

Query: 123 NIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQ 182
           NIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q+ +Q+ 
Sbjct: 114 NIGFPNAYDRAHGYDGKYLMIHGACVSIGCYAMTDGGIDEIFQFVTGALV-FGQAGVQVS 172

Query: 183 AFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + + + +Y+  K 
Sbjct: 173 IYPFRMTDANMQRHKFSTYSEFWKQLKPGYDYFEQTHKPPTVSVADGRYIVSKP 226


>gi|237730216|ref|ZP_04560697.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905755|gb|EEH91673.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 246

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 88/236 (37%), Positives = 129/236 (54%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+  +         +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLLPCVSFAGLLSSSSP----TTPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +    L P+S+++ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVQRGQLKPDSRFYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    QS +Q
Sbjct: 112 AINIGFPNAYDRAHGYEGKYLMIHGACVSVGCYAMTDNGIDEIFQFVTGALV-FGQSSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+  + P + ++N +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKFSYYKDFWAQLKPGYDYFEQTRKPPTVSVVNGRYVVSKP 226


>gi|242238374|ref|YP_002986555.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya dadantii Ech703]
 gi|242130431|gb|ACS84733.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya dadantii Ech703]
          Length = 249

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 89/227 (39%), Positives = 132/227 (58%), Gaps = 2/227 (0%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWK 67
           L  A+  FL     +      A    +       Q ++++   P  I+IFK E +LE++ 
Sbjct: 6   LSLAMLFFLPSVAINSHAAQTAPVTTNTTQQPLQQPQQSAIGSPVYIQIFKEERVLELYS 65

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP 127
           ++   +Y L++ Y IC +SG  GPK   GD ++PEGFY +    L P+S+Y+ +IN+GFP
Sbjct: 66  KS-GNDYRLVQSYPICKFSGGLGPKKTEGDFKSPEGFYQVDLRQLKPDSRYYRAINVGFP 124

Query: 128 NEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFR 187
           NE+D+A   +G  LMIHGEC S GCYAM NK + EIY  V  +LR N Q  + I  +PFR
Sbjct: 125 NEYDRAQGYSGRYLMIHGECVSIGCYAMTNKSIDEIYTYVEKALR-NGQQKVDIAIYPFR 183

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           MT +NM+ +  + +Y FW+ L+ G+ +F   HQ P + + N QYV  
Sbjct: 184 MTEQNMKRHSRSVDYKFWSQLQPGYAFFNLTHQPPAVSVANGQYVIN 230


>gi|16759307|ref|NP_454924.1| hypothetical protein STY0357 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16763695|ref|NP_459310.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29142920|ref|NP_806262.1| hypothetical protein t2538 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56414560|ref|YP_151635.1| hypothetical protein SPA2443 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161615518|ref|YP_001589483.1| hypothetical protein SPAB_03290 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553102|ref|ZP_02346852.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167993330|ref|ZP_02574425.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168232267|ref|ZP_02657325.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238582|ref|ZP_02663640.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168240051|ref|ZP_02664983.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168261273|ref|ZP_02683246.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168465386|ref|ZP_02699268.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168819097|ref|ZP_02831097.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445276|ref|YP_002039554.1| hypothetical protein SNSL254_A0351 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451114|ref|YP_002044296.1| hypothetical protein SeHA_C0353 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469639|ref|ZP_03075623.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194738370|ref|YP_002113338.1| hypothetical protein SeSA_A0361 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251197|ref|YP_002145294.1| hypothetical protein SeAg_B0346 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264992|ref|ZP_03165066.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197363490|ref|YP_002143127.1| hypothetical protein SSPA2281 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198244473|ref|YP_002214267.1| hypothetical protein SeD_A0342 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389854|ref|ZP_03216465.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204926845|ref|ZP_03218047.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205351636|ref|YP_002225437.1| hypothetical protein SG0323 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207855797|ref|YP_002242448.1| hypothetical protein SEN0295 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213162132|ref|ZP_03347842.1| hypothetical protein Salmoneentericaenterica_19903 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213425139|ref|ZP_03357889.1| hypothetical protein SentesTyphi_05232 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580522|ref|ZP_03362348.1| hypothetical protein SentesTyph_04605 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213649645|ref|ZP_03379698.1| hypothetical protein SentesTy_21510 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852431|ref|ZP_03381963.1| hypothetical protein SentesT_05809 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238913298|ref|ZP_04657135.1| hypothetical protein SentesTe_19534 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|25359104|pir||AF0542 probable exported protein STY0357 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16418814|gb|AAL19269.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16501598|emb|CAD08782.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138552|gb|AAO70122.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56128817|gb|AAV78323.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161364882|gb|ABX68650.1| hypothetical protein SPAB_03290 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403939|gb|ACF64161.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409418|gb|ACF69637.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194456003|gb|EDX44842.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194713872|gb|ACF93093.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195631687|gb|EDX50207.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197094967|emb|CAR60504.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214900|gb|ACH52297.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243247|gb|EDY25867.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288566|gb|EDY27943.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938989|gb|ACH76322.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199602299|gb|EDZ00845.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204323510|gb|EDZ08705.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205271417|emb|CAR36225.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322377|gb|EDZ10216.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205328600|gb|EDZ15364.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333436|gb|EDZ20200.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205339945|gb|EDZ26709.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205344088|gb|EDZ30852.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205349892|gb|EDZ36523.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206707600|emb|CAR31882.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261245538|emb|CBG23332.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992006|gb|ACY86891.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301156928|emb|CBW16409.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911281|dbj|BAJ35255.1| hypothetical protein STMDT12_C03120 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320084567|emb|CBY94359.1| Uncharacterized protein yafK Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224973|gb|EFX50034.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322614605|gb|EFY11534.1| hypothetical protein SEEM315_18260 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620124|gb|EFY16996.1| hypothetical protein SEEM971_15976 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623418|gb|EFY20257.1| hypothetical protein SEEM973_06381 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629284|gb|EFY26063.1| hypothetical protein SEEM974_10053 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632004|gb|EFY28758.1| hypothetical protein SEEM201_09219 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637258|gb|EFY33960.1| hypothetical protein SEEM202_19419 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642455|gb|EFY39057.1| hypothetical protein SEEM954_06651 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646291|gb|EFY42805.1| hypothetical protein SEEM054_13439 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652440|gb|EFY48794.1| hypothetical protein SEEM675_07516 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653398|gb|EFY49731.1| hypothetical protein SEEM965_19094 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660454|gb|EFY56690.1| hypothetical protein SEEM19N_20333 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664606|gb|EFY60799.1| hypothetical protein SEEM801_06827 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669341|gb|EFY65491.1| hypothetical protein SEEM507_01020 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670887|gb|EFY67020.1| hypothetical protein SEEM877_06777 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678874|gb|EFY74929.1| hypothetical protein SEEM867_12580 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681903|gb|EFY77928.1| hypothetical protein SEEM180_16648 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322688029|gb|EFY83995.1| hypothetical protein SEEM600_10966 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323128630|gb|ADX16060.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194384|gb|EFZ79579.1| hypothetical protein SEEM581_21779 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323197799|gb|EFZ82931.1| hypothetical protein SEEM501_21865 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203405|gb|EFZ88430.1| hypothetical protein SEEM460_07235 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206850|gb|EFZ91803.1| hypothetical protein SEEM020_02859 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210381|gb|EFZ95273.1| hypothetical protein SEEM6152_05557 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214623|gb|EFZ99374.1| hypothetical protein SEEM0077_18315 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323223179|gb|EGA07522.1| hypothetical protein SEEM0047_02263 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224850|gb|EGA09113.1| hypothetical protein SEEM0055_09708 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230054|gb|EGA14174.1| hypothetical protein SEEM0052_01612 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233792|gb|EGA17881.1| hypothetical protein SEEM3312_07268 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238514|gb|EGA22572.1| hypothetical protein SEEM5258_09642 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244202|gb|EGA28211.1| hypothetical protein SEEM1156_09570 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246362|gb|EGA30345.1| hypothetical protein SEEM9199_11783 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251988|gb|EGA35851.1| hypothetical protein SEEM8282_14497 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257985|gb|EGA41664.1| hypothetical protein SEEM8283_03816 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259918|gb|EGA43549.1| hypothetical protein SEEM8284_22115 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323265068|gb|EGA48567.1| hypothetical protein SEEM8285_20274 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323272631|gb|EGA56038.1| hypothetical protein SEEM8287_15049 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622011|gb|EGE28356.1| Putative L,D-transpeptidase YafK [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326626667|gb|EGE33010.1| Putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332987261|gb|AEF06244.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 246

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 130/236 (55%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+  +         +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLMPCVSFAGLLSSSSP----VTPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q
Sbjct: 112 AINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV-FGQPSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++ +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKP 226


>gi|271501763|ref|YP_003334789.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya dadantii Ech586]
 gi|270345318|gb|ACZ78083.1| ErfK/YbiS/YcfS/YnhG family protein [Dickeya dadantii Ech586]
          Length = 241

 Score =  279 bits (713), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 90/230 (39%), Positives = 136/230 (59%), Gaps = 9/230 (3%)

Query: 10  FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRN 69
            A+   L     S S  ++          ++ + K+     P  I+IFK E +LE++   
Sbjct: 8   LAMLFILPSVAISNSYANQVSP-------VATETKQQVAGSPVYIQIFKEERVLELYAM- 59

Query: 70  VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE 129
           +  EY L++ Y IC +SG  GPK+  GD ++PEGFY +    L P+S Y+ +IN+GFPNE
Sbjct: 60  IGGEYKLVQSYPICKYSGGLGPKMTEGDFKSPEGFYQVDLKQLKPDSHYYRAINVGFPNE 119

Query: 130 FDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMT 189
           +D+AH  +G  LMIHGEC S GCYAM NK ++EIY  V  +LR N Q  +++  +PFRMT
Sbjct: 120 YDRAHGYSGRYLMIHGECVSIGCYAMTNKYIEEIYTYVEKALR-NGQQKVELAIYPFRMT 178

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
            +NM+ +  +  Y FW+ L+ G+ YF + HQ P + ++N QYV  +   +
Sbjct: 179 EQNMKRHSRSNYYKFWSQLQPGYAYFNRMHQPPAVSVLNGQYVVNQSAPV 228


>gi|238793948|ref|ZP_04637567.1| hypothetical protein yinte0001_28550 [Yersinia intermedia ATCC
           29909]
 gi|238726715|gb|EEQ18250.1| hypothetical protein yinte0001_28550 [Yersinia intermedia ATCC
           29909]
          Length = 235

 Score =  279 bits (713), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 89/217 (41%), Positives = 130/217 (59%), Gaps = 6/217 (2%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
            + S    A  P++    +S + K+        I+IFK E  LE++ R +  EY L++ Y
Sbjct: 4   PAVSFTSSASEPVA----VSKELKQQLLGSSVYIQIFKEERTLELYAR-LQGEYRLVQSY 58

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGAD 140
           +IC +SG  GPK   GD ++PEGFY I   +L P+SK++ +INIGFPN++DK+   +G  
Sbjct: 59  RICEFSGGLGPKRREGDFKSPEGFYSIDMRHLKPDSKFYRAINIGFPNDYDKSQGYSGKY 118

Query: 141 LMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNP 200
           LMIHG C S GCYAM +  M EI+  V+ +     Q  + I  +PFRMT +NMQ ++N+ 
Sbjct: 119 LMIHGACKSIGCYAMTDAYMDEIFNYVQTAF-IFGQEKVDISIYPFRMTEQNMQRHRNSS 177

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +YSFW  L+ G+ YF KN   P + +IN QYV  +  
Sbjct: 178 DYSFWRQLQPGYAYFTKNRMPPSVAVINGQYVLSRPP 214


>gi|304395395|ref|ZP_07377278.1| ErfK/YbiS/YcfS/YnhG family protein [Pantoea sp. aB]
 gi|304356689|gb|EFM21053.1| ErfK/YbiS/YcfS/YnhG family protein [Pantoea sp. aB]
          Length = 248

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 93/232 (40%), Positives = 132/232 (56%), Gaps = 8/232 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I L     + +       P+     +S + K+     P  I+IFK E  LE+
Sbjct: 4   IALLFAM-ILLPALSMAMTP-----EPVQTAAPVSKELKKQLLGTPVYIQIFKEERTLEL 57

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  EY LL  Y+IC +SG  GPK   GD ++PEGFY +  N L P+S+++ +INIG
Sbjct: 58  Y-GKIGNEYRLLDTYRICNFSGGLGPKRREGDFKSPEGFYNVKLNQLKPDSRFYRAINIG 116

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN+FD+    +G  LMIHG+C S GCYAM N  M EI+  V  +LR N Q  + I  +P
Sbjct: 117 FPNQFDRNQGYSGNYLMIHGDCKSIGCYAMTNAYMDEIFTYVNAALR-NGQQDVSISIYP 175

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT  NMQ ++ + + SFW  L+ G+ YF K HQ P + + + +YV     
Sbjct: 176 FRMTDSNMQRHRYSSDASFWQQLQPGYAYFAKYHQPPTVNVASGKYVMNSSP 227


>gi|227329184|ref|ZP_03833208.1| hypothetical protein PcarcW_18350 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 231

 Score =  278 bits (711), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 92/216 (42%), Positives = 128/216 (59%), Gaps = 2/216 (0%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
            S  +   A         I+ + K+     P  I+IFK E I E++ + V  EY LL++Y
Sbjct: 2   PSLVVTSAASETAPPLAPIAKELKQQLLGSPIYIQIFKEERIFELYAK-VGNEYRLLEQY 60

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGAD 140
            IC +SG  GPK   GD ++PEGFY +    L P+S+Y+ +INIGFPN++DK+   +G  
Sbjct: 61  PICKYSGGLGPKRVEGDLKSPEGFYQVDLRQLKPDSQYYRAINIGFPNDYDKSQGYSGRY 120

Query: 141 LMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNP 200
           LMIHGEC S GCYAM N  M EIY     +LR N Q+ I I  +PFRMT +NMQ ++N+ 
Sbjct: 121 LMIHGECVSVGCYAMTNTYMDEIYRYAEAALR-NGQAKIDIAIYPFRMTEQNMQRHRNST 179

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
             SFW  L+ G+ YF +++Q P + + N QYV    
Sbjct: 180 YASFWKQLQPGYAYFNQHNQPPAVTVFNGQYVVNPP 215


>gi|213622012|ref|ZP_03374795.1| hypothetical protein SentesTyp_32601 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 242

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 89/227 (39%), Positives = 130/227 (57%), Gaps = 6/227 (2%)

Query: 10  FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRN 69
           F L + L  C     L+  +         +S + K+     P  I+IFK E  L+++ + 
Sbjct: 2   FFLAMLLMPCVSFAGLLSSSSP----VTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK- 56

Query: 70  VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE 129
           +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ +INIGFPN 
Sbjct: 57  MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYKAINIGFPNA 116

Query: 130 FDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMT 189
           +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q+  +PFRMT
Sbjct: 117 YDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV-FGQPSVQVSIYPFRMT 175

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
             NMQ ++ +    FW  LK G+DYFE+ H+ P + I++ +YV  K 
Sbjct: 176 DANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKP 222


>gi|238918831|ref|YP_002932345.1| hypothetical protein NT01EI_0895 [Edwardsiella ictaluri 93-146]
 gi|238868398|gb|ACR68109.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 240

 Score =  277 bits (710), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 128/238 (53%), Gaps = 12/238 (5%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     IL   L + L     S S             I  +    +       I+IFK E
Sbjct: 1   MGKIVAILAICLTLPLAASKSSASESG----------ITPLNDANSLLGSQVYIQIFKEE 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++ +  D +Y L+K + IC +SG  GPK   GD ++PEGFY I   +L P+S+Y+ 
Sbjct: 51  RQLELYAKVQD-KYRLVKSFPICKFSGGLGPKRTEGDFKSPEGFYQIDARHLKPDSRYYQ 109

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIG+PN FD++H  +G  LMIHG+C S GCYAM N  + EIY  V+ + R   Q+ + 
Sbjct: 110 AINIGYPNSFDQSHGYSGNYLMIHGDCVSIGCYAMTNDGISEIYRYVQSAFRS-GQTLVN 168

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           I  +PFRMT +NMQL++N+    FW  L+ G+ YF +N   P + + + +YV      
Sbjct: 169 INIYPFRMTDRNMQLHRNSSYIGFWRQLQPGYQYFAQNALPPQVNVQDGRYVVSGALP 226


>gi|161504584|ref|YP_001571696.1| hypothetical protein SARI_02698 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865931|gb|ABX22554.1| hypothetical protein SARI_02698 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 246

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 130/236 (55%), Gaps = 10/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L     + L  C     L+  +         +S + K+     P  I+IFK E
Sbjct: 1   MRKIAFFL----AMLLMPCVSLAGLLSSSSP----VTPVSKEYKQQLMGSPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ 
Sbjct: 53  RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYK 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q
Sbjct: 112 AINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAAL-IFGQPSVQ 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++ +YV  K 
Sbjct: 171 VSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPIVSIVDGRYVVSKP 226


>gi|37525163|ref|NP_928507.1| hypothetical protein plu1195 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784589|emb|CAE13489.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 247

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 97/237 (40%), Positives = 126/237 (53%), Gaps = 8/237 (3%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M            I L     +            + L+   Q     P  P  I+IFK E
Sbjct: 1   MKKIAAFPAIITIILLLFSSFTPVYTQ-------DTLVQLQQNFPVQPGSPVFIQIFKEE 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            ILE++ +N    Y L K Y IC +SG  GPK   GD ++PEGFY +  + LNPNS+Y+ 
Sbjct: 54  RILELYTKNSHGSYQLSKSYPICNYSGGLGPKTTEGDLKSPEGFYRVKTHQLNPNSRYYR 113

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           SIN+GFPNE+DK    +G  LMIHGEC S GCYAM N  M EIY  V  +L    Q  I 
Sbjct: 114 SINLGFPNEYDKFRGYSGNYLMIHGECKSVGCYAMTNGYMDEIYHYVESALL-RGQYEIN 172

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           I  +PFRMT +NM  ++++ +Y FW  L+  ++YF KNHQ   + IIN QYV     
Sbjct: 173 ISIYPFRMTPQNMLRHRSSSHYMFWLQLQPAYEYFAKNHQPATVSIINGQYVVNATP 229


>gi|261346249|ref|ZP_05973893.1| putative membrane protein [Providencia rustigianii DSM 4541]
 gi|282565557|gb|EFB71092.1| putative membrane protein [Providencia rustigianii DSM 4541]
          Length = 245

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 88/209 (42%), Positives = 122/209 (58%), Gaps = 1/209 (0%)

Query: 29  AEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGT 88
                 E LI   ++          I+IFK E +LE++++  D ++ L+K Y IC +SG 
Sbjct: 19  VNAQNKETLINLNERANIEQKSSIFIQIFKQEGVLELYQKASDGKFKLVKTYPICKFSGG 78

Query: 89  FGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA 148
            GPK   GD ++PEGFY I    LNPNS+++ SIN+GFPN+FDKA   TG  LMIHG C 
Sbjct: 79  LGPKKIEGDLKSPEGFYQITAEQLNPNSQFYRSINLGFPNDFDKAQGYTGNYLMIHGSCV 138

Query: 149 SAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNML 208
           S GCYAM +K M EIY  V  +L+ N Q  I +  +PFRMT  NM  Y+N+ +Y+FW  L
Sbjct: 139 STGCYAMTDKSMGEIYQTVERALQ-NGQPIIDVNIYPFRMTKTNMLRYRNSSHYAFWKQL 197

Query: 209 KLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           +  +DYFE+      + +I  +Y      
Sbjct: 198 QPAYDYFERTKTPAEVSVILGKYNVNSMP 226


>gi|300715465|ref|YP_003740268.1| hypothetical protein EbC_08790 [Erwinia billingiae Eb661]
 gi|299061301|emb|CAX58410.1| Putative exported protein [Erwinia billingiae Eb661]
          Length = 246

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 87/234 (37%), Positives = 132/234 (56%), Gaps = 7/234 (2%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ IFL     +         P+     +S + K+     P  I+IFK E  LE+
Sbjct: 4   IALLFAM-IFLPAVVFASVPTS----PVLPLAPVSKELKKQLLGTPVYIQIFKEERTLEL 58

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  +Y LL  Y+IC +SG  GPK   GD ++PEGFY +G + L P+S+++ +IN+G
Sbjct: 59  Y-GKIGNDYRLLDSYRICNFSGGLGPKRRQGDFKSPEGFYSVGLSQLKPDSRFYRAINVG 117

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPNE+D+     G  LMIHG C S GCYAM +  + +IY  V  +LR N Q  +++  +P
Sbjct: 118 FPNEYDRQQGYEGKYLMIHGSCVSIGCYAMTDANIADIYQFVDAALR-NGQPRVEVSIYP 176

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           FRMT  N+Q ++N+  YSFW  L+ G+  F +N   P + +    YV  +  ++
Sbjct: 177 FRMTDSNLQRHRNSVYYSFWKQLQPGYAQFVQNRLPPSVSVNEGHYVLNQPGSL 230


>gi|22124856|ref|NP_668279.1| hypothetical protein y0949 [Yersinia pestis KIM 10]
 gi|108811018|ref|YP_646785.1| hypothetical protein YPN_0853 [Yersinia pestis Nepal516]
 gi|229901240|ref|ZP_04516362.1| putative exported protein precursor [Yersinia pestis Nepal516]
 gi|270489430|ref|ZP_06206504.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|21957687|gb|AAM84530.1|AE013698_4 hypothetical protein y0949 [Yersinia pestis KIM 10]
 gi|108774666|gb|ABG17185.1| hypothetical protein YPN_0853 [Yersinia pestis Nepal516]
 gi|229681169|gb|EEO77263.1| putative exported protein precursor [Yersinia pestis Nepal516]
 gi|270337934|gb|EFA48711.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|320016430|gb|ADW00002.1| putative exported protein precursor [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 220

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 81/199 (40%), Positives = 120/199 (60%), Gaps = 2/199 (1%)

Query: 39  ISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDE 98
           +S + K+        I+IFK E +LE++ + +  EY L++ Y IC +SG  GPK   GD 
Sbjct: 3   VSKELKQQLLGSSVYIQIFKEERVLELYAK-LQGEYRLVQSYPICEFSGGLGPKRREGDF 61

Query: 99  QAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNK 158
           ++PEGFY I   +L P+S+++ +INIGFPN++DK+   +G  LMIHG C S GCYAM + 
Sbjct: 62  KSPEGFYRINTRHLKPDSQFYRAINIGFPNDYDKSQGYSGKYLMIHGACKSIGCYAMTDA 121

Query: 159 QMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKN 218
            M EI+  VR +     Q  + I  +PFRMT +N+Q ++N+   +FW  L+ G+ YF KN
Sbjct: 122 YMDEIFNYVRTAF-IFGQEKVDISIYPFRMTEQNIQRHRNSSYSNFWRQLQPGYTYFAKN 180

Query: 219 HQEPFIQIINKQYVFFKGQ 237
              P + + N QYV     
Sbjct: 181 RMPPPVSVSNGQYVLSPPP 199


>gi|308185804|ref|YP_003929935.1| hypothetical protein Pvag_0272 [Pantoea vagans C9-1]
 gi|308056314|gb|ADO08486.1| Uncharacterized protein yafK precursor [Pantoea vagans C9-1]
          Length = 247

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 91/232 (39%), Positives = 132/232 (56%), Gaps = 9/232 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ I L     + +    +  P+S+ L   +         P  I+IFK E  LE+
Sbjct: 4   IALLFAM-ILLPALSMAMTPEPVSAAPVSKELKKQL------LGTPVYIQIFKEERTLEL 56

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  E+ LL  Y+IC +SG  GPK   GD ++PEGFY +  N L P+S+++ +INIG
Sbjct: 57  Y-GKIGNEFRLLDTYRICNFSGGLGPKRREGDFKSPEGFYNVKLNQLKPDSRFYRAINIG 115

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++D+    +G  LMIHG+C S GCYAM N  M EI+  V  +LR N Q  + I  +P
Sbjct: 116 FPNQYDRNQGYSGNYLMIHGDCKSIGCYAMTNAYMDEIFTYVNAALR-NGQQDVGISIYP 174

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           FRMT  NMQ ++ + + SFW  L+ G+ YF K HQ P + + + +YV     
Sbjct: 175 FRMTDSNMQRHRYSSDASFWQQLQPGYAYFAKYHQPPMVNVASGKYVMNSSP 226


>gi|218780861|ref|YP_002432179.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762245|gb|ACL04711.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 239

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 85/216 (39%), Positives = 124/216 (57%), Gaps = 3/216 (1%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
            S +   +    ++ +L     +   +   P  +RIFK E  LE+W       +   K Y
Sbjct: 25  PSSARSKEVIARIAPDLKKEFSQAGLTWGAPVFMRIFKKEKRLEVWVLK-GKRFQHFKSY 83

Query: 81  KI-CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGA 139
           KI        GPK+E GD +APEGFY++    +NP+S+Y L+ NIG+PN++D+ H RTG 
Sbjct: 84  KIFTYGLRGLGPKLEEGDWRAPEGFYFVPPKMMNPSSRYHLAFNIGYPNKYDRRHGRTGG 143

Query: 140 DLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNN 199
            +M+HG C S GCYAM +K+++EIY I   +LR N Q   ++  FPF MT KNM+ YQ++
Sbjct: 144 LIMVHGSCVSVGCYAMRDKRIEEIYTIADAALR-NGQPFFRVHIFPFEMTEKNMKKYQDD 202

Query: 200 PNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
             + FW  LK G+D FEKN   P   + + +YVF  
Sbjct: 203 DWFEFWRNLKQGYDLFEKNKTPPDADVKDGKYVFSP 238


>gi|292487367|ref|YP_003530239.1| hypothetical protein EAMY_0881 [Erwinia amylovora CFBP1430]
 gi|292898612|ref|YP_003537981.1| exported protein [Erwinia amylovora ATCC 49946]
 gi|291198460|emb|CBJ45568.1| putative exported protein [Erwinia amylovora ATCC 49946]
 gi|291552786|emb|CBA19831.1| Uncharacterized protein yafK precursor [Erwinia amylovora CFBP1430]
 gi|312171472|emb|CBX79730.1| Uncharacterized protein yafK precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 244

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 86/231 (37%), Positives = 129/231 (55%), Gaps = 8/231 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ IFL     +          ++    +S + ++     P  ++IFK E  LE+
Sbjct: 4   IALLFAM-IFLPAVVFAS-----VNETITPLAPVSKELRKQLIGIPVYLQIFKEERTLEL 57

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  EY LL  + IC +SG  GPK   GD ++PEGFY +  + L P+S+Y+ +IN+G
Sbjct: 58  Y-GKIGNEYRLLNSFPICKFSGGLGPKRVQGDFKSPEGFYSVSLSQLKPDSRYYRAINVG 116

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPNE+D+     G  LMIHG C S GCYAM +  M EIY  V  +LR N Q  I++  +P
Sbjct: 117 FPNEYDRQQGYQGKYLMIHGNCVSIGCYAMTDAYMDEIYRYVEAALR-NGQPRIEVSIYP 175

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           FRMT+ NMQ ++ +   +FW  L+ G+  FE+  Q P + +   +YV  + 
Sbjct: 176 FRMTASNMQRHRYSTYINFWKQLQPGYAQFEQTKQPPAVAVSAGKYVLSRP 226


>gi|317047049|ref|YP_004114697.1| ErfK/YbiS/YcfS/YnhG family protein [Pantoea sp. At-9b]
 gi|316948666|gb|ADU68141.1| ErfK/YbiS/YcfS/YnhG family protein [Pantoea sp. At-9b]
          Length = 248

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 92/240 (38%), Positives = 125/240 (52%), Gaps = 11/240 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L   +   L+              P++    +S + K+     P  I+IFK E
Sbjct: 1   MGRIALFLAMIVMPVLSWAMTP--------EPVNPQAPVSKELKKQLLGTPVYIQIFKEE 52

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++   +  EY LL  Y+IC +SG  GPK   GD ++PEGFY +  N L P+S Y+ 
Sbjct: 53  RTLELY-GKIGNEYRLLDSYRICNFSGGLGPKRREGDFKSPEGFYSVKLNQLKPDSHYYR 111

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +IN GFPN+FD+ +   G  LMIHG+C S GCYAM N  M EIY  V  +LR N Q  I 
Sbjct: 112 AINTGFPNQFDRDNGYNGKYLMIHGDCKSIGCYAMTNAYMDEIYTYVNAALR-NGQQEIA 170

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIIN-KQYVFFKGQTI 239
           +  FPFRMT  NMQ ++ +   SFW  L+ G+ YFEK  Q P + +    QY       +
Sbjct: 171 LSIFPFRMTDSNMQRHRYSTYASFWRQLQPGYAYFEKYRQPPTVNVTATGQYAVNSSPAV 230


>gi|310766742|gb|ADP11692.1| hypothetical protein EJP617_20110 [Erwinia sp. Ejp617]
          Length = 244

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 87/232 (37%), Positives = 128/232 (55%), Gaps = 7/232 (3%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           I L    IFL     +   +  A  PL+    +S + ++     P  ++IFK E  LE++
Sbjct: 4   IALLIAMIFLPAVVFAS--VPDAVTPLAP---VSKELRKQLIGVPVYLQIFKEERTLELY 58

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
              +  EY LL  Y IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +IN+GF
Sbjct: 59  -GKIGNEYRLLNSYPICKFSGGLGPKRVQGDFKSPEGFYSVSLSQLKPDSRFYRAINVGF 117

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PNE+D+     G  LMIHG C S GCYAM +  M EIY  V  +LR N Q  I++  +PF
Sbjct: 118 PNEYDRQQGYQGKYLMIHGSCVSIGCYAMTDAYMDEIYHYVEAALR-NGQPRIEVSIYPF 176

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           RMT  NMQ ++ +   +FW  L+ G+  F +  Q P + +   +YV  +  T
Sbjct: 177 RMTESNMQRHRYSTYINFWKQLQPGYAQFVQTKQPPAVAVSAGKYVLSRPLT 228


>gi|188534726|ref|YP_001908523.1| hypothetical protein ETA_26010 [Erwinia tasmaniensis Et1/99]
 gi|188029768|emb|CAO97647.1| Putative exported protein [Erwinia tasmaniensis Et1/99]
          Length = 244

 Score =  274 bits (702), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 87/233 (37%), Positives = 124/233 (53%), Gaps = 8/233 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+         S +       P+S+ L   +         P  ++IFK E  LE+
Sbjct: 4   IALLFAMIFLPAVVFASVTETATPLAPVSKELRKQL------IGVPVYLQIFKEERTLEL 57

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  EY LL  Y IC +SG  GPK   GD ++PEGFY +  + L PNS+++ +IN+G
Sbjct: 58  Y-GKIGNEYRLLNSYPICKFSGGLGPKRVQGDFKSPEGFYNVSLSQLKPNSRFYRAINVG 116

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPNE+D+     G  LMIHG C S GCYAM +  M EIY  V  +LR N Q  I +  +P
Sbjct: 117 FPNEYDRQQGYQGNYLMIHGSCVSIGCYAMTDAYMDEIYHYVEAALR-NGQPRIDVSIYP 175

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           FRMT  NMQ ++ +   +FW  L+ G+  F +  Q P + +   +YV  +  T
Sbjct: 176 FRMTESNMQRHRYSTYINFWKQLQPGYAQFVQTKQPPAMAVNAGKYVLDRPLT 228


>gi|300024685|ref|YP_003757296.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526506|gb|ADJ24975.1| ErfK/YbiS/YcfS/YnhG family protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 318

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 78/207 (37%), Positives = 120/207 (57%), Gaps = 2/207 (0%)

Query: 31  HPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG 90
            P    L   ++ K  +   P +IRIFK E+ LEIWK+     Y+L   Y IC WSGT G
Sbjct: 42  TPNVAFLQARLRDKGVTLADPILIRIFKAESELEIWKQKGGG-YILFATYPICHWSGTLG 100

Query: 91  PKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASA 150
           PK+  GD QAPEG+Y +  +      ++  S+++GFPN  D++  RTG+ +++HG C+S 
Sbjct: 101 PKLRDGDRQAPEGYYTLSRSQTRHVGRWPRSLDLGFPNILDQSQARTGSSILVHGGCSSI 160

Query: 151 GCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKL 210
           GC+AM N    EI+ +   ++ G  +  + +  FPFRMT KN+     +P  +FW  LK 
Sbjct: 161 GCFAMTNPVSDEIHQMTLAAMDG-GEQIVPVHVFPFRMTDKNLAAQDASPWKAFWTNLKE 219

Query: 211 GHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           G+D FE+  + P I + + +Y+F + Q
Sbjct: 220 GYDLFEQTKRPPIIGVCSGRYIFRETQ 246


>gi|269119360|ref|YP_003307537.1| ErfK/YbiS/YcfS/YnhG family protein [Sebaldella termitidis ATCC
           33386]
 gi|268613238|gb|ACZ07606.1| ErfK/YbiS/YcfS/YnhG family protein [Sebaldella termitidis ATCC
           33386]
          Length = 247

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 98/236 (41%), Positives = 142/236 (60%), Gaps = 10/236 (4%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKR---------TSPFHPTVIR 55
              L F +FI ++       +ID+ E  ++   + + + +              +P  IR
Sbjct: 9   VLALFFLVFIGISNKISFEKVIDEGEEIINTISLGNKEYRNSGEKGGQENIKTGNPLYIR 68

Query: 56  IFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN 115
           +FK E  LE+W +N    Y L K + IC +SG  GPK + GD+++PEGFYY   + LNPN
Sbjct: 69  VFKEEKELEMWIKNDSGTYSLYKVFDICTFSGGLGPKKKEGDKKSPEGFYYTQKSFLNPN 128

Query: 116 SKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNM 175
           S Y LS NIG+PNE+DK+H  TG+ +MIHG+C S GCYAM +K ++EIY +V  +L  N 
Sbjct: 129 SAYHLSFNIGYPNEYDKSHGYTGSLIMIHGDCLSIGCYAMTDKYIEEIYGLVEKTLN-NG 187

Query: 176 QSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQY 231
           Q  I +  FPF+MT+ NM+ ++ +  YSFW  LK G+DYFEKN   P + + NK+Y
Sbjct: 188 QEKINVDVFPFKMTAANMKRHKKSEYYSFWEELKPGYDYFEKNKIPPRMTVENKKY 243


>gi|212709370|ref|ZP_03317498.1| hypothetical protein PROVALCAL_00406 [Providencia alcalifaciens DSM
           30120]
 gi|212688282|gb|EEB47810.1| hypothetical protein PROVALCAL_00406 [Providencia alcalifaciens DSM
           30120]
          Length = 245

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 91/225 (40%), Positives = 123/225 (54%), Gaps = 9/225 (4%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
            +    C               + L     K  T P     I+IFK E +LE++++    
Sbjct: 11  LLITFACSS--------YAQKEDALFSLNNKPATQPDSSIFIQIFKQEGVLELYQKTAVG 62

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK 132
           +Y L+K Y IC +SG  GPK   GD ++PEGFY I  + LNPNS+Y+ SIN+GFPNEFDK
Sbjct: 63  KYKLVKTYPICKFSGGLGPKKMEGDLKSPEGFYQITHSQLNPNSRYYRSINLGFPNEFDK 122

Query: 133 AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
               +G  LMIHG C S GCYAM +K M EIY IV  +L+ N Q  I +  +PFRMT  N
Sbjct: 123 TQGYSGNYLMIHGSCVSVGCYAMTDKSMGEIYQIVEQALQ-NGQPAIDVSIYPFRMTKMN 181

Query: 193 MQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           M  Y+N+ +Y+FW  L+  +DYFE+      I +   +Y      
Sbjct: 182 MLRYRNSAHYAFWKQLQPAYDYFERTGNPAEISVTLGKYHVNSMP 226


>gi|62178883|ref|YP_215300.1| hypothetical protein SC0313 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62126516|gb|AAX64219.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322713335|gb|EFZ04906.1| hypothetical protein SCA50_0331 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 207

 Score =  272 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 82/188 (43%), Positives = 117/188 (62%), Gaps = 2/188 (1%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
             P  I+IFK E  L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY + 
Sbjct: 2   GSPVYIQIFKEERTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQ 60

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVR 168
            N L P+S+++ +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V 
Sbjct: 61  RNQLKPDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVT 120

Query: 169 DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIIN 228
            +L    Q  +Q+  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++
Sbjct: 121 AALV-FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVD 179

Query: 229 KQYVFFKG 236
            +YV  K 
Sbjct: 180 GRYVVSKP 187


>gi|183596299|ref|ZP_02958327.1| hypothetical protein PROSTU_00030 [Providencia stuartii ATCC 25827]
 gi|188023899|gb|EDU61939.1| hypothetical protein PROSTU_00030 [Providencia stuartii ATCC 25827]
          Length = 245

 Score =  272 bits (696), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 81/191 (42%), Positives = 118/191 (61%), Gaps = 1/191 (0%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                  I+IFK E +LE++++  + +Y L K Y IC +SG  GPK   GD ++PEGFY 
Sbjct: 37  QQNSAIFIQIFKQEGVLELYQKAPNGKYNLSKTYPICKFSGGLGPKKREGDLKSPEGFYQ 96

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAI 166
           I  + LNPNS+Y+ SIN+GFPNE+D+A    G  LMIHG+C S GCYAM +K M EIY  
Sbjct: 97  ITASQLNPNSRYYRSINLGFPNEYDRAQGYEGNYLMIHGDCVSVGCYAMTDKYMSEIYQT 156

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQI 226
           V  + +   Q+ I +  +PFRMT +NM +++N+ +Y+FW  LK  +DYF+   +   I +
Sbjct: 157 VESAFKS-GQNTIDVSIYPFRMTKENMLIHRNSSHYAFWQQLKPAYDYFQDAGKPAQISV 215

Query: 227 INKQYVFFKGQ 237
            + +Y      
Sbjct: 216 TSGKYAVNSLP 226


>gi|259909352|ref|YP_002649708.1| hypothetical protein EpC_27230 [Erwinia pyrifoliae Ep1/96]
 gi|224964974|emb|CAX56502.1| Putative exported protein [Erwinia pyrifoliae Ep1/96]
 gi|283479424|emb|CAY75340.1| Uncharacterized protein yafK precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 243

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 86/230 (37%), Positives = 127/230 (55%), Gaps = 7/230 (3%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           I L    IFL     +   +  A  PL+    +S + ++     P  ++IFK E  LE++
Sbjct: 4   IALLIAMIFLPAVVFAS--VPDAVTPLAP---VSKELRKQLIGVPVYLQIFKEERTLELY 58

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
              +  EY LL  Y IC +SG  GPK   GD ++PEGFY +  + L P+S+++ +IN+GF
Sbjct: 59  -GKIGNEYRLLNSYPICKFSGGLGPKRVQGDFKSPEGFYSVSLSQLKPDSRFYRAINVGF 117

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PNE+D+     G  LMIHG C S GCYAM +  M EIY  V  +LR N Q  I++  +PF
Sbjct: 118 PNEYDRQQGYQGKYLMIHGSCVSIGCYAMTDAYMDEIYHHVEAALR-NGQPRIEVSIYPF 176

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           RMT  NMQ ++ +   +FW  L+ G+  F +  Q P + +   +YV  + 
Sbjct: 177 RMTESNMQRHRYSTYINFWKQLQPGYAQFVQTKQPPAVAVSAGKYVLSRP 226


>gi|320540146|ref|ZP_08039801.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029812|gb|EFW11836.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 253

 Score =  271 bits (694), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 132/237 (55%), Gaps = 15/237 (6%)

Query: 1   MTNRYN-ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M        +F     L  C         A   L    ++  Q        P  I+IFK 
Sbjct: 1   MGKIALWFAMFLAMPILTACS--------ANTQLPALPVVQQQL----VGAPVYIQIFKE 48

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           E  LE++ + +  ++ L K ++IC++SG  GPK + GD ++PEGFY I   +L P+S+Y+
Sbjct: 49  ERTLELYTK-IGDQFRLAKSFRICSFSGGLGPKRQQGDFKSPEGFYSIDVRHLKPDSQYY 107

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179
            +INIGFPN++DKA   +GA LMIHGEC S GCYAM N  M EIY  V  +     QS I
Sbjct: 108 RAINIGFPNDYDKAQGYSGAYLMIHGECKSIGCYAMTNTAMGEIYRYVAAAF-AYGQSRI 166

Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
            I  +PFRMT +N+Q ++++   +FW  L+ G++YF KN Q P + + N QYV  + 
Sbjct: 167 DISIYPFRMTKQNLQRHRSSSYIAFWRQLEPGYNYFVKNQQPPRMAVANGQYVLNRP 223


>gi|322831680|ref|YP_004211707.1| ErfK/YbiS/YcfS/YnhG family protein [Rahnella sp. Y9602]
 gi|321166881|gb|ADW72580.1| ErfK/YbiS/YcfS/YnhG family protein [Rahnella sp. Y9602]
          Length = 241

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 136/236 (57%), Gaps = 11/236 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L   L + L   +++ +         S+ + ++   K+     P  I+IFK E
Sbjct: 1   MIRIALFLAMLLSLPLFTANYAVA---------SDAVPVNAALKKQLLGAPVYIQIFKQE 51

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             LE++ + +D E+ L+  Y IC +SG  G K   GD ++PEGFY +  ++L P+S+++ 
Sbjct: 52  RKLELYAQ-LDGEFRLIGSYGICDFSGGLGNKRREGDFKSPEGFYNVDIHHLKPDSRFYR 110

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D +   +G  LMIHG C S GCYAM +  M EI+  V+ + +   Q +++
Sbjct: 111 AINIGFPNAYDISQGYSGKYLMIHGNCKSIGCYAMTDGYMDEIFTYVQAAFQ-FGQRNLK 169

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           I  +PFRMT  NM+ ++N+  YSFWN L+ G+ YFEK+HQ P + + + +Y   + 
Sbjct: 170 ISIYPFRMTDANMKAHKNSSYYSFWNQLQPGYAYFEKHHQPPNVVVTDGRYEVLQP 225


>gi|329296658|ref|ZP_08253994.1| ErfK/YbiS/YcfS/YnhG family protein [Plautia stali symbiont]
          Length = 247

 Score =  267 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 90/235 (38%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
             LLFA+ +                 P+     +S + K+     P  I+IFK E  LE+
Sbjct: 4   IALLFAMILM------PLLSWAMTPEPMQPLAPVSKELKKQLLGTPVFIQIFKEERTLEL 57

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           +   +  EY LL  Y+IC  SG  GPK   GD ++PEGFY +  N L P+S+++ +IN G
Sbjct: 58  Y-GKIGNEYRLLDSYRICNISGGLGPKRRQGDFKSPEGFYNVKMNQLKPDSRFYRAINTG 116

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           FPN++D+A    G  LMIHG+C S GCYAM N  M EI+  V  +LR N Q  +Q+  FP
Sbjct: 117 FPNQYDRAKGYNGNYLMIHGDCVSVGCYAMTNASMDEIFTYVNAALR-NGQQDVQVNIFP 175

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIIN-KQYVFFKGQTI 239
           FRMT  NMQ ++ +   SFW  L+ G+ YF K H  P + +    QY       +
Sbjct: 176 FRMTDSNMQRHRYSTYISFWRELQPGYAYFAKYHVPPTVNVTATGQYAVNNTPVM 230


>gi|296446177|ref|ZP_06888125.1| ErfK/YbiS/YcfS/YnhG family protein [Methylosinus trichosporium
           OB3b]
 gi|296256371|gb|EFH03450.1| ErfK/YbiS/YcfS/YnhG family protein [Methylosinus trichosporium
           OB3b]
          Length = 387

 Score =  267 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 79/215 (36%), Positives = 111/215 (51%), Gaps = 15/215 (6%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           S   +   +           +RIFK E  LE+W +  D  Y L K Y IC WSG  GPK+
Sbjct: 165 SPGPLQRREDGNFRLGAAAYVRIFKKEGELELWLK-RDGRYSLYKTYPICKWSGRLGPKL 223

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCY 153
            +GD Q+PEGFY +    L+P+S Y  + NIGFPN +D+ + RTG  LM+HG C S GC+
Sbjct: 224 RSGDYQSPEGFYSVSARQLHPSSAYHRAFNIGFPNAYDRQNGRTGGALMVHGACKSVGCF 283

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLY-------------QNNP 200
           AM +K ++EIY +V  +LR   Q  + +  FPFRMT + +                +   
Sbjct: 284 AMTDKVIEEIYGVVEAALRA-GQHEVPVHIFPFRMTEEALAKETRGDWSTFWAVPPEYQQ 342

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
             +FW  LK G+D FE+  + P       +Y F  
Sbjct: 343 WTAFWQNLKEGYDLFERTGEPPTAYACGARYGFAA 377


>gi|187735088|ref|YP_001877200.1| protein of unknown function DUF949 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425140|gb|ACD04419.1| protein of unknown function DUF949 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 244

 Score =  262 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 74/223 (33%), Positives = 121/223 (54%), Gaps = 3/223 (1%)

Query: 13  FIFLNGCHH-SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR-NV 70
            +F   C   S +  D A   ++  L   ++        P  +R  K +++LE+W + + 
Sbjct: 20  AVFNMACAEKSSNRADIARKRVTPVLNSFLEPCGARVGSPVFLRAVKEDSVLELWVKPDK 79

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEF 130
              Y+L K Y I AWSG  GPK + GD Q PEGFY +  + LNP S Y LS NIG+PN +
Sbjct: 80  SECYMLAKRYPIAAWSGKLGPKEKEGDRQTPEGFYEVEPSGLNPRSNYHLSFNIGYPNAY 139

Query: 131 DKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTS 190
           D++ NRTG+ +M+HG   S GC AM +  ++EIY +V  +L  + Q ++ +Q +PF  T 
Sbjct: 140 DRSLNRTGSFIMVHGRDVSIGCLAMTDSGIEEIYTMVEQALV-HGQKNVPVQIYPFVPTP 198

Query: 191 KNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             +   +++P+ +FW  +    D+ E+      ++ +N + V 
Sbjct: 199 ARLSEEKDSPHAAFWADMARAWDWTERTRTPARVKAVNGRLVV 241


>gi|197284252|ref|YP_002150124.1| hypothetical protein PMI0351 [Proteus mirabilis HI4320]
 gi|194681739|emb|CAR40910.1| putative exported protein [Proteus mirabilis HI4320]
          Length = 250

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 81/228 (35%), Positives = 126/228 (55%), Gaps = 12/228 (5%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +++F   I  +   ++ +       P+ ++              P  I+IFK EN+LE++
Sbjct: 8   LIIFLTIILTSLFVNAENSSKFLIKPVKKST-----------GEPIYIQIFKEENLLELY 56

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
               D +   ++ Y IC++SG  GPK   GD ++PEGFY +    LNPNS+++ +IN+GF
Sbjct: 57  IEKQDGQLEKIRTYPICSYSGGLGPKKYQGDLKSPEGFYQVNQTQLNPNSRFYRAINLGF 116

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN++D+    TG  LMIHG C S GCYAM +  M EIY     +L+ N Q  I I  FPF
Sbjct: 117 PNQYDQEQGYTGDFLMIHGACKSVGCYAMTDTVMDEIYQYAELALK-NGQQSINIHIFPF 175

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +MT++NM+ +Q + N  FW  L   + Y E+  + P I + N +Y+  
Sbjct: 176 KMTAENMKKFQYSANMDFWQQLAPAYQYVEEYKKIPSISVKNGRYLVN 223


>gi|253990732|ref|YP_003042088.1| exported protein YafK [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782182|emb|CAQ85346.1| putative exported protein YafK [Photorhabdus asymbiotica]
          Length = 244

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 95/234 (40%), Positives = 124/234 (52%), Gaps = 11/234 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M          L  F        SL           L  +     T   +P  I+IFK E
Sbjct: 1   MKKTAAFAAIILMFF-------SSLPPTYAQDTPIELKSTPS---TQLGYPVFIQIFKEE 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            ILE++ ++    Y L K Y IC +SG  GPK   GD ++PEGFY +  + LNPNS+Y+ 
Sbjct: 51  RILELYTKDSHGNYQLAKSYPICNYSGGLGPKTMEGDLKSPEGFYRVKTSQLNPNSRYYR 110

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           SIN+GFPNE+DK+   +G  LMIHGEC S GCYAM N  M EIY  V  +L  N Q  I 
Sbjct: 111 SINLGFPNEYDKSRGYSGNYLMIHGECKSVGCYAMTNNYMNEIYHYVESALL-NGQYEIN 169

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           I  +PFRMT +NM  +Q + +Y FW  L+  ++YF K  +   I +IN QY   
Sbjct: 170 ISIYPFRMTPQNMLRHQASSHYMFWLQLQPAYEYFIKTRRPAAISVINNQYAVN 223


>gi|268593097|ref|ZP_06127318.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
 gi|291311366|gb|EFE51819.1| conserved hypothetical protein [Providencia rettgeri DSM 1131]
          Length = 245

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 85/188 (45%), Positives = 119/188 (63%), Gaps = 2/188 (1%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I+IFK E +LE++++    +Y L K Y IC +SG  GPK   GD ++PEGFY I    
Sbjct: 42  IFIQIFKQEGLLELYQKTPSGKYKLSKTYPICKFSGGLGPKKIEGDLKSPEGFYQITAEQ 101

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSL 171
           LNPNS+Y+ SINIGFPNEFDKA   +G+ LMIHG C S GCYAM +K M EIY  V  +L
Sbjct: 102 LNPNSRYYRSINIGFPNEFDKAQGYSGSYLMIHGSCVSVGCYAMTDKYMGEIYQTVETAL 161

Query: 172 RGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQY 231
               QS I +  +PF+MT++NM  Y+N+ +Y+FW  L+  ++YF +  +   + +   +Y
Sbjct: 162 LS-GQSVINVSIYPFKMTNENMLRYRNSSHYAFWKQLQPAYEYFNRTGRPAEVSVALGKY 220

Query: 232 -VFFKGQT 238
            V  +  T
Sbjct: 221 AVIDQADT 228


>gi|227357845|ref|ZP_03842193.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Proteus mirabilis ATCC
           29906]
 gi|227161955|gb|EEI46973.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Proteus mirabilis ATCC
           29906]
          Length = 250

 Score =  261 bits (667), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 81/228 (35%), Positives = 127/228 (55%), Gaps = 12/228 (5%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +++F   I  +   ++ +       P+ ++              P  I+IFK EN+LE++
Sbjct: 8   LIIFLTIILTSLFVNAENSSKFLIKPVKKST-----------GEPIYIQIFKEENLLELY 56

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
               D +   ++ Y IC++SG  GPK   GD ++PEGFY +    LNPNS+++ +IN+GF
Sbjct: 57  IEKQDGQLEKIRTYPICSYSGGLGPKKYQGDLKSPEGFYQVNQTQLNPNSRFYRAINLGF 116

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN++D+    TG  LMIHG C S GCYAM +  M EIY     +L+ N Q +I I  FPF
Sbjct: 117 PNQYDQEQGYTGDFLMIHGACKSVGCYAMTDTVMDEIYQYAELALK-NGQQNINIHIFPF 175

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +MT++NM+ +Q + N  FW  L   + Y E+  + P I + N +Y+  
Sbjct: 176 KMTAENMKKFQYSANMDFWQQLAPAYQYVEEYQKIPVISVKNGRYLVN 223


>gi|226328780|ref|ZP_03804298.1| hypothetical protein PROPEN_02680 [Proteus penneri ATCC 35198]
 gi|225201966|gb|EEG84320.1| hypothetical protein PROPEN_02680 [Proteus penneri ATCC 35198]
          Length = 256

 Score =  260 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 78/198 (39%), Positives = 118/198 (59%), Gaps = 2/198 (1%)

Query: 40  SMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQ 99
            M+  + S   P  I+IFK E++LE++   +D +   ++ Y IC++SG  GPK   GD +
Sbjct: 30  LMKPVKKSTGQPIYIQIFKEESLLELYTEKLDGQLEKVRTYPICSYSGGLGPKKFQGDLK 89

Query: 100 APEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQ 159
           +PEGFY + +  LNPNS+++ +IN+GFPN++DK+   TG  LMIHG C S GCYAM +  
Sbjct: 90  SPEGFYQVNFAQLNPNSRFYRAINLGFPNQYDKSKGYTGDFLMIHGACKSVGCYAMTDPV 149

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYS-FWNMLKLGHDYFEKN 218
           M EIY     +L+   QS I I  FPF+MT++NM+ +Q + +   FW  L   + Y E  
Sbjct: 150 MDEIYQYAELALQ-RGQSTINIHIFPFKMTAENMKKHQYSKDMDFFWQQLMPAYQYVEAY 208

Query: 219 HQEPFIQIINKQYVFFKG 236
            + P I + + +Y     
Sbjct: 209 KKIPSITVQDGRYFVNST 226


>gi|171911100|ref|ZP_02926570.1| hypothetical protein VspiD_07990 [Verrucomicrobium spinosum DSM
           4136]
          Length = 219

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 79/208 (37%), Positives = 115/208 (55%), Gaps = 4/208 (1%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIW-KRNVDAEYVLLKEYKICAWSGTFGPK 92
           +  L   ++++  +   P  IR+FK    LE+W K      +   K + I A SG  GPK
Sbjct: 9   TPGLTEELRRQGFALGDPIFIRVFKETLELELWIKAKSAPAFRKWKTWPIAAMSGELGPK 68

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGC 152
            + GD QAPEGFY +   +LNP S Y LS NIG+PN FD+AH RTG+ +M+HG+  S GC
Sbjct: 69  TKEGDRQAPEGFYQVTTKSLNPRSSYHLSFNIGYPNAFDQAHQRTGSFIMVHGKAVSIGC 128

Query: 153 YAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNM--QLYQNNPNYSFWNMLKL 210
           +AM +  ++EIY +   +L+   QS   +  FPFRMTS+ +     ++     FW  L+ 
Sbjct: 129 FAMTDPVIEEIYLMAEAALK-RGQSSFGVHVFPFRMTSERLLQAGEEHPSLLKFWLDLRP 187

Query: 211 GHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           G+  FE   Q P I++  K+Y      T
Sbjct: 188 GYTAFESTQQPPIIKVEEKRYRVTPVGT 215


>gi|114800403|ref|YP_759185.1| hypothetical protein HNE_0455 [Hyphomonas neptunium ATCC 15444]
 gi|114740577|gb|ABI78702.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 253

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 125/240 (52%), Gaps = 11/240 (4%)

Query: 5   YNILLFALFIFL----------NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVI 54
              +L A+  FL                 +    A    +E L  ++ +K  +   P  +
Sbjct: 15  IFAILIAMLAFLCLPALLAFAHADTVPETARSRAAYAAQAEPLKAALAEKGLALGSPVFL 74

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
           +I K    L  + ++ + ++   + + +CA SG  GPKI  GD QAPEGFY +    +NP
Sbjct: 75  QITKEPAELTAYVQDTEGKFQPFRTWPVCAVSGDLGPKIREGDHQAPEGFYKVTAGQMNP 134

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGN 174
            S + LS N+G+PN FD+A++RTG+ LM+HG CAS GC+AM ++ ++EI+ +++ +  G 
Sbjct: 135 ASSFHLSFNLGYPNAFDRANDRTGSFLMVHGSCASVGCFAMTDEGIEEIWTLMQAAFEG- 193

Query: 175 MQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
            Q  + +  FPF MT + M   + +P+ +FW  LK   + F  + + P + + +  Y   
Sbjct: 194 GQKAVDVHIFPFPMTQQAMAGREASPHAAFWESLKPAWNKFSASGEVPTVSVRDGAYQVR 253


>gi|320353230|ref|YP_004194569.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobulbus propionicus DSM
           2032]
 gi|320121732|gb|ADW17278.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobulbus propionicus DSM
           2032]
          Length = 266

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 86/241 (35%), Positives = 126/241 (52%), Gaps = 11/241 (4%)

Query: 7   ILLFALFIFLN------GCHHSRSLIDKAEHPLS---ENLIISMQKKRTSPFHPTVIRIF 57
           +L F+L    +                KAE  ++     +   +Q K  +   P  +RIF
Sbjct: 14  LLFFSLLTLASPWPVPVATGTDLPTTPKAETAMAQTRPKIQQELQAKGFAVGQPIFVRIF 73

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K   ILE+W       + L K YK+C +SG  GPKI  GD QAPEGFY +    LNPNS 
Sbjct: 74  KIPGILELWMNKGRG-FELFKAYKVCNYSGFPGPKISEGDWQAPEGFYSVSAEQLNPNSG 132

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
           Y L+ +IG+PN FD A  RTG  +M+HG C S GC+AM +++++EIY +  ++L    Q 
Sbjct: 133 YHLAFDIGYPNAFDVAKRRTGNLIMVHGNCKSVGCFAMTDRRIEEIYLLAHEAL-AQGQE 191

Query: 178 HIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
              +  FPF +T +N++ +  +P   FW  L+ G+  FE + Q P I + N +YV     
Sbjct: 192 RFDVHIFPFPLTQRNLKKFAASPWIKFWESLEPGYSAFEMSKQVPQIAVQNGEYVVTSRV 251

Query: 238 T 238
            
Sbjct: 252 P 252


>gi|46204594|ref|ZP_00049770.2| COG3034: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 290

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/169 (46%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           ++   +  Y LLK Y I  WS   GPK + GD QAPEGFY I    +NPNS Y+LS ++G
Sbjct: 3   FEARANGHYALLKTYPIFRWSVQLGPKTKQGDRQAPEGFYTITPGQMNPNSSYYLSFDVG 62

Query: 126 FPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           +PN  D+A   TG  +M+HG C+SAGC+AM +  M EIYA+ R++  G  Q   Q Q++P
Sbjct: 63  YPNAVDRAKGGTGNYIMVHGTCSSAGCFAMTDASMGEIYALAREAFNG-GQRAFQFQSYP 121

Query: 186 FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           FRMT+ N+  ++N+PN  FW  LK G DYFE   +EP +     +YVF 
Sbjct: 122 FRMTAANVAKFRNDPNAPFWRNLKEGSDYFEALKEEPRVAACGTKYVFG 170


>gi|323137985|ref|ZP_08073059.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocystis sp. ATCC 49242]
 gi|322396704|gb|EFX99231.1| ErfK/YbiS/YcfS/YnhG family protein [Methylocystis sp. ATCC 49242]
          Length = 496

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 82/227 (36%), Positives = 111/227 (48%), Gaps = 16/227 (7%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
             L + A  P  E+       K         +RIFK E  LE+W R  +  + L K + I
Sbjct: 263 ARLPEPALRPAPEDAFQQPPPK-FGMGDQVFVRIFKQEGQLELWLRK-NGRFNLYKTFPI 320

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM 142
           C WSG  GPKI+  D Q+PEGFY +    LNP+S Y  + N+G+PN FD+ + RTG  +M
Sbjct: 321 CKWSGRLGPKIKEADYQSPEGFYSVSARQLNPHSNYHRAFNVGYPNAFDRQNGRTGGLVM 380

Query: 143 IHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLY------ 196
           +HG C S GC+AM ++ ++EIY  V  +LR   Q  I +  FPFRMT   +         
Sbjct: 381 VHGACKSVGCFAMTDRGIEEIYGFVEAALRA-GQKEIAVHIFPFRMTDAAIARETGGGWL 439

Query: 197 -------QNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
                        SFW  LK G+D FE+  + P        Y F  G
Sbjct: 440 AFVGGGGNYAQWTSFWKNLKQGYDLFERTGEPPVAFACGDHYEFDGG 486


>gi|312892268|ref|ZP_07751764.1| ErfK/YbiS/YcfS/YnhG family protein [Mucilaginibacter paludis DSM
           18603]
 gi|311295243|gb|EFQ72416.1| ErfK/YbiS/YcfS/YnhG family protein [Mucilaginibacter paludis DSM
           18603]
          Length = 234

 Score =  250 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/233 (39%), Positives = 131/233 (56%), Gaps = 5/233 (2%)

Query: 4   RYNILLFALFIFLN---GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           +  ++L + F+ +N          L       +   L   +         P  IRIFK E
Sbjct: 3   KALLVLISFFLLINHPVTDLPDSKLAADVRAAVWPRLEKELNNGGFKAGSPIYIRIFKEE 62

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           +ILEIW +  D+ Y L K Y +C +SG FG K    D ++PEGFYYI    LNP S Y L
Sbjct: 63  HILEIWVKK-DSTYSLFKTYPVCYFSGGFGTKTRINDGKSPEGFYYITPWQLNPVSHYHL 121

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIG+PN+ +K+   TG D+MIHG CAS GCYAM +  ++EIY +V  SL    Q+ I 
Sbjct: 122 AINIGYPNQLEKSKGYTGTDIMIHGHCASIGCYAMTDPLIEEIYTVVYKSL-AAGQTAIP 180

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           +  FPF++ + NM+L   +  +SFWN +K G+D FE     P + ++NKQY F
Sbjct: 181 LHIFPFKLNATNMKLCAASDYFSFWNNMKAGYDLFESRRIPPVVSVVNKQYAF 233


>gi|312114448|ref|YP_004012044.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219577|gb|ADP70945.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 352

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 123/237 (51%), Gaps = 6/237 (2%)

Query: 1   MTNRY-NILLFALFIFLNGCHHSRSLIDKAEHPLSEN--LIISMQKKRTSPFHPTVIRIF 57
           M  R   +L+ A+   L     + +    A   + +   L    + K      P  IRI+
Sbjct: 1   MQYRLVCVLVSAIAFCLASFQGASATSRDARGAVEKENALAAEFEGKGMKLGSPVFIRIY 60

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL-NPNS 116
           K  + LE+W       Y L K Y IC ++G  GPK+  GD Q+PEG Y + W++L  PN 
Sbjct: 61  KQSSTLELWVEK-GPRYELFKTYGICKFAGGLGPKMYEGDRQSPEGLYRVEWDDLIGPNP 119

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
           ++  ++NI +PN FDK + R G+ ++IHG+C+S GC+A+ +  ++E+Y  VR +LRG  Q
Sbjct: 120 RWHRAMNINYPNAFDKMNGRGGSSILIHGKCSSIGCFAIQDANVEEVYDAVRAALRG-GQ 178

Query: 177 SHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           SH+ + A PFR      +L        FW+ L+     F+++   P   + + +Y F
Sbjct: 179 SHVPVLALPFRFAKYAPELDDTRKLNEFWSDLRRADLLFDRDRLPPMAYVCDNRYYF 235


>gi|284007778|emb|CBA73623.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 182

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 1/162 (0%)

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           ++K Y IC +SG  GPK   GD ++PEGFY I  + L P+SKY+ + N+GFPNE+D+AH 
Sbjct: 1   MVKSYPICNFSGGLGPKTRQGDLKSPEGFYRITRSQLKPDSKYYRAFNLGFPNEYDQAHG 60

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
            TG+ LM+HG C S GCYAM ++ + EIY  V ++L  N Q  IQ+  +PF+MTS NM  
Sbjct: 61  YTGSYLMVHGGCRSIGCYAMTDRYINEIYRYVENAL-HNGQYEIQVNIYPFKMTSANMNR 119

Query: 196 YQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
           ++N+  Y+FW  L+  ++YF K +Q P I I   QY+  K  
Sbjct: 120 HRNSRYYTFWQQLQPAYEYFTKTNQLPVINIQQGQYLVNKFP 161


>gi|254786219|ref|YP_003073648.1| hypothetical protein TERTU_2191 [Teredinibacter turnerae T7901]
 gi|237686206|gb|ACR13470.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 171

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 74/169 (43%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
               EY L K Y+IC +SG+ GPK   GD QAPEGFY++   +LNP S Y LS N+G+PN
Sbjct: 4   KSGEEYELFKTYEICTFSGSLGPKTRKGDNQAPEGFYFVKPGSLNPWSSYHLSFNLGYPN 63

Query: 129 EFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRM 188
            +++ H  TG+ LM+HG+C S G YAM ++ + EIYA+ + +     Q   ++ AFPFR+
Sbjct: 64  SYERLHGFTGSALMVHGKCVSIGSYAMTDRYINEIYAMAQGAFES-GQPFFRVHAFPFRL 122

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQ 237
            S+ ++ Y+NN  YSFW  LK G+D+F K+   P +     +YVF  G 
Sbjct: 123 ESEVLEKYKNNRWYSFWKNLKEGYDHFAKHKVPPNVDSEKGRYVFSAGT 171


>gi|332664143|ref|YP_004446931.1| ErfK/YbiS/YcfS/YnhG family protein [Haliscomenobacter hydrossis DSM
           1100]
 gi|332332957|gb|AEE50058.1| ErfK/YbiS/YcfS/YnhG family protein [Haliscomenobacter hydrossis DSM
           1100]
          Length = 251

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 112/243 (46%), Gaps = 21/243 (8%)

Query: 6   NILLFALFIFLNGCHHSRSLIDK---------AEHPLSENLIISMQKKRTSPFHPTVIRI 56
            IL   +   LN     +   +          A   + E L   + +K   P     IR 
Sbjct: 8   LILTILMLNNLNCSGQQQQTTNTLVDGDRVANARQLVGEKLAQELTQKGLKPGAAIFIRA 67

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           FK+E  LE+W ++   ++   K Y IC   G  GPK + GD Q PEG Y+I     NP S
Sbjct: 68  FKSEQQLEVWVQD-SLQFRWFKTYHICKVPGELGPKRKEGDLQVPEGLYWIE--VFNPQS 124

Query: 117 KYFLSINIGFPNEFDKAH---NRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRG 173
            Y LS+ I +PN  D+      + G ++ IHG C S GC  + ++ ++E+Y +  D+ + 
Sbjct: 125 SYHLSMGINYPNASDRILSDPKKPGGEIYIHGACGSVGCIPLTDEFIREVYLLALDA-KT 183

Query: 174 NMQSHIQIQAFPFRMTSKNMQ--LYQNNPN-YSFWNMLKLGHDYFEKNHQEPFIQIIN-- 228
             Q  I +  FP RMT +N    L +N P+   FW  L   +D+F +    P  ++ +  
Sbjct: 184 AGQEKIPVHIFPCRMTEQNKVNLLARNQPHLMPFWENLAEAYDFFVEKKVVPKYEVESNT 243

Query: 229 KQY 231
            +Y
Sbjct: 244 GRY 246


>gi|255530608|ref|YP_003090980.1| ErfK/YbiS/YcfS/YnhG family protein [Pedobacter heparinus DSM 2366]
 gi|255343592|gb|ACU02918.1| ErfK/YbiS/YcfS/YnhG family protein [Pedobacter heparinus DSM 2366]
          Length = 244

 Score =  224 bits (572), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 72/205 (35%), Positives = 109/205 (53%), Gaps = 9/205 (4%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE-YVLLKEYKICAWSGTFGPKI 93
            NL   +     +      I  +KNE  LE+W +    + Y L K Y  CA SGT GPK+
Sbjct: 42  ANLQTELSAAGITRPFKLYIAAYKNEGKLELWLKTNGQKAYKLFKIYDFCAHSGTLGPKV 101

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH---NRTGADLMIHGECASA 150
           + GD Q PEGFYYI     NP S + LS+ + +PN+ D+      R G D+ IHG C + 
Sbjct: 102 KEGDLQTPEGFYYIN--VFNPKSSFHLSLGVNYPNKVDERRSGKERPGGDIYIHGNCVTV 159

Query: 151 GCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNM--QLYQNNPNYSFWNML 208
           GC  + + +++E+Y +  ++ +   Q  I +  FPF+MTS N+  QL Q     + W  L
Sbjct: 160 GCIPLTDDKIKEVYVLAVEA-KNAGQDPIPVHIFPFKMTSVNLNIQLKQYPAQRALWTNL 218

Query: 209 KLGHDYFEKNHQEPFIQIINKQYVF 233
           + G+ YFEK++  P +     +Y+F
Sbjct: 219 ETGYRYFEKHNNLPVVTEKEGKYLF 243


>gi|149279594|ref|ZP_01885723.1| putative inner membrane protein [Pedobacter sp. BAL39]
 gi|149229630|gb|EDM35020.1| putative inner membrane protein [Pedobacter sp. BAL39]
          Length = 247

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 109/222 (49%), Gaps = 9/222 (4%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVD-AEYVLLK 78
             +   +  A     + +  ++ + +       +I  +K E +LE+W +    + Y L +
Sbjct: 28  QLTFPRVKAAYQDTWKPMQKALLEAKIPAGSELLIMAYKKEGMLEVWMKPKGTSRYQLFR 87

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH---N 135
            Y  CA SG  GPK++ GD Q PEGFY I     NP S + LS+ + +PN  D A     
Sbjct: 88  SYGFCARSGVLGPKVQEGDYQTPEGFYEINA--FNPQSNFHLSLGVSYPNAVDLARSGTK 145

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           + G ++ IHG C + GC  + +++++E+Y +  ++ R   Q  I +  FPFRM   N + 
Sbjct: 146 KPGGEIYIHGNCVTVGCVPLTDEKIKEVYLLAIEA-RNAGQQRIPVYMFPFRMNEVNFEK 204

Query: 196 Y--QNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              Q     +FW  +K G+ YFE     P I++ + QY   K
Sbjct: 205 NAKQFPQFRNFWASMKTGYQYFESRKTLPQIRVKSGQYQISK 246


>gi|196234486|ref|ZP_03133311.1| protein of unknown function DUF949 [Chthoniobacter flavus Ellin428]
 gi|196221467|gb|EDY16012.1| protein of unknown function DUF949 [Chthoniobacter flavus Ellin428]
          Length = 265

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 68/258 (26%), Positives = 108/258 (41%), Gaps = 27/258 (10%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHP--------------LSENLIISMQKKRTSPFH 50
             +   A+ + L G H     +     P                  L             
Sbjct: 8   LLVATIAIALSLVGAHAWAQAVPAPASPDNDTTDRIAVARQQHEAALRQKYHAAAVGYPG 67

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
              +R  K E +LE+W R+    + L+  Y I A SGT GPK   GD Q PEGFY I   
Sbjct: 68  EVFLRWLKREAMLELWARDPGRRFRLVATYPILASSGTPGPKRREGDRQVPEGFYEINR- 126

Query: 111 NLNPNSKYFLSINIGFPNEFDKA---HNRTGADLMIHGECASAGCYAMNNKQMQEIYAIV 167
             NP S + LS+ + +PN  D     H++ G+D+ IHG   S GC  + +  ++E+Y   
Sbjct: 127 -FNPKSSFHLSLGLNYPNASDLVLSDHDQPGSDIFIHGSNVSIGCAPLGDNAIEEVYLAA 185

Query: 168 RDSLRGNMQSHIQIQAFPFRMTSKNMQLY-----QNNPNYS-FWNMLKLGHDYFEKNHQE 221
            D+ +   Q+ IQ+  FP RM     + +     +  P  + FW  L+ G ++FE++   
Sbjct: 186 LDA-QARGQARIQVHVFPSRMNGSGWEQFATGEIRQRPELAVFWTQLRPGFEFFERHRTL 244

Query: 222 PFIQII-NKQYVFFKGQT 238
           P + +  + +Y       
Sbjct: 245 PTVAVEKDGRYRVQGAAP 262


>gi|256424395|ref|YP_003125048.1| ErfK/YbiS/YcfS/YnhG family protein [Chitinophaga pinensis DSM 2588]
 gi|256039303|gb|ACU62847.1| ErfK/YbiS/YcfS/YnhG family protein [Chitinophaga pinensis DSM 2588]
          Length = 252

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 73/219 (33%), Positives = 111/219 (50%), Gaps = 15/219 (6%)

Query: 26  IDKAEHPLSENLIISMQKKRT-SPFHPTVIRIFKNENILEIWKRNV-DAEYVLLKEYKIC 83
           +  A     E L    QKK    P     IR FK ++ LEIW +N     + L K Y++C
Sbjct: 36  VGTAYRDKEEQLREEFQKKGLAYPAKYIFIRSFKLDSELEIWVKNSVADTFRLFKSYRVC 95

Query: 84  AWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH---NRTGAD 140
             SG  GPK + GD Q PEGFYYI   + NPNS Y LS+ I +PN  DK      + G +
Sbjct: 96  TLSGKMGPKRKEGDRQVPEGFYYIN--DFNPNSSYHLSLGINYPNFADKILSDPKKPGGE 153

Query: 141 LMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLY---- 196
           + IHG C + GC  + +  ++E+Y +  ++ + + Q  I +  FP +  +     Y    
Sbjct: 154 IYIHGSCLTIGCIPLTDDIIEEVYVMAVNA-KNSGQDFIPVHVFPVKFGNIRSMEYLGNF 212

Query: 197 --QNNPNYSFWNMLKLGHDYFEKNHQEPFIQI-INKQYV 232
             ++N +  FW  LK  +DYFE +H+ P + +    +Y+
Sbjct: 213 TLKDNSSEKFWVDLKYAYDYFEAHHKLPVVLVDEKGKYI 251


>gi|124003370|ref|ZP_01688220.1| pollen allergen Poa pIX/Phl pVI, C-terminal [Microscilla marina
           ATCC 23134]
 gi|123991468|gb|EAY30899.1| pollen allergen Poa pIX/Phl pVI, C-terminal [Microscilla marina
           ATCC 23134]
          Length = 296

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 100/204 (49%), Gaps = 13/204 (6%)

Query: 40  SMQKKRTSPFHPTVIRIFKNENILEIWKRNVD-AEYVLLKEYKICAWSGTFGPKIETGDE 98
             Q+   +      IR  K E  +E+W R      + L++ YK C  SG  GPK + GD+
Sbjct: 93  LKQQDIQTLDIELFIRAVKLEREVEVWARQKGTKPFKLVRTYKFCESSGELGPKRKDGDK 152

Query: 99  QAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT---GADLMIHGECASAGCYAM 155
           Q PEGFY+I     NP SK+ LS+ + +PN  DK    T   G D+ +HG+C + GC  +
Sbjct: 153 QIPEGFYHINR--FNPVSKFHLSLGLNYPNRSDKVLGDTTGLGGDIFLHGDCVTVGCIPI 210

Query: 156 NNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNM----QLYQNNPNY-SFWNMLKL 210
            +  ++E+Y    ++ +   Q  I +  FP R+ +       + Y+   N   FW  LK 
Sbjct: 211 TDNNIRELYVFAVEA-KARGQKKIPVNIFPARLDNAGFDKLKEQYKAQENLVEFWASLKK 269

Query: 211 GHDYFEKNHQEPFIQIIN-KQYVF 233
           G++YFE   + P I      +Y+ 
Sbjct: 270 GYEYFENTKELPTIIFAKSGKYIV 293


>gi|296125423|ref|YP_003632675.1| ErfK/YbiS/YcfS/YnhG family protein [Brachyspira murdochii DSM
           12563]
 gi|296017239|gb|ADG70476.1| ErfK/YbiS/YcfS/YnhG family protein [Brachyspira murdochii DSM
           12563]
          Length = 247

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 75/190 (39%), Positives = 104/190 (54%), Gaps = 11/190 (5%)

Query: 52  TVIRIFKNENILEIWKRN-VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
            +I  +K E+ILEI+ +N  D  Y  + EYKI A SG  GPK   GD Q PEGFYYI   
Sbjct: 61  ILITAYKQEDILEIYAKNKNDKTYKKIAEYKIAAKSGILGPKRMEGDLQVPEGFYYIDR- 119

Query: 111 NLNPNSKYFLSINIGFPNEFDKAH---NRTGADLMIHGECASAGCYAMNNKQMQEIYAIV 167
             NP S Y+LS+ I +PNE D+      R G D+ IHG   + GC  M + +++EIY   
Sbjct: 120 -FNPASSYYLSLGINYPNEADRKKSNAKRLGGDIFIHGANVTIGCMPMTDDKIKEIYLYA 178

Query: 168 RDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ---NNPNYSFWNMLKLGHDYFEKNHQEPFI 224
             + + N Q+ I +  FPF+MT  N   Y+    +    FW  +K G+D F+   +E  I
Sbjct: 179 IYA-KDNGQNKIPVYIFPFKMTDDNFNYYKEIYESSLIDFWKNIKEGYDIFQNTKKEINI 237

Query: 225 QI-INKQYVF 233
           +I  N  Y+F
Sbjct: 238 KIDNNGNYIF 247


>gi|300870101|ref|YP_003784972.1| hypothetical protein BP951000_0468 [Brachyspira pilosicoli 95/1000]
 gi|300687800|gb|ADK30471.1| hypothetical protein BP951000_0468 [Brachyspira pilosicoli 95/1000]
          Length = 242

 Score =  204 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 119/243 (48%), Gaps = 15/243 (6%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRS-----LIDKAEHPLSENLIISMQKKRTSPFH-PTVI 54
           M       LF L   L   +          + KA     + +  ++Q    S      +I
Sbjct: 1   MLKYIAASLFILNTLLFSANFLDEQKRYPRVRKAIEDKEQIIKQNLQNNNISINKLNIII 60

Query: 55  RIFKNENILEIWKRNV-DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
             +K E+ILEI+ +N  D  Y  + +Y I + SG  GPK   GD Q PEGFYYI     N
Sbjct: 61  IAYKEESILEIYAKNNADKTYKKIAQYNIASKSGVLGPKRMEGDLQVPEGFYYIDR--FN 118

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT---GADLMIHGECASAGCYAMNNKQMQEIYAIVRDS 170
           P S Y+LS+ I +PN+ D+   +    G D+ IHG   + GC  M + +++EIY     +
Sbjct: 119 PASSYYLSLGINYPNKSDQIKGKRNQLGGDIFIHGSEVTIGCIPMTDDKIKEIYLYAVHA 178

Query: 171 LRGNMQSHIQIQAFPFRMTSKNMQ-LYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQI-IN 228
            + N Q  I +  FPF+MT +N++   +++   +FW  +K+G+D F  + +E   +I  N
Sbjct: 179 -KNNGQKKIPVYIFPFKMTEENIKNRRESDKLINFWKNIKVGYDVFINSKREIIYKIDEN 237

Query: 229 KQY 231
             Y
Sbjct: 238 GNY 240


>gi|290476303|ref|YP_003469207.1| hypothetical protein XBJ1_3325 [Xenorhabdus bovienii SS-2004]
 gi|289175640|emb|CBJ82443.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 180

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 65/183 (35%), Positives = 95/183 (51%), Gaps = 8/183 (4%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L   L   ++    ++S     + P     +         P     I+IFK E
Sbjct: 1   MKKTAFYLSLLLLFHMSCSALAQSTPSWLQSPNERRPLKQ-------PGAEIFIQIFKEE 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            +LE++ ++    Y L + Y IC +SG  GPK  TGD ++PEGFY++    L PNS+Y+ 
Sbjct: 54  KVLELYTKDNTDHYQLAQSYPICNYSGGLGPKTLTGDFKSPEGFYHVNLKQLKPNSRYYR 113

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +IN+GFPNEFDK    +G +LMIHG C S GCYAM ++ + EIY     ++    Q  I+
Sbjct: 114 AINLGFPNEFDKFRGYSGNNLMIHGGCKSIGCYAMTDRYIDEIYRYAESAI-SYGQDEIK 172

Query: 181 IQA 183
           I  
Sbjct: 173 INI 175


>gi|213026129|ref|ZP_03340576.1| hypothetical protein Salmonelentericaenterica_28298 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 147

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 80/128 (62%), Gaps = 1/128 (0%)

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVR 168
            N L P+S+++ +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V 
Sbjct: 1   RNQLKPDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVT 60

Query: 169 DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIIN 228
            +L    Q  +Q+  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++
Sbjct: 61  AALV-FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVD 119

Query: 229 KQYVFFKG 236
            +YV  K 
Sbjct: 120 GRYVVSKP 127


>gi|225619280|ref|YP_002720506.1| hypothetical protein BHWA1_00333 [Brachyspira hyodysenteriae WA1]
 gi|225214099|gb|ACN82833.1| conserved hypothetical protein [Brachyspira hyodysenteriae WA1]
          Length = 233

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/176 (39%), Positives = 101/176 (57%), Gaps = 10/176 (5%)

Query: 52  TVIRIFKNENILEIWKRNV-DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
            +I ++K E+ILEI+ +N  D+ Y  +  Y I A SG  GPK   GD Q PEGFYYI   
Sbjct: 60  ILITVYKQEDILEIYAKNKSDSTYKKIASYNIAAKSGILGPKRMEGDLQVPEGFYYIDR- 118

Query: 111 NLNPNSKYFLSINIGFPNEFDKAH---NRTGADLMIHGECASAGCYAMNNKQMQEIYAIV 167
             NP S Y+LS+ I +PNE DK     +R G D+ IHG   + GC  M + +++EIY   
Sbjct: 119 -FNPASSYYLSLGINYPNESDKKKSNASRLGGDIFIHGANVTIGCMPMTDDKIKEIYLYA 177

Query: 168 RDSLRGNMQSHIQIQAFPFRMTSKNM---QLYQNNPNYSFWNMLKLGHDYFEKNHQ 220
             + + N Q+ I +  FPF+MT +N    + Y N    +FW+ +K G+D F+ + +
Sbjct: 178 VYA-KDNGQNKIPVYIFPFQMTDRNFDYYKKYYNESLINFWDNIKKGYDIFQNSKK 232


>gi|218678022|ref|ZP_03525919.1| hypothetical protein RetlC8_03792 [Rhizobium etli CIAT 894]
          Length = 262

 Score =  184 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 82/112 (73%), Gaps = 1/112 (0%)

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPF 186
           PN +D A+ RTG+DLMIHG C+S+GCY+M ++Q+ EIYA  RD+ +G  Q+ +Q+QAFPF
Sbjct: 1   PNRYDAANGRTGSDLMIHGACSSSGCYSMTDQQVLEIYAFARDAFKG-GQATVQLQAFPF 59

Query: 187 RMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQT 238
           RMT++NM  ++ + +Y FW MLK+G+D FE   + P + +  K+YVF +  T
Sbjct: 60  RMTAENMVKHRLDSSYDFWKMLKVGYDNFEVTKRPPEVAVCEKKYVFNQQAT 111


>gi|300723899|ref|YP_003713210.1| hypothetical protein XNC1_3038 [Xenorhabdus nematophila ATCC 19061]
 gi|297630427|emb|CBJ91092.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 121

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 1/120 (0%)

Query: 96  GDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAM 155
           GD ++PEGFY++    L PNS Y+ +IN+GFPNEFDK+   +G +LMIHGEC S GCYAM
Sbjct: 3   GDLKSPEGFYHVSLKQLKPNSHYYRAINLGFPNEFDKSKGYSGNNLMIHGECKSIGCYAM 62

Query: 156 NNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYF 215
            N+ M EIY     +   + Q  I+I  +PFRMT +NM+ Y+NN N+ FW  L+  ++Y+
Sbjct: 63  TNRYMDEIYQYAESAF-YHGQLAIKINIYPFRMTPQNMRRYKNNDNFLFWKQLQHAYEYY 121


>gi|294054888|ref|YP_003548546.1| ErfK/YbiS/YcfS/YnhG family protein [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614221|gb|ADE54376.1| ErfK/YbiS/YcfS/YnhG family protein [Coraliomargarita akajimensis
           DSM 45221]
          Length = 235

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/233 (25%), Positives = 97/233 (41%), Gaps = 28/233 (12%)

Query: 1   MTNRYNILLFA--LFIFLNGCHHSRSLI-------DKAEHPLSENLIISMQ-KKRTSPFH 50
           M  R+ ILL    L + L  C  S            +    +   +  +       S + 
Sbjct: 1   MRQRFCILLIGTILLVLLYLCGRSIWYPVYIKLRGGRTVSEVVHEIKSTQSFNDDFSQWK 60

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
              +  FK E  +E+W          ++++    +SG  GPK+  GD Q PEG Y I + 
Sbjct: 61  SLHLLCFKEERKIEVWVSGQSGTKE-IRQFDFTGYSGELGPKLRQGDGQIPEGIYEIEY- 118

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIY 164
            LNPNS Y LS+ I +PNEFD+   R       G D+ IHG+ A+ GC  + +  ++E++
Sbjct: 119 -LNPNSSYHLSMKISYPNEFDRLKGREDRREKLGYDIFIHGKSATVGCIPIGDDGIEELF 177

Query: 165 AIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEK 217
            +V +      +  +Q+   P+ M      L     +   W      +D  E 
Sbjct: 178 LMVSE----FGKDRVQVIISPYDMRQGRRALEITEIS---WEN--ELYDIIEA 221


>gi|83646750|ref|YP_435185.1| hypothetical protein HCH_04045 [Hahella chejuensis KCTC 2396]
 gi|83634793|gb|ABC30760.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 248

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 61/223 (27%), Positives = 98/223 (43%), Gaps = 22/223 (9%)

Query: 12  LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNENILEIWKRNV 70
           L++ L G      ++      +   L  +  +   + P     +  FK E  LE+W    
Sbjct: 34  LYLDLKGRRTVDDVMRNIGPVVEPGLQDAFARAGVTYPPQRITLLAFKEEKRLELWAE-Q 92

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEF 130
           D   VL+  Y I A SG  GPK+  GD Q PEGFY I     NPNS + LS+ + +P+ F
Sbjct: 93  DGVQVLVSAYPIQAASGVAGPKLREGDRQVPEGFYRIEG--FNPNSSFHLSMKLNYPSPF 150

Query: 131 D----KAHNRT--GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           D    +A  RT  G D+ IHG+ +S GC AM +  +++++ +          ++I +   
Sbjct: 151 DLKHAQAEGRTSPGGDIFIHGKASSVGCLAMGDPAVEDLFILA----NRVGVTNIDVIIA 206

Query: 185 P--FRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQ 225
           P  FRM            +   W  L   +   E++ +   + 
Sbjct: 207 PHDFRMR----APEATPQSAPAW--LPELYQDIEQSLRPFAVS 243


>gi|163737962|ref|ZP_02145378.1| ErfK/YbiS/YcfS/YnhG family protein [Phaeobacter gallaeciensis
           BS107]
 gi|161388578|gb|EDQ12931.1| ErfK/YbiS/YcfS/YnhG family protein [Phaeobacter gallaeciensis
           BS107]
          Length = 172

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 74/189 (39%), Gaps = 43/189 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L  A  + L GC    S       P   +                 + + K  
Sbjct: 1   MDRRTFGLGAAATLGLAGCSSGPSKFRSYNGPEVTS-----------------VVVNKGA 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EY +       G K   GD + PEG Y I     NPNS+Y L
Sbjct: 44  RKVYLLHHED-----VLREYDMELGFAPLGHKQIEGDGKTPEGTYLIDRR--NPNSRYHL 96

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI I +PN  D+A       + G ++ IHGE                +AGC A+ N +++
Sbjct: 97  SIGISYPNGQDRAKASAMGKKPGGEIFIHGEPNNAKERKRAARVDDWTAGCIAVTNDEIE 156

Query: 162 EIYAIVRDS 170
           EIYA+VRD 
Sbjct: 157 EIYAMVRDG 165


>gi|163742642|ref|ZP_02150028.1| ErfK/YbiS/YcfS/YnhG family protein [Phaeobacter gallaeciensis 2.10]
 gi|161384227|gb|EDQ08610.1| ErfK/YbiS/YcfS/YnhG family protein [Phaeobacter gallaeciensis 2.10]
          Length = 172

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 74/189 (39%), Gaps = 43/189 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L  A  + L GC    S       P   +                 + + K  
Sbjct: 1   MDRRTFGLGAAATLGLAGCSSGPSKFRSYNGPEVTS-----------------VVVNKGA 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EY +       G K   GD + PEG Y I     NPNS+Y L
Sbjct: 44  RKVYLLHHED-----VLREYDMELGFAPLGHKQIEGDGKTPEGTYLIDRR--NPNSRYHL 96

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI I +PN  D+A       + G ++ IHGE                +AGC A+ N +++
Sbjct: 97  SIGISYPNGQDRAKAAAMGKKPGGEIFIHGEPNNAKERKRAARVDDWTAGCIAVTNDEIE 156

Query: 162 EIYAIVRDS 170
           EIYA+VRD 
Sbjct: 157 EIYAMVRDG 165


>gi|254476164|ref|ZP_05089550.1| ErfK/YbiS/YcfS/YnhG family protein [Ruegeria sp. R11]
 gi|214030407|gb|EEB71242.1| ErfK/YbiS/YcfS/YnhG family protein [Ruegeria sp. R11]
          Length = 175

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 76/189 (40%), Gaps = 40/189 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L  A  + + GC  S   ++K        +                I + K  
Sbjct: 1   MDRRAFGLGIAATLGVAGCSSSTGPVNKFLAYNGPEVTS--------------IVVNKGA 46

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EYK+       G K   GD + PEG Y+I     NPNS Y L
Sbjct: 47  RKVYLMHDQD-----ILREYKMDLGFAPAGHKAVEGDGKTPEGTYFIDRR--NPNSAYHL 99

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI I +PN  D+A       + G ++ IHGE                +AGC A+ N +++
Sbjct: 100 SIGISYPNAEDRAKAAAMGKKPGGEIFIHGEPNSAKARKRAARVDDWTAGCIAVKNHEIE 159

Query: 162 EIYAIVRDS 170
           EIYA+V D 
Sbjct: 160 EIYAMVADG 168


>gi|86136792|ref|ZP_01055370.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. MED193]
 gi|85826116|gb|EAQ46313.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. MED193]
          Length = 174

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 75/189 (39%), Gaps = 41/189 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L     + + GC     +  + +      +                + + K  
Sbjct: 1   MDRRAFGLTAVASLAVAGCGRGPQV-SRFKTYGGPEVTS--------------VVVNKGA 45

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EYK+       G K   GD + PEG Y I     NPNS + L
Sbjct: 46  RKVYLLHGED-----ILREYKMDLGFAPLGHKRVEGDGKTPEGLYRIDRR--NPNSAFHL 98

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI I +PN  D+AH      R G ++ IHGE                +AGC A+ N +++
Sbjct: 99  SIGISYPNAEDRAHARALGKRPGGEIFIHGEPNNEKDRKRAARVSDWTAGCIAVKNDEIE 158

Query: 162 EIYAIVRDS 170
           EIYA+VRD 
Sbjct: 159 EIYAMVRDG 167


>gi|213421922|ref|ZP_03354988.1| hypothetical protein Salmonentericaenterica_31013 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 119

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++ + +  +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P+S+++ 
Sbjct: 1   RTLDLYVK-MGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYK 59

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQ 180
           +INIGFPN +D+AH   G  LMIHG C S GCYAM +  + EI+  V  +L    Q  +Q
Sbjct: 60  AINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV-FGQPSVQ 118

Query: 181 I 181
           +
Sbjct: 119 V 119


>gi|83942056|ref|ZP_00954518.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. EE-36]
 gi|83953105|ref|ZP_00961827.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. NAS-14.1]
 gi|83842073|gb|EAP81241.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. NAS-14.1]
 gi|83847876|gb|EAP85751.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. EE-36]
          Length = 165

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/183 (26%), Positives = 74/183 (40%), Gaps = 40/183 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  IL     + L  C  S+    +   P                     + + K +
Sbjct: 1   MKRRNLILGGTALVALGACSSSK--FKRYNGPQVT-----------------YVIVNKGD 41

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   +      +L+ Y I       G K+  GD + PEG Y I     NPNS++ L
Sbjct: 42  RRMYLMHHD-----KVLESYDIKLGFAPVGHKVYEGDGRTPEGIYMIDRR--NPNSRFHL 94

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHG---------ECASAGCYAMNNKQMQEIYAI 166
           SI I +PNE D+A         G D+ IHG            + GC +++N +M+EIYA+
Sbjct: 95  SIGINYPNEMDRARAEALGKSPGGDIFIHGQKTAKDKNRTDWTWGCISVSNDEMEEIYAM 154

Query: 167 VRD 169
           V D
Sbjct: 155 VGD 157


>gi|254487420|ref|ZP_05100625.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. GAI101]
 gi|214044289|gb|EEB84927.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. GAI101]
          Length = 166

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 39/181 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  IL     + L+ C         +   ++                   + + K +
Sbjct: 1   MKRRNFILGGTALVALSACSGDSKFKRYSGPQVT------------------YVVVNKGD 42

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +  ++      +L+ Y I       G K   GD + PEG Y+I     NPNSK+ L
Sbjct: 43  RRMYLMHQD-----KVLEAYDIRLGFAPVGHKAHEGDGRTPEGRYWIDRR--NPNSKFHL 95

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGE---------CASAGCYAMNNKQMQEIYAI 166
           S+ I +PN+ D+A+      + G D+ IHG+           + GC +++N+++++IYA+
Sbjct: 96  SLGISYPNDNDRANAAALGKQPGGDIFIHGQKAADKKNINDWTWGCISVSNQEIEDIYAM 155

Query: 167 V 167
           V
Sbjct: 156 V 156


>gi|259417350|ref|ZP_05741269.1| ErfK/YbiS/YcfS/YnhG [Silicibacter sp. TrichCH4B]
 gi|259346256|gb|EEW58070.1| ErfK/YbiS/YcfS/YnhG [Silicibacter sp. TrichCH4B]
          Length = 203

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 76/189 (40%), Gaps = 44/189 (23%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R         +   GC    ++      P++                   I I K  
Sbjct: 33  MHRRTFGAGILATLGAAGCSSGPNIRRYNGPPVTS------------------IVINKGS 74

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +       E  +LKEY++       G K   GD + PEG Y I     NP S+++L
Sbjct: 75  RRMYLL-----NETKVLKEYEVGLGFAPVGHKQIEGDGRTPEGTYRIDRR--NPRSQFYL 127

Query: 121 SINIGFPNEFDKAH-----NRTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S+ I +PN  D+A+        G D+ IHGE                +AGC A++N++++
Sbjct: 128 SLGISYPNAADRAYASSLGASPGGDIFIHGEPNDRADRRRAARTQDWTAGCIAVSNEEIE 187

Query: 162 EIYAIVRDS 170
           EI+++V D 
Sbjct: 188 EIWSMVNDG 196


>gi|260431994|ref|ZP_05785965.1| ErfK/YbiS/YcfS/YnhG family protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415822|gb|EEX09081.1| ErfK/YbiS/YcfS/YnhG family protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 192

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 72/189 (38%), Gaps = 43/189 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L     + L+ C  S       + P   +                 I + K  
Sbjct: 21  MDRRAFGLGALATLSLSACGTSGPRFLTYDGPEVTS-----------------IVVNKGA 63

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EY I       G K   GD + PEG Y I     NP S+Y L
Sbjct: 64  RKMYLLHHE-----QILREYDIDLGFAPNGTKTRRGDGRTPEGTYLIDRR--NPRSRYHL 116

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S+ I +PN  D A  +      G D+ IHG+                +AGC A+ N +++
Sbjct: 117 SVGISYPNAQDIAKAKAMGVDPGGDIFIHGQPNLRKELKRAKKTPDWTAGCIAVKNHEIE 176

Query: 162 EIYAIVRDS 170
           EIYA+V++ 
Sbjct: 177 EIYAMVKEG 185


>gi|254509663|ref|ZP_05121730.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221533374|gb|EEE36362.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 172

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 75/189 (39%), Gaps = 43/189 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L     + L+ C  ++        P   +L+                 I K  
Sbjct: 1   MDRRAFGLGAVATLGLSACASAKPRFLSYRGPEVTSLV-----------------INKGA 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EY++       G K   GD + PEG Y I     NP S+Y L
Sbjct: 44  RKMYLLHNE-----QILREYEVDLGFAPKGTKTRKGDGRTPEGTYLIDRR--NPRSRYHL 96

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S+ I +PN  D+A  +      G D+ IHG+                +AGC A+ N++M+
Sbjct: 97  SLGISYPNSADRAQAKAAGVDPGGDIFIHGQPNLRSELKRAKKTPDWTAGCIAVKNEEME 156

Query: 162 EIYAIVRDS 170
           EIYA+V + 
Sbjct: 157 EIYAMVNEG 165


>gi|126738470|ref|ZP_01754175.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. SK209-2-6]
 gi|126720269|gb|EBA16975.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. SK209-2-6]
          Length = 174

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 76/189 (40%), Gaps = 41/189 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L  A  + L GC  + +   + +      +                + + K  
Sbjct: 1   MDRRVFGLSVAASLTLAGCGST-NYASRFKTYNGPEVTS--------------VVVNKGA 45

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L+EYK+       G K   GD + PEG Y I     NPNS Y L
Sbjct: 46  RKIYLL-----NGESILREYKMDLGFAPLGHKQIEGDGKTPEGLYRIDRR--NPNSSYHL 98

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI I +PN  D A+      R G ++ IHGE                +AGC A+ N +++
Sbjct: 99  SIGISYPNASDVAYARSIGKRPGGEIFIHGEPNERKARKRASRVSDWTAGCIAVKNSEIE 158

Query: 162 EIYAIVRDS 170
           EIYA+VRD 
Sbjct: 159 EIYAMVRDG 167


>gi|159046034|ref|YP_001534828.1| ErfK/YbiS/YcfS/YnhG family protein [Dinoroseobacter shibae DFL 12]
 gi|157913794|gb|ABV95227.1| ErfK/YbiS/YcfS/YnhG family protein [Dinoroseobacter shibae DFL 12]
          Length = 166

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/146 (31%), Positives = 65/146 (44%), Gaps = 24/146 (16%)

Query: 42  QKKRTSPFHPTV--IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQ 99
             K      P V  I +FK E  + +   +      +L+ + I       G K   GD +
Sbjct: 21  SSKFLDYEGPEVTRIVVFKGERRMYLMNED-----RVLRGFDIDLGFAPEGHKQVEGDGK 75

Query: 100 APEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC------- 147
            PEG Y I     NPNS + LS+ I +PN  D A  R      G ++ IHG+        
Sbjct: 76  TPEGRYRIDRR--NPNSSFHLSLGISYPNTADVARARAMGQSPGGNIFIHGQPNLLGPQT 133

Query: 148 ---ASAGCYAMNNKQMQEIYAIVRDS 170
               +AGC A+ N +M+EIYA+V D 
Sbjct: 134 EENWTAGCIAVTNAEMEEIYAMVEDG 159


>gi|84685767|ref|ZP_01013663.1| ErfK/YbiS/YcfS/YnhG family protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665860|gb|EAQ12334.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacterales bacterium
           HTCC2654]
          Length = 222

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 76/200 (38%), Gaps = 51/200 (25%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  +   A F+ L  C    S       P                     I +FK  
Sbjct: 2   MNRRVMLASTAAFVGLTAC----SKFKTYNGPEVTE-----------------IFVFKEN 40

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +           L EY +      +G K + GD + PEG Y I     NP+S + L
Sbjct: 41  RKMYLMHHQTA-----LAEYDVHLGFSPYGHKQQKGDGRTPEGSYRINRR--NPDSAFHL 93

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC----------ASAGCYAMNNKQMQEIYA 165
           S+ + +PN+ D+   +      G D+ IHG             +AGC A+ NK++++IYA
Sbjct: 94  SVGLDYPNDTDRKIAKEVGVSPGGDIFIHGGPTRKEDKNKADWTAGCIAVTNKEIEDIYA 153

Query: 166 IVRDSLRGNMQSHIQIQAFP 185
           +VRD           I  FP
Sbjct: 154 MVRDGT--------PIHIFP 165


>gi|84500743|ref|ZP_00998992.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanicola batsensis HTCC2597]
 gi|84391696|gb|EAQ04028.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanicola batsensis HTCC2597]
          Length = 165

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 78/185 (42%), Gaps = 42/185 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     IL+ A+ + L+GC        K +      +                + ++K +
Sbjct: 1   MRFLSLILMIAIGLGLSGCAS------KFKTYYGPEVTQ--------------VLVYKAD 40

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   +      +LK Y+I       G K   GD + PEG Y I     NP+S++ L
Sbjct: 41  RRMYLMHHD-----EVLKSYRIGLGFAPVGHKQFEGDGRTPEGTYRIDRR--NPDSEFHL 93

Query: 121 SINIGFPNEFDKA----HNR-TGADLMIHGEC----------ASAGCYAMNNKQMQEIYA 165
           S+ + +PN  D A      +  G D+ IHG             +AGC A+ N ++++IYA
Sbjct: 94  SVGLSYPNTRDVAFATSQGKSPGGDIFIHGLPNRFKKSGSRDWTAGCIAVRNHEIEDIYA 153

Query: 166 IVRDS 170
           +V+D 
Sbjct: 154 MVKDG 158


>gi|89067448|ref|ZP_01154961.1| hypothetical protein OG2516_11426 [Oceanicola granulosus HTCC2516]
 gi|89047017|gb|EAR53071.1| hypothetical protein OG2516_11426 [Oceanicola granulosus HTCC2516]
          Length = 164

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 77/198 (38%), Gaps = 47/198 (23%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     +LL      L  C  S+        P++                   ++++K +
Sbjct: 1   MNAIRLVLLMVGLTLLASCAPSK-FRTYNGPPVTS------------------VQVWKTD 41

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            ++ +          +LK Y         G K   GD + PEG YYI     NPNS Y L
Sbjct: 42  RVMALMSGT-----RVLKTYDFEMGFAPQGHKYFEGDGRTPEGVYYIDRR--NPNSDYHL 94

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           SI I +P+E D A         G D+ IHG           +AGC A++N  ++EIYA+V
Sbjct: 95  SIGISYPDEEDIARALEAGLEPGGDIFIHGTPKLFADRTDWTAGCIAVSNDAVEEIYAMV 154

Query: 168 RDSLRGNMQSHIQIQAFP 185
           +D           I  +P
Sbjct: 155 QDGT--------PIVIYP 164


>gi|260429237|ref|ZP_05783214.1| ErfK/YbiS/YcfS/YnhG family protein [Citreicella sp. SE45]
 gi|260419860|gb|EEX13113.1| ErfK/YbiS/YcfS/YnhG family protein [Citreicella sp. SE45]
          Length = 173

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 77/200 (38%), Gaps = 50/200 (25%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     IL+ AL   L  C       +  E                     T + + K+ 
Sbjct: 1   MRFFRLILIIALLGGLGACSSKFRTYNGPEV--------------------TQVVVKKST 40

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   +      +L+ Y I       G K   GD + PEG Y+I     NPNS + L
Sbjct: 41  RRMYLLHND-----KVLESYDIGLGFQPQGHKQYEGDGKTPEGLYFIDRR--NPNSNFHL 93

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC------------------ASAGCYAMNN 157
           SI I +PN +D+A         G D+ IHG                     + GC A+++
Sbjct: 94  SIGISYPNPYDRAFAASSGKSPGGDIFIHGGPPKDKKRRGGGSWRSNGRDWTWGCIAVSD 153

Query: 158 KQMQEIYAIVRDSLRGNMQS 177
           ++M++IYA+VRD     +Q 
Sbjct: 154 REMEDIYAMVRDGTPITIQP 173


>gi|237752719|ref|ZP_04583199.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376208|gb|EEO26299.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 324

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 87/275 (31%), Gaps = 42/275 (15%)

Query: 1   MTN-RYNILLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRT------------ 46
           M   +   L   L     G      L  K     + + +   MQ +              
Sbjct: 1   MKFFKIFYLCLVLSFASAGDFEWVELYKKGGVSAIEKKIDSIMQTRDFWSGVLREQDTRF 60

Query: 47  --SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                   +    KN   L ++  N       L            G K + GD   P G 
Sbjct: 61  GYYEDLKYLFIATKNAPTLRLYALNEGKWNEKLNV--ESLVGSKGGHKEKEGDLATPIGV 118

Query: 105 YYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAM 155
           Y +    +N +  Y  L+    +PN +D+   RTG  + IHG           + GC A+
Sbjct: 119 YSLNARLVNLDQYYGPLAFATNYPNLYDRLQKRTGYGIWIHGMPLDGNRKELNTRGCIAI 178

Query: 156 NNKQMQEIYAIV--RDSLRGNMQSHI-------------QIQAFPFRMTSKNMQLYQNNP 200
            N ++  + A++  R +L    ++                +  +       N++ Y    
Sbjct: 179 ENDKLSSVDALINYRQALLITFENSFKEVKKEDLSILLADLYVWKDAWKESNIEKYLEFY 238

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           +  F       +D F +N +  F +   K+ VF +
Sbjct: 239 SKDFIRFDGNKYDDFAQNKRRIFAKNEKKEIVFSQ 273


>gi|330447689|ref|ZP_08311337.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491880|dbj|GAA05834.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 233

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 99/241 (41%), Gaps = 33/241 (13%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLI--------------DKAEHPLSENLIISMQKKRT 46
           M  +  + L  +F  +     + S                 +    +   +    +    
Sbjct: 1   MFKKALLPLLVMFTAVTDAQAASSYATYPPAGSRTVDDVMKRYSPFVEPRIKRYFESVGL 60

Query: 47  S-PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           + P     +   K E  LE+W      ++  +K Y I   SG  GPK+  GD+Q PEG Y
Sbjct: 61  TYPPKNIALFAMKEEMSLELWAEEK-GKWSYVKRYDIEKISGKKGPKLREGDKQVPEGIY 119

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR------TGADLMIHGECASAGCYAMNNKQ 159
            +  + LNPNS++ LS+ + +PN FD+ + R       G+++ IHG+ AS GC AM +  
Sbjct: 120 RV--SLLNPNSRFHLSMKLDYPNAFDRKYARLEGRTSPGSNIFIHGKQASTGCLAMGDYS 177

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNH 219
           ++E++ +           +I++   P       +    N P   FW  +   +   E+  
Sbjct: 178 IEELFLLAE----RTGLDNIEVVISPRDPKKGKLTAALNQP---FWTQI--LYRNIEQEA 228

Query: 220 Q 220
           +
Sbjct: 229 R 229


>gi|52841744|ref|YP_095543.1| lipoprotein [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|30577829|emb|CAD90960.1| LssA protein [Legionella pneumophila]
 gi|52628855|gb|AAU27596.1| lipoprotein [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 243

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 100/241 (41%), Gaps = 32/241 (13%)

Query: 1   MTNRYNIL-------LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPT 52
           M   + IL       LFA+   LN        I +    +   LI    K   S P    
Sbjct: 11  MKRFFPILFILYCCNLFAMAPKLNWDKAIDKAIKRYGLRVEPQLISYFSKAGVSYPPKEI 70

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            +  FK+E  +E+W +N + E+  + +Y +  +SG  GPK+   D+Q PEG Y +   N 
Sbjct: 71  ALLAFKSERKVELWAKNPNQEWTHIHDYPLTGFSGRLGPKLRENDKQIPEGIYKLV--NF 128

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAI 166
           NP S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ +
Sbjct: 129 NPFSSMHLSMMINYPNSFDRQKGYMDGRKELGNNIFIHGKNLSVGCLAVGDLAIDQLFIL 188

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
            R         +IQ+   P      N   YQ     +F    W  L   +    ++ +  
Sbjct: 189 AR----RVGLKNIQVIIAP------NDLRYQKPSTSTFAQPRW--LPELYKQITESLKPF 236

Query: 223 F 223
            
Sbjct: 237 K 237


>gi|54297427|ref|YP_123796.1| secretion system protein A [Legionella pneumophila str. Paris]
 gi|53751212|emb|CAH12623.1| Legionella secretion system protein A [Legionella pneumophila str.
           Paris]
          Length = 243

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 100/241 (41%), Gaps = 32/241 (13%)

Query: 1   MTNRYNIL-------LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPT 52
           M   ++IL       LFA+   LN        I +    +   LI    K   S P    
Sbjct: 11  MKRFFSILFILYCCNLFAMAPKLNWDKAIDKAIKRYGLRVEPQLISYFSKAGVSYPPKEI 70

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            +  FK+E  +E+W +N   E+  + +Y +  +SG  GPK+   D+Q PEG Y +   N 
Sbjct: 71  ALLAFKSERKVELWAKNPSQEWTHIHDYPLTGFSGRLGPKLRENDKQIPEGIYKLV--NF 128

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAI 166
           NP S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ +
Sbjct: 129 NPFSSMHLSMMINYPNSFDRQKGYMDGRKELGNNIFIHGKNLSVGCLAVGDLAIDQLFIL 188

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
            R         +IQ+   P      N   YQ     +F    W  L   +    ++ +  
Sbjct: 189 AR----RVGLKNIQVIIAP------NDLRYQKPSTSTFAQPRW--LPELYKQISESLKPF 236

Query: 223 F 223
            
Sbjct: 237 K 237


>gi|54294442|ref|YP_126857.1| secretion system protein A [Legionella pneumophila str. Lens]
 gi|30577820|emb|CAD90952.1| LssA protein [Legionella pneumophila str. Corby]
 gi|53754274|emb|CAH15751.1| Legionella secretion system protein A [Legionella pneumophila str.
           Lens]
          Length = 243

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 100/241 (41%), Gaps = 32/241 (13%)

Query: 1   MTNRYNIL-------LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPT 52
           M   ++IL       LFA+   LN        I +    +   LI    K   S P    
Sbjct: 11  MKRFFSILFILYCCNLFAMAPKLNWDKAIDKAIKRYGLRVEPQLISYFSKAGVSYPPKEI 70

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            +  FK+E  +E+W +N   E+  + +Y +  +SG  GPK+   D+Q PEG Y +   N 
Sbjct: 71  ALLAFKSERKVELWAKNPSQEWTHIHDYPLTGFSGRLGPKLRENDKQIPEGIYKLV--NF 128

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAI 166
           NP S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ +
Sbjct: 129 NPFSSMHLSMMINYPNSFDRQKGYMDGRKELGNNIFIHGKNLSVGCLAVGDLAIDQLFIL 188

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
            R         +IQ+   P      N   YQ     +F    W  L   +    ++ +  
Sbjct: 189 AR----RVGLKNIQVIIAP------NDLRYQKPSTSTFAQPRW--LPELYKQITESLKPF 236

Query: 223 F 223
            
Sbjct: 237 K 237


>gi|86358120|ref|YP_470012.1| hypothetical protein RHE_CH02508 [Rhizobium etli CFN 42]
 gi|86282222|gb|ABC91285.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 189

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 142 MIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPN 201
           M+HG C+S+GC+A+ ++ + EIYA+V  +LRG  Q   Q+QA+PFRMT +N+  ++++PN
Sbjct: 1   MVHGACSSSGCFALTDQGVGEIYAVVEKALRG-GQQAFQVQAYPFRMTPQNLAAHRDDPN 59

Query: 202 YSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           ++FW  LK G+D FE   +EP +   +++Y+F  
Sbjct: 60  FAFWKNLKEGYDIFEVRRREPRVAACSRKYIFDA 93


>gi|148359048|ref|YP_001250255.1| lipoprotein [Legionella pneumophila str. Corby]
 gi|296107097|ref|YP_003618797.1| lipoprotein [Legionella pneumophila 2300/99 Alcoy]
 gi|148280821|gb|ABQ54909.1| lipoprotein [Legionella pneumophila str. Corby]
 gi|295648998|gb|ADG24845.1| lipoprotein [Legionella pneumophila 2300/99 Alcoy]
          Length = 233

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 100/241 (41%), Gaps = 32/241 (13%)

Query: 1   MTNRYNIL-------LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPT 52
           M   ++IL       LFA+   LN        I +    +   LI    K   S P    
Sbjct: 1   MKRFFSILFILYCCNLFAMAPKLNWDKAIDKAIKRYGLRVEPQLISYFSKAGVSYPPKEI 60

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            +  FK+E  +E+W +N   E+  + +Y +  +SG  GPK+   D+Q PEG Y +   N 
Sbjct: 61  ALLAFKSERKVELWAKNPSQEWTHIHDYPLTGFSGRLGPKLRENDKQIPEGIYKLV--NF 118

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAI 166
           NP S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ +
Sbjct: 119 NPFSSMHLSMMINYPNSFDRQKGYMDGRKELGNNIFIHGKNLSVGCLAVGDLAIDQLFIL 178

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
            R         +IQ+   P      N   YQ     +F    W  L   +    ++ +  
Sbjct: 179 AR----RVGLKNIQVIIAP------NDLRYQKPSTSTFAQPRW--LPELYKQITESLKPF 226

Query: 223 F 223
            
Sbjct: 227 K 227


>gi|83955789|ref|ZP_00964331.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. NAS-14.1]
 gi|83839794|gb|EAP78971.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfitobacter sp. NAS-14.1]
          Length = 160

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 78/180 (43%), Gaps = 43/180 (23%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +LL  L  FL+GC       +  E                     T +RI+K + +L + 
Sbjct: 1   MLLGGLATFLSGCASKFRSYNGPEV--------------------TRLRIYKAQRLLVL- 39

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
               D    +L+ Y I       G K   GD + PEG Y I     NP+S + LSI I F
Sbjct: 40  ----DGTDDVLRTYPIGLGFAPEGHKQFEGDGRTPEGSYLIDRR--NPDSLFHLSIGISF 93

Query: 127 PNEFDKAHNR-----TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIVRDS 170
           PNE D A  +      G D+ IHG              +AGC ++ ++Q+++IYA+VRD 
Sbjct: 94  PNEADIAFAKAQGKSPGGDIFIHGGPRKGIDPMNKRDWTAGCISVTDRQIEDIYAMVRDG 153


>gi|163735640|ref|ZP_02143071.1| ErfK/YbiS/YcfS/YnhG [Roseobacter litoralis Och 149]
 gi|161391068|gb|EDQ15406.1| ErfK/YbiS/YcfS/YnhG [Roseobacter litoralis Och 149]
          Length = 170

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 53/197 (26%), Positives = 78/197 (39%), Gaps = 51/197 (25%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           R  +LL  L  FL+GC          E                     T +R++K + +L
Sbjct: 8   RRAVLLGGLAAFLSGCASKFRSYGGPEV--------------------TRVRLYKGQRLL 47

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
            +     D    +L+ Y +       G K   GD + PEG Y +     NP S Y LS+ 
Sbjct: 48  VL-----DGADRVLQTYPVGLGFAPEGHKQFEGDGRTPEGTYIVDKR--NPESTYHLSVG 100

Query: 124 IGFPNEFDKAHNR-----TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIV 167
           I +PNE D A         G D+ IHG              +AGC A+ ++Q+++IYA+V
Sbjct: 101 ISYPNEVDIAFAEAQGLSPGGDIFIHGGPRPGIDPTDVRDWTAGCIAVTDRQIEDIYAMV 160

Query: 168 RDSLRGNMQSHIQIQAF 184
           +D           I  F
Sbjct: 161 KDGT--------PIHIF 169


>gi|86139674|ref|ZP_01058241.1| hypothetical protein MED193_02185 [Roseobacter sp. MED193]
 gi|85823565|gb|EAQ43773.1| hypothetical protein MED193_02185 [Roseobacter sp. MED193]
          Length = 170

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 55/197 (27%), Positives = 79/197 (40%), Gaps = 51/197 (25%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           R  +LL  L  FL+GC       D  E                     T +R++K + +L
Sbjct: 8   RRAVLLGGLAAFLSGCAGKFRSYDGPEV--------------------TRLRLYKGQRLL 47

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
            +     D    +L+ Y I       G K   GD + PEG Y +     NP S Y LS+ 
Sbjct: 48  VL-----DGSDRVLQTYPIGLGFAPQGHKQFEGDGRTPEGTYIVDKR--NPESTYHLSVG 100

Query: 124 IGFPNEFDKAHNR-----TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIV 167
           I +PNE D A         G D+ IHG              +AGC A+ ++Q+++IYA+V
Sbjct: 101 ISYPNEADIAFAAAQGLSPGGDIFIHGGPRPGIDPTDIRDWTAGCIAVTDRQIEDIYAMV 160

Query: 168 RDSLRGNMQSHIQIQAF 184
           +D           I  F
Sbjct: 161 KDGT--------PIHIF 169


>gi|149377346|ref|ZP_01895091.1| hypothetical protein MDG893_17682 [Marinobacter algicola DG893]
 gi|149358358|gb|EDM46835.1| hypothetical protein MDG893_17682 [Marinobacter algicola DG893]
          Length = 187

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 28/170 (16%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
             + SL     +PLS + +       T      ++R  K E  L +   +      +++ 
Sbjct: 20  AFAFSLSLAPLYPLSASELPMGAMDETPEVSEVLVR--KEERRLYLLSGD-----QVVRS 72

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN---- 135
           Y+I       G K+  GD++ PEG Y + W   N NS ++ SI+I +PN  D+       
Sbjct: 73  YRIGLGDNPSGHKLYEGDKRTPEGKYVLDWR--NSNSDFYKSIHISYPNAEDREQASAWG 130

Query: 136 -RTGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIVRDS 170
              G  +MIHG                 + GC A++N++M EI+ +V D 
Sbjct: 131 LDPGGSIMIHGLPNEAGDMAFAFLGLDWTDGCIAVSNEEMDEIWQLVADG 180


>gi|89052763|ref|YP_508214.1| ErfK/YbiS/YcfS/YnhG [Jannaschia sp. CCS1]
 gi|88862312|gb|ABD53189.1| ErfK/YbiS/YcfS/YnhG [Jannaschia sp. CCS1]
          Length = 160

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 81/198 (40%), Gaps = 53/198 (26%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI--FKNE 60
            R+ ++     + L GC                        +      P V R+  +K E
Sbjct: 1   MRFLLIAVLTLVALTGCS-----------------------RFIDYDGPQVTRVLVYKGE 37

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            ++ +   N      +L+ Y+I       G K+E GD + PEG Y I     NPNS+++L
Sbjct: 38  RMMYLMHNND-----VLESYEIELGFAPEGHKLEEGDGRTPEGEYMIDRR--NPNSQWYL 90

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           SI I +PNE D A  R      G D+ IHG           + GC A+ N +M++IYA+V
Sbjct: 91  SIGISYPNEDDIAQARERGVDPGGDIFIHGTPRPFRRDQDWTVGCIAVTNAEMRQIYAMV 150

Query: 168 RDSLRGNMQSHIQIQAFP 185
            +           I  +P
Sbjct: 151 ENGT--------PISIYP 160


>gi|163732991|ref|ZP_02140435.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter litoralis Och 149]
 gi|161393526|gb|EDQ17851.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter litoralis Och 149]
          Length = 159

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 68/172 (39%), Gaps = 39/172 (22%)

Query: 11  ALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNV 70
           A  + L+ C         +   ++                   + + K    + +     
Sbjct: 4   AALLSLSACATGSKFKRYSGPEVT------------------FVVVNKGARRMHLLHNES 45

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEF 130
                LLK Y I       G K   GD + PEG Y I     NPNS + LS+ I +PN  
Sbjct: 46  -----LLKSYDIHLGFAPVGHKQFEGDGKTPEGLYRIDRR--NPNSDFHLSLGISYPNVN 98

Query: 131 D----KAHNRT-GADLMIHGE---------CASAGCYAMNNKQMQEIYAIVR 168
           D    KA  ++ G D+ IHG+           + GC A+ N +M+EIYA+V+
Sbjct: 99  DYAAAKAVGKSAGGDIFIHGQKSPFRNDDPDWTWGCIAVTNPEMEEIYAMVQ 150


>gi|254436867|ref|ZP_05050361.1| hypothetical protein OA307_1737 [Octadecabacter antarcticus 307]
 gi|198252313|gb|EDY76627.1| hypothetical protein OA307_1737 [Octadecabacter antarcticus 307]
          Length = 163

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 75/180 (41%), Gaps = 40/180 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M NR      A    L  C +   + +                        T + + K  
Sbjct: 1   MMNRRTFTSAAALFALTACSNKFRVYNGP--------------------AVTSVVVQKGR 40

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   N      +L++Y+        G K   GD + PEG YYI     NPNS+++L
Sbjct: 41  RKMFLLHNN-----KVLEQYEFELGFAPTGHKKTEGDGRTPEGAYYIDRK--NPNSRFYL 93

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           SI I +PN+ D+A  R      G D+ IHG           +AGC A+ +++M++IYA+V
Sbjct: 94  SIGISYPNDADRARARAMGKSPGGDIFIHGTPRLSLNRDDWTAGCLAVTDREMEDIYAMV 153


>gi|225024431|ref|ZP_03713623.1| hypothetical protein EIKCOROL_01306 [Eikenella corrodens ATCC
           23834]
 gi|224942812|gb|EEG24021.1| hypothetical protein EIKCOROL_01306 [Eikenella corrodens ATCC
           23834]
          Length = 200

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 75/197 (38%), Gaps = 35/197 (17%)

Query: 1   MTNRYNILLFALFIFLNG--------CHHSRSLIDKAEHP-LSENLIISMQKKRTSPFHP 51
           M  +  + LF   + L G         +   SL +      LS      +Q+    P   
Sbjct: 1   MNKKPLLALFGTILLLLGGYVFLRHSSNPPGSLPNTGNSAGLSPRQQSLLQQPALPPGSE 60

Query: 52  TV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
              + + K E  ++ +    +    LLK Y I       G K   GD + PEG Y I   
Sbjct: 61  IAKLVVRKAEREMDAYDAQGN----LLKTYPIALGFSPVGHKQFEGDGKTPEGRYTINDR 116

Query: 111 NLNPNSKYFLSINIGFPNEFDK----AHNR-TGADLMIHG--------------ECASAG 151
             NP+S +  ++ I +PN  D+    A  +  G D+ IHG                 + G
Sbjct: 117 --NPHSSHHKNLGISYPNAADRTHASAQGKNPGGDIKIHGLRNGLGLIGAQHLRRDWTHG 174

Query: 152 CYAMNNKQMQEIYAIVR 168
           C A+ + ++ E+Y  V+
Sbjct: 175 CIAVTDGEIDELYIHVK 191


>gi|90578351|ref|ZP_01234162.1| hypothetical protein VAS14_14909 [Vibrio angustum S14]
 gi|90441437|gb|EAS66617.1| hypothetical protein VAS14_14909 [Vibrio angustum S14]
          Length = 233

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 103/241 (42%), Gaps = 33/241 (13%)

Query: 1   MTNRYNILLFALFIFL--------------NGCHHSRSLIDKAEHPLSENLIISMQKKRT 46
           M  +  + L  +F  +               G      ++ +    +   +    ++   
Sbjct: 1   MFKKALLPLLVMFTAVTDVQAAYSYSTYPPAGTRTVDDVMKRYSPFVEPRIKRYFEQAGL 60

Query: 47  S-PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           S P     +   K E ++E+W      ++  +K Y I   SG  GPK+  GD+Q PEG Y
Sbjct: 61  SYPPKNIALFAMKEEMLVELWAEEK-GKWSYVKRYNIEKISGKKGPKLREGDKQVPEGIY 119

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR------TGADLMIHGECASAGCYAMNNKQ 159
            +  + LNPNS++ LS+ + +PN FD+ + +       G+++ IHG+ AS GC AM +  
Sbjct: 120 RV--SLLNPNSRFHLSMKLDYPNAFDRKYAKLEGRTSPGSNIFIHGKQASTGCLAMGDYS 177

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNH 219
           ++E++ + +         +I++   P       +     + N  FW  +   +   E+  
Sbjct: 178 IEELFLLAQ----RTGLDNIEVVISPHDPKKGKL---LASVNQPFWTQI--LYRNIEQQA 228

Query: 220 Q 220
           +
Sbjct: 229 R 229


>gi|85706916|ref|ZP_01038006.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. 217]
 gi|85668527|gb|EAQ23398.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. 217]
          Length = 166

 Score =  151 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 76/184 (41%), Gaps = 39/184 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +   ++ A    L+ C  +          ++                   + + K E
Sbjct: 1   MKLKRRFVVMAGLCALSACGTNSKFRSYRGPEVT------------------RVIVNKGE 42

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   N      LLK YK+       G K   GD + PEG Y I     NPNS + L
Sbjct: 43  REMYLLHHN-----KLLKRYKVDLGFAPAGHKQFEGDGRTPEGEYVIDRR--NPNSSFHL 95

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC---------ASAGCYAMNNKQMQEIYAI 166
           S+ I +PNE D A+        G D+ IHGE           +AGC ++ N++M+++YA+
Sbjct: 96  SLGISYPNEADIAYAEAMGETPGGDIFIHGEPNALAVLSRDWTAGCISVKNREMEDVYAM 155

Query: 167 VRDS 170
           VRD 
Sbjct: 156 VRDG 159


>gi|187251137|ref|YP_001875619.1| hypothetical protein Emin_0727 [Elusimicrobium minutum Pei191]
 gi|186971297|gb|ACC98282.1| hypothetical protein Emin_0727 [Elusimicrobium minutum Pei191]
          Length = 189

 Score =  151 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 49/183 (26%), Positives = 79/183 (43%), Gaps = 26/183 (14%)

Query: 1   MTN-RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M   R   +    FI L G        + A  PL++    +++K+         I I K 
Sbjct: 1   MRKERLIYIFIVTFILLCGVLFFALRGNAAGIPLTKEEQENLKKEIPENAVIDKIVILKE 60

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           + I+E+       +  LLK YKI       G K + GD + PEG Y +     NP+S+Y+
Sbjct: 61  KRIMEV-----SQKEELLKSYKISLGFEPKGHKEQQGDGKTPEGIYKVDGK--NPHSRYY 113

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHG-------------ECASAGCYAMNNKQMQ 161
            ++ + +PN+ D+A  +      G D+ IHG                + GC A+ N ++ 
Sbjct: 114 KNLGVSYPNDKDRAAAKAKGINPGGDIKIHGIGKDYWHIKENILGDWTLGCIAVTNAEID 173

Query: 162 EIY 164
           EIY
Sbjct: 174 EIY 176


>gi|270160116|ref|ZP_06188772.1| Legionella secretion system protein A [Legionella longbeachae
           D-4968]
 gi|269988455|gb|EEZ94710.1| Legionella secretion system protein A [Legionella longbeachae
           D-4968]
          Length = 264

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 96/239 (40%), Gaps = 33/239 (13%)

Query: 3   NRYNILL--------FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTV 53
            R   L+        +A+   LN        + +    +   L     +   S P     
Sbjct: 33  KRVFALIMIVFSFNSYAMAPKLNWDQAVDRAVQRYGLRVEPQLKSYFSRAGVSYPPRELA 92

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +  FK+E  +E+W RN +  +  + +Y +  +SG  GPK+   D+Q PEG Y +   N N
Sbjct: 93  LLAFKSERKVELWARNSNQSWKHIHDYPLTGFSGRLGPKLRENDKQIPEGVYKLV--NFN 150

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAIV 167
           P S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ + 
Sbjct: 151 PFSSMHLSMMINYPNSFDRQKGYQDGRKQLGNNIFIHGKNLSVGCLAVGDLAIDQLFILA 210

Query: 168 RDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
           R        ++I++   P      N    +     +F    W  L   +    ++ +  
Sbjct: 211 R----RVGLNNIKVIIAP------NDLRKKKPSTSTFAQPRW--LPELYKQIAESLKPF 257


>gi|99082736|ref|YP_614890.1| ErfK/YbiS/YcfS/YnhG [Ruegeria sp. TM1040]
 gi|99039016|gb|ABF65628.1| ErfK/YbiS/YcfS/YnhG [Ruegeria sp. TM1040]
          Length = 162

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 71/180 (39%), Gaps = 44/180 (24%)

Query: 10  FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRN 69
               +   GC     +      P++                   I + K    + +    
Sbjct: 1   MLATLGAAGCSSGPQIRRYNGPPVTS------------------IVVNKGSRKMYLL--- 39

Query: 70  VDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNE 129
              E  +L EYK+       G K   GD + PEG Y I     NP S+++LS+ I +PN 
Sbjct: 40  --NESKVLTEYKVGLGFAPVGHKQVEGDGRTPEGTYLIDRR--NPRSQFYLSLGISYPNS 95

Query: 130 FDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIVRDS 170
            D+AH R      G D+ IHGE                +AGC A+ N +++EI+++V + 
Sbjct: 96  ADRAHARSLGASPGGDIFIHGEPNDRADRRRAARVRDWTAGCIAVTNDEIEEIWSMVNNG 155


>gi|56694959|ref|YP_165304.1| ErfK/YbiS/YcfS/YnhG family protein [Ruegeria pomeroyi DSS-3]
 gi|56676696|gb|AAV93362.1| ErfK/YbiS/YcfS/YnhG family protein [Ruegeria pomeroyi DSS-3]
          Length = 202

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/189 (28%), Positives = 76/189 (40%), Gaps = 43/189 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R+  L  A  + L+ C    S   +   P   +                 I I K  
Sbjct: 31  MDRRHFGLGAAAALGLSACGSQDSKFRRYYGPAVTS-----------------IVINKGA 73

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +LKEYK+       G K   GD + PEG Y I     NPNS + L
Sbjct: 74  RKMYLLNNE-----KVLKEYKVELGFAPAGHKQFEGDGKTPEGTYLIDRR--NPNSAFHL 126

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S+ I +PN  D A+      + G ++ IHGE                +AGC A+ N +++
Sbjct: 127 SLGISYPNSRDVAYAQAMGKKPGGEIFIHGEPNGLRDRKKAKKQPDWTAGCIAVKNDEIE 186

Query: 162 EIYAIVRDS 170
           EIYA+VRD 
Sbjct: 187 EIYAMVRDG 195


>gi|149204465|ref|ZP_01881431.1| ErfK/YbiS/YcfS/YnhG [Roseovarius sp. TM1035]
 gi|149141964|gb|EDM30013.1| ErfK/YbiS/YcfS/YnhG [Roseovarius sp. TM1035]
          Length = 158

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/178 (28%), Positives = 75/178 (42%), Gaps = 43/178 (24%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           +     FL+GC       +  E                     T +R++K + +L +   
Sbjct: 1   MGGFAAFLSGCASKFRSYNGPEV--------------------TRLRMYKGQRLLVL--- 37

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             D    +L+ Y I       G K   GD + PEG Y I     NP+S + LSI I +PN
Sbjct: 38  --DGADDVLRTYPIGLGFAPEGHKQFEGDGRTPEGSYEIDRR--NPDSLFHLSIGISYPN 93

Query: 129 EFDK----AHNR-TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIVRDS 170
           E D     A  +  G D+ +HG              +AGC A+ ++Q++EIYA+VRD 
Sbjct: 94  EADIAFAEAQGKSPGGDIFVHGGPRKGIDPMNVRDWTAGCIAVTDRQIEEIYAMVRDG 151


>gi|89074657|ref|ZP_01161122.1| hypothetical protein SKA34_07229 [Photobacterium sp. SKA34]
 gi|89049595|gb|EAR55155.1| hypothetical protein SKA34_07229 [Photobacterium sp. SKA34]
          Length = 233

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 99/238 (41%), Gaps = 33/238 (13%)

Query: 1   MTNRYNILLFALFIFL--------------NGCHHSRSLIDKAEHPLSENLIISMQKKRT 46
           M  +  + L  +F  +               G      ++      +   +    +    
Sbjct: 1   MFKKALLPLLVMFTAVTDVQAAYSYSTYPPAGTRTVDDVMKHYSPFVEPRMKRYFEHAGL 60

Query: 47  S-PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           S P     +   K E  +E+W      ++  +K Y I   SG  GPK+  GD+Q PEG Y
Sbjct: 61  SYPPQNIALFAMKEEMSVELWAEEK-GKWSYVKRYNIEKISGKKGPKLREGDKQVPEGIY 119

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR------TGADLMIHGECASAGCYAMNNKQ 159
            I  + LNPNS++ LS+ + +PN FD+ + +       G+++ IHG+ AS GC AM +  
Sbjct: 120 RI--SLLNPNSRFHLSMKLDYPNAFDRKYAKLEGRTFPGSNIFIHGKQASTGCLAMGDYS 177

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEK 217
           ++E++ + +         +I++   P       +     + N  FW  +   +   E+
Sbjct: 178 IEELFLLAQ----RTGLDNIEVVISPHDPKKGKL---LASVNQPFWTQI--LYRNIEQ 226


>gi|85707004|ref|ZP_01038093.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. 217]
 gi|85668445|gb|EAQ23317.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. 217]
          Length = 158

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 74/178 (41%), Gaps = 43/178 (24%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           +  L  FL+GC       +  E                     T +R++K +  L +   
Sbjct: 1   MGGLAAFLSGCASKFRSYNGPEV--------------------TRLRMYKAQRFLVL--- 37

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             D    +L+ Y I       G K   GD + PEG Y I     NP S + LSI I +PN
Sbjct: 38  --DGVDDVLRTYPIGLGFAPEGHKQFEGDGRTPEGSYVIDRR--NPESLFHLSIGISYPN 93

Query: 129 EFD----KAHNR-TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIVRDS 170
             D    +A  +  G D+ IHG              +AGC A+ ++Q++EIYA+VRD 
Sbjct: 94  AADIAFAQAQGKSPGGDIFIHGGPRKGIDPMNVRDWTAGCIAVTDRQIEEIYAMVRDG 151


>gi|289165107|ref|YP_003455245.1| Legionella secretion system protein A [Legionella longbeachae
           NSW150]
 gi|288858280|emb|CBJ12148.1| Legionella secretion system protein A [Legionella longbeachae
           NSW150]
          Length = 243

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 96/239 (40%), Gaps = 33/239 (13%)

Query: 3   NRYNILL--------FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTV 53
            R   L+        +A+   LN        + +    +   L     +   S P     
Sbjct: 12  KRVFALIMIVFSFNSYAMAPKLNWDQAVDRAVQRYGLRVEPQLKSYFSRAGVSYPPRELA 71

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +  FK+E  +E+W RN +  +  + +Y +  +SG  GPK+   D+Q PEG Y +   N N
Sbjct: 72  LLAFKSERKVELWARNSNQSWKHIHDYPLTGFSGRLGPKLRENDKQIPEGVYKLV--NFN 129

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAIV 167
           P S   LS+ I +PN FD+           G ++ IHG+  S GC A+ +  + +++ + 
Sbjct: 130 PFSSMHLSMMINYPNSFDRQKGYQDGRKQLGNNIFIHGKNLSVGCLAVGDLAIDQLFILA 189

Query: 168 RDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
           R        ++I++   P      N    +     +F    W  L   +    ++ +  
Sbjct: 190 R----RVGLNNIKVIIAP------NDLRKKKPSTSTFAQPRW--LPELYKQIAESLKPF 236


>gi|167032069|ref|YP_001667300.1| hypothetical protein PputGB1_1056 [Pseudomonas putida GB-1]
 gi|166858557|gb|ABY96964.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 184

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 78/187 (41%), Gaps = 29/187 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + LF L +       +         P+      S  ++   P    V+ I K+E  
Sbjct: 1   MRWLLALFCLCV--TSVSQAAFTETIIRKPVPAAQTPSPSQQAMQPLIDKVLVI-KSERR 57

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L++  R        LK Y+I       G K   GD++ PEG Y++ W     + ++ L++
Sbjct: 58  LQLISRG-----EPLKTYRISLGKQPKGAKEREGDKKTPEGLYWLDWR--KQSDRFNLAM 110

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A         G+ +MIHG                 + GC AM N+ MQE+
Sbjct: 111 HINYPNISDAARATREGVSAGSMIMIHGTPINDEYPEWYFHTLDWTDGCIAMRNRDMQEV 170

Query: 164 YAIVRDS 170
           + +VRD 
Sbjct: 171 WELVRDG 177


>gi|84514894|ref|ZP_01002257.1| ErfK/YbiS/YcfS/YnhG family protein [Loktanella vestfoldensis SKA53]
 gi|84511053|gb|EAQ07507.1| ErfK/YbiS/YcfS/YnhG family protein [Loktanella vestfoldensis SKA53]
          Length = 160

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 20/134 (14%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I++FK +  +++   +      LL++Y +         K + GD + PEG Y I     N
Sbjct: 31  IQVFKEQRKMQLLHND-----KLLRQYDVALGFNPRDHKQQEGDGRTPEGAYVINRQ--N 83

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------ASAGCYAMNNKQM 160
           PNS++ LSI I +PN  D A  R      G D+ IHG           + GC A++N +M
Sbjct: 84  PNSRFHLSIGISYPNAVDVARARAMGVHPGGDIFIHGTPAPWIGMPDWTWGCIAVSNTEM 143

Query: 161 QEIYAIVRDSLRGN 174
            E+Y++V+   +  
Sbjct: 144 DEVYSMVQLGTKIF 157


>gi|116626039|ref|YP_828195.1| ErfK/YbiS/YcfS/YnhG [Candidatus Solibacter usitatus Ellin6076]
 gi|116229201|gb|ABJ87910.1| ErfK/YbiS/YcfS/YnhG [Candidatus Solibacter usitatus Ellin6076]
          Length = 140

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 20/130 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I ++K+   + + +        +L+ Y+I       G K + GD + PEG Y I     N
Sbjct: 11  IVVYKSRREMLLLRGES-----ILRSYRIALGRDPIGHKFQEGDGRTPEGCYTIDRR--N 63

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------ECASAGCYAMNNKQM 160
           P SKY LS++I +P   D    R      G D+MIHG           + GC A++N++M
Sbjct: 64  PKSKYHLSLHISYPEARDLDRAREAGVDPGGDIMIHGLKDGQPDPSDWTQGCIAVSNEEM 123

Query: 161 QEIYAIVRDS 170
            EI+++V D 
Sbjct: 124 DEIWSLVPDG 133


>gi|269104655|ref|ZP_06157351.1| hypothetical protein VDA_000812 [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161295|gb|EEZ39792.1| hypothetical protein VDA_000812 [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 239

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 14/191 (7%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNENILEIWKRNVDAEYVL 76
           G      +I + +  +   L I   +   S P     +   KNE  +E+W       + L
Sbjct: 34  GSRTVDDVIKRYQPIVEPRLKIDFARAEVSYPPKKIALFAMKNEQKMELWAE-EGDTWHL 92

Query: 77  LKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN- 135
           +K Y I   SG  GPK   GD+Q PEG Y + +  LNPNS+Y LS+ + +PN+FD  +  
Sbjct: 93  IKNYPITKLSGVMGPKKREGDKQIPEGIYQVEF--LNPNSQYHLSMKLNYPNDFDLKYAK 150

Query: 136 -----RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTS 190
                + G ++ IHG+ +S GC A+ +  ++E++ +     +     +I +   P+   +
Sbjct: 151 LEGRTKPGTNIFIHGKESSVGCLAIGDVAIEELFVLA----KNTGIDNIDVVISPYDPRT 206

Query: 191 KNMQLYQNNPN 201
           + +    + P 
Sbjct: 207 RTLVPTLSEPY 217


>gi|255261385|ref|ZP_05340727.1| ErfK/YbiS/YcfS/YnhG [Thalassiobium sp. R2A62]
 gi|255103720|gb|EET46394.1| ErfK/YbiS/YcfS/YnhG [Thalassiobium sp. R2A62]
          Length = 175

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 74/184 (40%), Gaps = 41/184 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     + +F LF  L GC       +  E                     T I ++K  
Sbjct: 12  MRLFRVLSVFLLFFVLVGCGSKFKTYNGPEV--------------------TRIAVYKEA 51

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +   N      +L++Y         G K   GD + PEG Y+I     NPNS++ L
Sbjct: 52  RTMYLMHNN-----EVLEKYDFALGFEPVGRKQVEGDGKTPEGNYFIDRR--NPNSRFHL 104

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC---------ASAGCYAMNNKQMQEIYAI 166
           S+ I +PN  D    R      G D+ IHG            + GC A+ +++M++IYA+
Sbjct: 105 SLGISYPNANDVEVARALGMPPGGDIFIHGTPKRFRNSDDDWTWGCIAVKDREMEQIYAM 164

Query: 167 VRDS 170
           V++ 
Sbjct: 165 VKNG 168


>gi|163745086|ref|ZP_02152446.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanibulbus indolifex HEL-45]
 gi|161381904|gb|EDQ06313.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanibulbus indolifex HEL-45]
          Length = 160

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 40/178 (22%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           IL     + L  C  S+    +   P                     + + K++  + + 
Sbjct: 2   ILGGTAMVALGACSSSK--FKRYNGPEVT-----------------YVVVNKSQRRMMLL 42

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
             N      +L++Y I       G K   GD + PEG Y I     NPNS++ LSI I +
Sbjct: 43  HHN-----RVLEDYPIKLGFAPVGHKTVEGDGRTPEGLYRIDRR--NPNSRFHLSIGIDY 95

Query: 127 PNEFDKAHNR-----TGADLMIHGE---------CASAGCYAMNNKQMQEIYAIVRDS 170
           PN+ D  + R      G D+ IHG+           + GC A+ NK+++++YA+VRD 
Sbjct: 96  PNQLDVEYARSMGKSPGGDIFIHGQKDPRQKEKNDWTWGCIAVTNKEIEDVYAMVRDG 153


>gi|254496466|ref|ZP_05109343.1| secretion system protein A [Legionella drancourtii LLAP12]
 gi|254354322|gb|EET12980.1| secretion system protein A [Legionella drancourtii LLAP12]
          Length = 243

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 96/240 (40%), Gaps = 32/240 (13%)

Query: 1   MTN-RYNILLF------ALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPT 52
           M      I++F      A+   LN        I +    +   L    +K   S P    
Sbjct: 11  MKRFITFIIMFLSLNSYAMTHKLNWDQAVDRAIKRYGLRVEPQLKSYFKKAGVSYPPRNI 70

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            +  FK+E  +E+W +N D  +  +  Y +  +SG  GPK+   D+Q PEG Y +   N 
Sbjct: 71  ALLAFKSERKVELWAKNQDQGWKHVHNYPLTGFSGRLGPKLRENDKQIPEGVYKLV--NF 128

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAI 166
           NP S   LS+ I +PN +D+           G ++ IHG+  S GC A+ +  + +++ +
Sbjct: 129 NPFSSMHLSMMINYPNNYDRQKGYQDGRRNLGNNIFIHGKNLSVGCLAIGDLAIDQLFIL 188

Query: 167 VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF----WNMLKLGHDYFEKNHQEP 222
            R         HIQ+   P      N    +     +F    W  L   +    ++ +  
Sbjct: 189 AR----RVGLEHIQVIIAP------NDLRNKKPSTSTFAQPRW--LPELYKQIAESLKPF 236


>gi|104783244|ref|YP_609742.1| hypothetical protein PSEEN4271 [Pseudomonas entomophila L48]
 gi|95112231|emb|CAK16958.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 185

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 82/188 (43%), Gaps = 30/188 (15%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + LF L +  ++    + ++I K         +  +  +         + + K+E 
Sbjct: 1   MRWLLALFCLSVASVSQAAFTETIIRKPASTQQPASLAMVAPQGPQIDK---VLVLKSER 57

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L++  R        LK Y+I       G K   GD++ PEG Y++ W  +  + +Y L+
Sbjct: 58  RLQLISRG-----EPLKTYRISLGKQPKGAKEREGDKKTPEGLYWLDWRKV--SDRYNLA 110

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G+ +MIHG                 + GC AM N  M+E
Sbjct: 111 MHISYPNITDAAKARRDGVAAGSMIMIHGTPINEEYPEWYFHTLDWTEGCIAMRNDDMRE 170

Query: 163 IYAIVRDS 170
           ++++V+D 
Sbjct: 171 VWSMVKDG 178


>gi|26988184|ref|NP_743609.1| hypothetical protein PP_1451 [Pseudomonas putida KT2440]
 gi|24982920|gb|AAN67073.1|AE016336_5 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|313500324|gb|ADR61690.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 184

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 77/187 (41%), Gaps = 29/187 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + LF L +       +         P       S  ++   P    V+ I K+E  
Sbjct: 1   MRWLLALFCLCV--TSVSQAAFTETIIRKPAPAAQTPSPSQQAMQPLIDKVLVI-KSERR 57

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L++  R        LK Y+I       G K   GD++ PEG Y++ W     + ++ L++
Sbjct: 58  LQLISRG-----EPLKTYRISLGKQPKGAKEREGDKKTPEGLYWLDWR--KQSDRFNLAM 110

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A         G+ +MIHG                 + GC AM N+ MQE+
Sbjct: 111 HINYPNISDAARATRAGVNAGSMIMIHGTPINDEYPEWYFHTLDWTDGCIAMRNRDMQEV 170

Query: 164 YAIVRDS 170
           + +VRD 
Sbjct: 171 WDLVRDG 177


>gi|146278672|ref|YP_001168831.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556913|gb|ABP71526.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 164

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 78/199 (39%), Gaps = 49/199 (24%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      L+  L + L  C  S+  I K E P   +                 +++ K E
Sbjct: 1   MKFLKITLII-LALGLTACGDSK--IRKYEGPPVTS-----------------VQVHKAE 40

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + +          +L++Y I       G K   GD + PEG Y+I     NP S Y L
Sbjct: 41  RKMYLLSGA-----KVLRQYDIGLGFKPTGHKQYEGDGRTPEGVYFIDRQ--NPRSSYHL 93

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHG---------ECASAGCYAMNNKQMQEIYAI 166
           S+ I +PN  D+        + G D+ IHG            +AGC A+ +++++EIYA+
Sbjct: 94  SLGISYPNTADQKMAFLEGKKPGGDIFIHGRGKYNGPNKRDWTAGCIAVTDQEVEEIYAM 153

Query: 167 VRDSLRGNMQSHIQIQAFP 185
           VR            I   P
Sbjct: 154 VRVGT--------PIYILP 164


>gi|302185720|ref|ZP_07262393.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. syringae 642]
          Length = 187

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLLALFCMSFVPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY+I W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWIDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +M+HG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNVSDSARARSEGVKPGSMIMLHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|148549476|ref|YP_001269578.1| hypothetical protein Pput_4270 [Pseudomonas putida F1]
 gi|148513534|gb|ABQ80394.1| conserved hypothetical protein [Pseudomonas putida F1]
          Length = 184

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 77/187 (41%), Gaps = 29/187 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + LF L +       +         P       S  ++   P    V+ I K+E  
Sbjct: 1   MRWLLALFCLCV--TSVSQAAFTETIIRKPAPAAQTPSPSQQAMQPLIDKVLVI-KSERR 57

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L++  R        LK Y+I       G K   GD++ PEG Y++ W     + ++ L++
Sbjct: 58  LQLISRG-----EPLKTYRISLGKQPKGAKEREGDKKTPEGLYWLDWR--KQSDRFNLAM 110

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A         G+ +MIHG                 + GC AM N+ MQE+
Sbjct: 111 HINYPNISDAARATRAGVSAGSMIMIHGTPINDEYPEWYFHTLDWTDGCIAMRNRDMQEV 170

Query: 164 YAIVRDS 170
           + +VRD 
Sbjct: 171 WDLVRDG 177


>gi|325273813|ref|ZP_08140000.1| hypothetical protein G1E_11950 [Pseudomonas sp. TJI-51]
 gi|324101053|gb|EGB98712.1| hypothetical protein G1E_11950 [Pseudomonas sp. TJI-51]
          Length = 184

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 29/187 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + +F L +       +         P+      S  ++   P    V+ I K+E  
Sbjct: 1   MRWLLAIFCLCV--TSVSQAAFTETIIRKPVQAAPSPSPSQQAMQPLIDKVLVI-KSERR 57

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L++  R        LK Y+I       G K   GD++ PEG Y++ W     + ++ L++
Sbjct: 58  LQLISRG-----EPLKTYRISLGKQPKGAKQREGDKKTPEGLYWLDWR--KQSDRFNLAM 110

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A         G+ +MIHG                 + GC AM N+ MQE+
Sbjct: 111 HINYPNSNDAARATREGVSAGSMIMIHGTPINDEYPEWYFHTLDWTDGCIAMRNRDMQEV 170

Query: 164 YAIVRDS 170
           + +VRD 
Sbjct: 171 WNLVRDG 177


>gi|77464780|ref|YP_354284.1| hypothetical protein RSP_1201 [Rhodobacter sphaeroides 2.4.1]
 gi|221640697|ref|YP_002526959.1| hypothetical protein RSKD131_2598 [Rhodobacter sphaeroides KD131]
 gi|77389198|gb|ABA80383.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|221161478|gb|ACM02458.1| Hypothetical Protein RSKD131_2598 [Rhodobacter sphaeroides KD131]
          Length = 166

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 81/200 (40%), Gaps = 49/200 (24%)

Query: 1   MTNRYN-ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
           M  ++  I L  L + L GC  S+  I K + P   +                 +++ K 
Sbjct: 1   MNMKFLKITLIVLALGLAGCGDSK--IRKYDGPPVTS-----------------VQVHKA 41

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           +  + +   +      +L++Y +       G K   GD + PEG Y+I     NP S Y 
Sbjct: 42  DRKMYLLNGS-----KVLRQYDVGLGFKPTGHKQYEGDGRTPEGVYFIDRQ--NPRSTYH 94

Query: 120 LSINIGFPNEFDKAHN-----RTGADLMIHG---------ECASAGCYAMNNKQMQEIYA 165
           LS+ I +PN  D+        + G D+ IHG            +AGC A+ + +++E+Y+
Sbjct: 95  LSLGISYPNVLDQKMAFLEGKKPGGDIFIHGRGKYNGPNRRDWTAGCIAITDDEVEEVYS 154

Query: 166 IVRDSLRGNMQSHIQIQAFP 185
           +VR            I   P
Sbjct: 155 MVRLGT--------PIYILP 166


>gi|254464093|ref|ZP_05077504.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacterales bacterium Y4I]
 gi|206685001|gb|EDZ45483.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacterales bacterium Y4I]
          Length = 135

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 26/134 (19%)

Query: 56  IFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN 115
           I K+   L +  +       +L+EY +       G K   GD + PEG Y I     NPN
Sbjct: 2   INKSSRKLYLLHKE-----EVLREYDVDLGFAPQGHKQFEGDGKTPEGTYVIDRR--NPN 54

Query: 116 SKYFLSINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMN 156
           S+Y LS+ I +PN  D+A       + G ++ IHG+                +AGC A++
Sbjct: 55  SRYHLSVGISYPNVEDRATAEAAGKKPGGEIFIHGQPNNPKERKRAARVSDWTAGCIAVS 114

Query: 157 NKQMQEIYAIVRDS 170
           N  ++EIYA+V+D 
Sbjct: 115 NDDIEEIYAMVQDG 128


>gi|120553064|ref|YP_957415.1| hypothetical protein Maqu_0121 [Marinobacter aquaeolei VT8]
 gi|120322913|gb|ABM17228.1| conserved hypothetical protein [Marinobacter aquaeolei VT8]
          Length = 185

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/189 (21%), Positives = 77/189 (40%), Gaps = 30/189 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  + +  +   L     +  L+ +A+  +  +       +        +  + K E
Sbjct: 1   MIVRVLLTIALIASPLLA--SASELLARADTRMMPSAPEPALMEGLLEITQVL--VNKGE 56

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L +   +       +++Y+I       G K+  GDE+ PEG Y + W   N +S ++ 
Sbjct: 57  RRLYLLSGD-----EPVRQYRISLGDNPVGHKLYEGDERTPEGDYVLDWR--NASSDFYK 109

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           SI+I +P+  D+          G  +MIHG                 + GC A++N+ M 
Sbjct: 110 SIHISYPSPRDRELAEAWGLDPGGSIMIHGLPNNAGDMAFAYTGLDWTNGCIAVSNEAMD 169

Query: 162 EIYAIVRDS 170
           EI+ +V++ 
Sbjct: 170 EIWQLVQNG 178


>gi|126724610|ref|ZP_01740453.1| ErfK/YbiS/YcfS/YnhG-like protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126705774|gb|EBA04864.1| ErfK/YbiS/YcfS/YnhG-like protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 166

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 31/160 (19%)

Query: 42  QKKRTSPFHPTVIR--IFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQ 99
             K      PTV R  +FK    L I+         +L  +++       G K   GD +
Sbjct: 22  SSKFKRYHGPTVTRLAVFKESRKLYIFHNET-----VLAAHEVELGFAPVGHKEVEGDGK 76

Query: 100 APEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIH---------G 145
            PEG Y+I     NPNS + LS+ I +PN+ D+          G D+ IH         G
Sbjct: 77  TPEGRYFIDRR--NPNSSFHLSLGISYPNDADRKAAAELGESPGGDIFIHGQKSLTNRGG 134

Query: 146 ECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           +  +AGC ++ N +M++IYA+V +         + I  +P
Sbjct: 135 DDWTAGCISVTNDEMEDIYAMVPNG--------VPIDIYP 166


>gi|149912912|ref|ZP_01901446.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. AzwK-3b]
 gi|149813318|gb|EDM73144.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. AzwK-3b]
          Length = 165

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/131 (32%), Positives = 60/131 (45%), Gaps = 21/131 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I + K E  + +          +L+ + I       G K   GD + PEG Y+I     N
Sbjct: 35  IIVNKGEREMHLLHHG-----RVLRSFDIHLGFAPEGHKQVEGDGKTPEGEYFIDRR--N 87

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC---------ASAGCYAMNNKQ 159
           PNS + LSI I +PNE D A         G D+ IHG            + GC A+ +K+
Sbjct: 88  PNSSFHLSIGISYPNEMDVARAASMGMSPGGDIFIHGAPQTVRRHRPDWTEGCIAVTDKE 147

Query: 160 MQEIYAIVRDS 170
           M+ IYA+V+D 
Sbjct: 148 MEIIYAMVKDG 158


>gi|289677908|ref|ZP_06498798.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. syringae FF5]
 gi|330969039|gb|EGH69105.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 187

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLLALFCMSFMPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY+I W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWIDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +M+HG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNVSDSARARSEGVKPGSMIMLHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|66044519|ref|YP_234360.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. syringae B728a]
 gi|63255226|gb|AAY36322.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. syringae B728a]
          Length = 187

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLLALFCMSFMPLSQAALTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY+I W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWIDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +M+HG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNVSDSARARSEGVKPGSMIMLHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|85859401|ref|YP_461603.1| protein ERFK [Syntrophus aciditrophicus SB]
 gi|85722492|gb|ABC77435.1| protein ERFK [Syntrophus aciditrophicus SB]
          Length = 314

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 75/181 (41%), Gaps = 36/181 (19%)

Query: 24  SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKIC 83
           + + K    L   L   +      P    +I   K +  L +  R+      +LK YKI 
Sbjct: 151 AALRKNIEALERELKNRISAIPNMPADRILIE--KRKRRLTLIARD-----KVLKMYKIA 203

Query: 84  AWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TG 138
                 GPKI  GD + PEG Y I     N +S+Y L+++I +PN+ D+   R      G
Sbjct: 204 LGGNPDGPKIRQGDNKTPEGTYIIDSR--NRDSRYHLALHISYPNDEDRKRARRLGVSPG 261

Query: 139 ADLMIHG--------------ECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
            ++MIHG                 + GC A+ N++++EI  +VR+           +   
Sbjct: 262 GNIMIHGLRNGFSWIGDFHTANDWTKGCIAVTNEEIEEIARLVRNGTI--------VHIL 313

Query: 185 P 185
           P
Sbjct: 314 P 314


>gi|170723329|ref|YP_001751017.1| hypothetical protein PputW619_4168 [Pseudomonas putida W619]
 gi|169761332|gb|ACA74648.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 184

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 78/188 (41%), Gaps = 31/188 (16%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+   LF L +  ++    + ++I K + PL          +         + + K+E 
Sbjct: 1   MRWLFALFCLCVTSVSQAAFTETIIRKPQPPLPAQSQSQAAMQPLIDK----VLVIKSER 56

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L++  R        LK Y+I       G K   GD++ PEG Y++ W     + ++ LS
Sbjct: 57  RLQLISRG-----EPLKTYRISLGKQPKGAKQREGDKKTPEGLYWLDWR--KQSDRFNLS 109

Query: 122 INIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A         G+ +MIHG                 + GC AM N  M+E
Sbjct: 110 MHITYPNISDAARATREGWSAGSMIMIHGTPINDEYPEWYFHTLDWTDGCIAMRNSDMRE 169

Query: 163 IYAIVRDS 170
           ++ +V D 
Sbjct: 170 VWDLVPDG 177


>gi|167947682|ref|ZP_02534756.1| hypothetical protein Epers_14537 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 249

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/238 (25%), Positives = 104/238 (43%), Gaps = 39/238 (16%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF----- 57
            R+ ++L    +       + +L   A  PLS  ++  +++       P + R F     
Sbjct: 1   MRFAVILLCFTLI------AGTLPVAANEPLSPEVVQVLERL-VPRLEPQLRRRFEQAGV 53

Query: 58  ------------KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                       K E  +E+W  +    +  + +Y++ A SG  GPK+  GD Q PEGFY
Sbjct: 54  EYPPARLQLISLKQEQQIEVWAADA-GPWRHIHDYQVLAASGVAGPKLREGDRQVPEGFY 112

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFD----KAHNR--TGADLMIHGECASAGCYAMNNKQ 159
            I    LNP+S++ LSI + FPN FD     A  R   G+++ IHG   S GC A+ ++ 
Sbjct: 113 QIEA--LNPHSRFHLSIKLNFPNSFDWLNAHAEGRRQPGSNIFIHGSAWSVGCLAIGDQA 170

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQ-LYQNNPN-YSFWNMLKLGHDYF 215
           ++E++ +V      + Q    +   P+    +  Q      P     ++ L+ G   F
Sbjct: 171 VEELFLLV----ARSWQEPASVMILPYDFRCQAPQLPAAARPWVAELYSYLQQGVARF 224


>gi|110677799|ref|YP_680806.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter denitrificans OCh
           114]
 gi|109453915|gb|ABG30120.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter denitrificans OCh
           114]
          Length = 153

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 57/130 (43%), Gaps = 21/130 (16%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + + K    + +           L+ Y I       G K   GD + PEG Y I     
Sbjct: 22  FVVVNKGARRMHLLHNETA-----LRSYDIHLGFAPVGHKQFEGDGKTPEGLYRIDRR-- 74

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE---------CASAGCYAMNNK 158
           NPNS + LS+ I +PN  D A  +      G D+ IHG+           + GC A+ N 
Sbjct: 75  NPNSDFHLSLGISYPNVNDYAAAKAVGKSPGGDIFIHGQKSPFRKDEPDWTWGCIAVTNP 134

Query: 159 QMQEIYAIVR 168
           +++EIYA+V+
Sbjct: 135 EIEEIYAMVQ 144


>gi|85373228|ref|YP_457290.1| hypothetical protein ELI_02005 [Erythrobacter litoralis HTCC2594]
 gi|84786311|gb|ABC62493.1| hypothetical protein ELI_02005 [Erythrobacter litoralis HTCC2594]
          Length = 169

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 75/187 (40%), Gaps = 43/187 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           +  R   L+  L  F+  C  +   +     P+                    + + K++
Sbjct: 2   IRFRIPALMLGLA-FVASCAPTPQPVSVEAPPVD------------------FLLVDKSD 42

Query: 61  NILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             L +++   +     ++ Y  +       G K   GDE+ PEG Y I     NPNS Y+
Sbjct: 43  RTLALYRDGAE-----VRRYTGLQFGDAPLGHKRFEGDERTPEGRYTIDTR--NPNSAYY 95

Query: 120 LSINIGFPNEFDKAHN-----RTGADLMIHGEC-----------ASAGCYAMNNKQMQEI 163
           LS+ + +PN  D+A+        G D+ +HG+             + GC A  N +M E+
Sbjct: 96  LSLRVSYPNAQDRAYAEGQGRDPGGDIFLHGQPNWLPAGRMPGDWTDGCIAFTNAEMDEL 155

Query: 164 YAIVRDS 170
           + +VRD 
Sbjct: 156 WRLVRDG 162


>gi|53805015|ref|YP_113152.1| hypothetical protein MCA0637 [Methylococcus capsulatus str. Bath]
 gi|53758776|gb|AAU93067.1| conserved domain protein [Methylococcus capsulatus str. Bath]
          Length = 292

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/172 (30%), Positives = 88/172 (51%), Gaps = 14/172 (8%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
               ++        + L    ++   + P    V+   K E  LE+W R+  ++Y L++ 
Sbjct: 77  TVSDVLRDFGPYSVQKLKPYFERAGVAFPPREVVLVGLKQEKKLELWARD-GSDYRLIRH 135

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN---- 135
           Y I A SG+ GPK+  GD+Q PEG Y I    LNPNS Y LS+ + +PN+FD  H     
Sbjct: 136 YDIQAASGSAGPKLRQGDKQVPEGVYRIVG--LNPNSNYHLSMKLNYPNDFDLYHAQLEG 193

Query: 136 --RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
             + G+D+ IHG   SAGC AM ++ ++E++ +         + ++++   P
Sbjct: 194 RTQPGSDIFIHGRAVSAGCLAMGDEAIEELFVLTAQ----VGKENVKVVIAP 241


>gi|83952906|ref|ZP_00961635.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
 gi|83835697|gb|EAP74997.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
          Length = 158

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/178 (26%), Positives = 73/178 (41%), Gaps = 43/178 (24%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           +  L  FL+GC          E                     T +R++K + +L +   
Sbjct: 1   MGGLAAFLSGCASKFRSYGGPEV--------------------TRVRLYKGQRLLVL--- 37

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
             D    +L+ Y +       G K   GD + PEG Y +     NP S Y LS+ I +PN
Sbjct: 38  --DGADRVLQTYPVGLGFAPEGHKQFEGDGRTPEGAYVVDKR--NPESTYHLSVGISYPN 93

Query: 129 EFDKAHNR-----TGADLMIHGEC-----------ASAGCYAMNNKQMQEIYAIVRDS 170
           E D A         G D+ IHG              +AGC A+ ++Q+++IYA+V+D 
Sbjct: 94  EADIAFAEAQGLSPGGDIFIHGGPRPGIDPTDVRDWTAGCIAVTDRQIEDIYAMVKDG 151


>gi|330895915|gb|EGH28200.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330936942|gb|EGH41053.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330975932|gb|EGH75998.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 187

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 91/189 (48%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLLALFCMSFMPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +M+HG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNVSDSARARSEGVKPGSMIMLHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|222053244|ref|YP_002535606.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. FRC-32]
 gi|221562533|gb|ACM18505.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. FRC-32]
          Length = 323

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           L   +            I I K +  L ++ +       +LK Y+I       GPK   G
Sbjct: 171 LEQKISALTIQKVTADRILIEKKQRRLTLFSKG-----EVLKTYRIALGGNPDGPKERQG 225

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG------ 145
           D + PEG Y+I     N +S+Y L+++I +PNE DK   +      G ++MIHG      
Sbjct: 226 DNKTPEGTYFIDSR--NRDSRYHLALHISYPNERDKRRAKELGVAPGGNIMIHGLKNGFS 283

Query: 146 --------ECASAGCYAMNNKQMQEIYAIVRDS 170
                      + GC A+ ++++ EI   V + 
Sbjct: 284 YVGDLHTKADWTKGCIAVTDEEIAEIAKAVPNG 316


>gi|148264213|ref|YP_001230919.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter uraniireducens Rf4]
 gi|146397713|gb|ABQ26346.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter uraniireducens Rf4]
          Length = 337

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K E  L +  +       +LK YKI       GPK   GD + PEG Y+I     N
Sbjct: 202 ILIEKKERRLMLISKG-----EVLKTYKIALGGNPNGPKERQGDNKTPEGTYFIDSR--N 254

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------------ECASAGCYA 154
            +S Y LS++I +PNE DK   +     TG ++MIHG                 + GC A
Sbjct: 255 KDSHYHLSLHISYPNERDKKRAKELGVSTGGNIMIHGIKNGFSWVGDFHTEVDWTKGCIA 314

Query: 155 MNNKQMQEIYAIVRDS 170
           + +++++EI  +  + 
Sbjct: 315 VTDEEIEEIAKLAPNG 330


>gi|90411123|ref|ZP_01219136.1| hypothetical protein P3TCK_06142 [Photobacterium profundum 3TCK]
 gi|90327969|gb|EAS44290.1| hypothetical protein P3TCK_06142 [Photobacterium profundum 3TCK]
          Length = 238

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 58/202 (28%), Positives = 91/202 (45%), Gaps = 19/202 (9%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRT-SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK 81
             +I +    L   + +  ++     P     +   K E  +E+W ++    +V +K Y 
Sbjct: 42  GDVIKRYSPILEPRISLMFEQVGVQYPPEQVALFALKEEMQVELWAKD-GEAWVYIKRYD 100

Query: 82  ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA------HN 135
           I   SG  GPK+  GD Q PEG Y +    LNPNSKY LS+ + +PNEFD         N
Sbjct: 101 IAKISGKSGPKLREGDHQVPEGIYQV--IGLNPNSKYHLSMQLNYPNEFDLKYAQLEKRN 158

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQL 195
           R GA++ IHG+  S GC AM +  ++E++ +V  +       ++Q+   P       +  
Sbjct: 159 RPGANIFIHGKAKSVGCLAMGDIAIEELFLLVERAKI----QNVQVVISPSDPRKGPLVP 214

Query: 196 YQNNPNYSFWNMLKLGHDYFEK 217
               P   FW      +   EK
Sbjct: 215 AYGQP---FWVT--QLYRDIEK 231


>gi|330872830|gb|EGH06979.1| hypothetical protein PSYMP_01409 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330968074|gb|EGH68334.1| hypothetical protein PSYAC_26222 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 187

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + FI L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 1   MRWLLALFCMSFIPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKKIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y++       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRVSLGKNPTGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|315267942|gb|ADT94795.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica OS678]
          Length = 170

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 34/172 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           ++   ++S     +      ++ I K+E+ + + +        +LK+Y+I       G K
Sbjct: 14  VTIAALVSPVLHASGMGKVDLVVITKSESSMALLRDG-----KILKQYRIAMGDLPAGHK 68

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE- 146
           ++ GD++ P+G Y + +    P+S Y+ SI+I +PNE DK        R G  +MIHG+ 
Sbjct: 69  LKEGDQRTPQGRYTLDYK--KPDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQN 126

Query: 147 -------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                          + GC A+ N +M E++ +V +           I+ +P
Sbjct: 127 PKSPLPPEQAQQYNWTDGCIAITNAEMDEVWKVVDEGT--------PIEIWP 170


>gi|42522152|ref|NP_967532.1| hypothetical protein Bd0553 [Bdellovibrio bacteriovorus HD100]
 gi|39574683|emb|CAE78525.1| unnamed protein product [Bdellovibrio bacteriovorus HD100]
          Length = 220

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 36/198 (18%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT-------- 52
           M      L+    + L     S++     ++      I  +  +                
Sbjct: 17  MKKLIFPLIALTLVSLQSFAGSKATDRSYKYCDDMTQIDKLLDRSRESVERIQREGLNIE 76

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I + K++  L +   +      LL+ Y +       G K   GD + PEG Y I +   
Sbjct: 77  RIVVSKDKRQLYLVSGDT-----LLRTYTVAFGWNFIGHKQFEGDGKTPEGIYSIDYK-- 129

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC----------------ASAG 151
           NP S++  S+++ +PN+ D A+ +      G D+MIHG                   + G
Sbjct: 130 NPKSQFTKSLHVDYPNKADIAYAKSQGRSPGGDIMIHGLPSNPQKYERISKIHPYDWTLG 189

Query: 152 CYAMNNKQMQEIYAIVRD 169
           C A+ NK+++EIYA+V++
Sbjct: 190 CIAVTNKEIEEIYALVKE 207


>gi|298488264|ref|ZP_07006297.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298157203|gb|EFH98290.1| lipoprotein, putative [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 187

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+    F + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLFAFFCMSFVPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSV 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +VRD 
Sbjct: 172 EIWDLVRDG 180


>gi|160875753|ref|YP_001555069.1| hypothetical protein Sbal195_2641 [Shewanella baltica OS195]
 gi|160861275|gb|ABX49809.1| conserved hypothetical protein [Shewanella baltica OS195]
          Length = 188

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 34/172 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           ++   ++S     +      ++ I K+E+ + + +        +LK+Y+I       G K
Sbjct: 32  VTIAALVSPVLHASGMGKVDLVVITKSESSMALLRDG-----KILKQYRIAMGDLPAGHK 86

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE- 146
           ++ GD++ P+G Y + +    P+S Y+ SI+I +PNE DK        R G  +MIHG+ 
Sbjct: 87  LKEGDQRTPQGRYTLDYK--KPDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQN 144

Query: 147 -------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                          + GC A+ N +M E++ +V +           I+ +P
Sbjct: 145 PKSPLPPEQAQQYNWTDGCIAITNAEMDEVWKVVDEGT--------PIEIWP 188


>gi|118579010|ref|YP_900260.1| ErfK/YbiS/YcfS/YnhG family protein [Pelobacter propionicus DSM
           2379]
 gi|118501720|gb|ABK98202.1| ErfK/YbiS/YcfS/YnhG family protein [Pelobacter propionicus DSM
           2379]
          Length = 334

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 66/134 (49%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K +  L ++ RN       LK Y+I       GPK   GD + PEG Y I     N
Sbjct: 199 ILIEKGDRRLTLFSRNEA-----LKSYRIALGGAPSGPKEREGDNKTPEGAYVIDSK--N 251

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------------ECASAGCYA 154
            NS+Y LS++I +PNE DK   +      G D+MIHG                 + GC A
Sbjct: 252 GNSQYHLSLHISYPNERDKKRAQELGVSPGGDIMIHGIKNGFSWVGDSQADADWTRGCVA 311

Query: 155 MNNKQMQEIYAIVR 168
           +++++++EIY +V+
Sbjct: 312 VSDEEIEEIYKLVQ 325


>gi|330950757|gb|EGH51017.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas syringae Cit 7]
          Length = 187

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 50/189 (26%), Positives = 91/189 (48%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLLALFCMSFMPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSV 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARSAGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|237800073|ref|ZP_04588534.1| hypothetical protein POR16_14647 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|237806402|ref|ZP_04593106.1| hypothetical protein POR16_38084 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331022928|gb|EGI02985.1| hypothetical protein POR16_14647 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331027515|gb|EGI07570.1| hypothetical protein POR16_38084 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 187

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ +  F + F+ L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 1   MRWLLAFFCMSFLPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKKIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISDGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC AM N  M+
Sbjct: 112 SMHISYPNITDSARARNEGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIAMKNNDMR 171

Query: 162 EIYAIVRDS 170
           E++ +V+D 
Sbjct: 172 EVWDLVKDG 180


>gi|163747598|ref|ZP_02154946.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanibulbus indolifex HEL-45]
 gi|161379123|gb|EDQ03544.1| ErfK/YbiS/YcfS/YnhG family protein [Oceanibulbus indolifex HEL-45]
          Length = 157

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 49/177 (27%), Positives = 77/177 (43%), Gaps = 42/177 (23%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           +  L + L GC       D                        T +++FK++  L ++  
Sbjct: 1   MGGLALGLAGCASKFRTYDGP--------------------AVTRLQMFKSDRNLFLFNN 40

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN 128
                  +LK Y+I       GPK   GD + PEG Y +     NP+S + LSI I +PN
Sbjct: 41  TS-----VLKAYRIDLGFAAEGPKQFEGDGKTPEGTYTVDRR--NPDSLFHLSIGISYPN 93

Query: 129 EFDKAHN-----RTGADLMIHGEC----------ASAGCYAMNNKQMQEIYAIVRDS 170
           E D A+        G D+ IHG             +AGC A++++++++IYA+VRD 
Sbjct: 94  EADIAYAAAQGQEPGGDIFIHGGPRPGIDAIKPDWTAGCIAVSDREIEDIYAMVRDG 150


>gi|85859827|ref|YP_462029.1| hypothetical protein SYN_00443 [Syntrophus aciditrophicus SB]
 gi|85722918|gb|ABC77861.1| hypothetical membrane protein [Syntrophus aciditrophicus SB]
          Length = 313

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 90/200 (45%), Gaps = 18/200 (9%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLK 78
                +I K        +    +K         +   + K E  LE+W R  D  +V ++
Sbjct: 50  PSVAGVIRKIGPRAEARIKPFFEKAGLPYPSRRLAFVVLKEEKKLEVWTR-YDGNWVHVR 108

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT- 137
            Y I A SG+ GPK + GD Q PEG Y I   +LNP S++ LS+ I +PN +D    R  
Sbjct: 109 TYDILAASGSRGPKRKKGDYQVPEGIYQIV--SLNPASRFHLSMKINYPNAYDLQMARNE 166

Query: 138 -----GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKN 192
                G D+ IHG+  S GC AM NK ++E++ +V          ++++   P  +   +
Sbjct: 167 QRSNLGGDIFIHGKTRSHGCLAMGNKAIEELFVLV----AKTRPRNVKVVIAPHDLRKSD 222

Query: 193 MQLYQNNPNYSFWNMLKLGH 212
             L  N P+   W  L   +
Sbjct: 223 PAL--NLPSQPSW--LPDLY 238


>gi|213972051|ref|ZP_03400145.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301385883|ref|ZP_07234301.1| hypothetical protein PsyrptM_24748 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063774|ref|ZP_07255315.1| hypothetical protein PsyrptK_27639 [Pseudomonas syringae pv. tomato
           K40]
 gi|302132524|ref|ZP_07258514.1| hypothetical protein PsyrptN_14095 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213923184|gb|EEB56785.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 187

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF + FI L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 1   MRWLLALFCVSFIPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKKIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y++       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRVSLGKNPTGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|126463622|ref|YP_001044736.1| hypothetical protein Rsph17029_2862 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559675|ref|ZP_08413997.1| hypothetical protein RSWS8N_11470 [Rhodobacter sphaeroides WS8N]
 gi|126105286|gb|ABN77964.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332277387|gb|EGJ22702.1| hypothetical protein RSWS8N_11470 [Rhodobacter sphaeroides WS8N]
          Length = 164

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 78/193 (40%), Gaps = 48/193 (24%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           I L  L + L GC  S+  I K + P   +                 +++ K +  + + 
Sbjct: 6   ITLIVLALGLAGCGDSK--IRKYDGPPVTS-----------------VQVHKADRKMYLL 46

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
             +      +L++Y +       G K   GD + PEG Y+I     NP S Y LS+ I +
Sbjct: 47  NGS-----KVLRQYDVGLGFKPTGHKQYEGDGRTPEGVYFIDRQ--NPRSTYHLSLGISY 99

Query: 127 PNEFDKAHN-----RTGADLMIHG---------ECASAGCYAMNNKQMQEIYAIVRDSLR 172
           PN  D+        + G D+ IHG            +AGC A+ + +++E+Y++VR    
Sbjct: 100 PNVLDQKMAFLEGKKPGGDIFIHGRGKYNGPNRRDWTAGCIAITDDEVEEVYSMVRLGT- 158

Query: 173 GNMQSHIQIQAFP 185
                   I   P
Sbjct: 159 -------PIYILP 164


>gi|126730073|ref|ZP_01745885.1| ErfK/YbiS/YcfS/YnhG [Sagittula stellata E-37]
 gi|126709453|gb|EBA08507.1| ErfK/YbiS/YcfS/YnhG [Sagittula stellata E-37]
          Length = 165

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 22/132 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K E  L +   +      +LK Y +       G K   GD + PEG Y+I     N
Sbjct: 34  VVVNKGERRLHLLHHD-----KVLKSYNVGLGFAPQGHKFIEGDGKTPEGNYFIDRR--N 86

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE----------CASAGCYAMNNK 158
           PNSK++LSI I +PN  D+   +      G D+ IHG+            +AGC A+ +K
Sbjct: 87  PNSKFYLSIGISYPNPVDRMTAQELGKSPGGDIFIHGQGPNYRKGSPRDWTAGCIAVTDK 146

Query: 159 QMQEIYAIVRDS 170
           QM++IYA+V+D 
Sbjct: 147 QMRDIYAMVQDG 158


>gi|71736308|ref|YP_273601.1| hypothetical protein PSPPH_1343 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487172|ref|ZP_05641213.1| hypothetical protein PsyrptA_28111 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289625953|ref|ZP_06458907.1| hypothetical protein PsyrpaN_12636 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647895|ref|ZP_06479238.1| hypothetical protein Psyrpa2_09102 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|71556861|gb|AAZ36072.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323189|gb|EFW79278.1| hypothetical protein PsgB076_19577 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329540|gb|EFW85529.1| hypothetical protein PsgRace4_12078 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330867514|gb|EGH02223.1| hypothetical protein PSYAE_09719 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874811|gb|EGH08960.1| hypothetical protein Pgy4_06879 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330894520|gb|EGH27181.1| hypothetical protein PSYMO_39125 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330985037|gb|EGH83140.1| hypothetical protein PLA107_08431 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009210|gb|EGH89266.1| hypothetical protein PSYTB_05857 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 187

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+    F + F+ L+    +++++ K +E  +  N +I+ +   + P    +  + K+ 
Sbjct: 1   MRWLFAFFCMSFVPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKPIDKVL--VLKSV 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|304409118|ref|ZP_07390739.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica OS183]
 gi|307303121|ref|ZP_07582876.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica BA175]
 gi|304352939|gb|EFM17336.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica OS183]
 gi|306913481|gb|EFN43903.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica BA175]
          Length = 188

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 34/172 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           ++   ++S     +      ++ I K+E+ + + +        +LK+Y+I       G K
Sbjct: 32  VTIAALVSPVLHASGMGKVDLVVITKSESSMALLRDG-----KILKQYRIAMGDLPAGHK 86

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE- 146
           ++ GD++ P+G Y + +    P+S Y+ SI+I +PNE DK        R G  +MIHG+ 
Sbjct: 87  LKEGDQRTPQGRYTLDYK--KPDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQN 144

Query: 147 -------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                          + GC A+ N +M E++ +V +           I+ +P
Sbjct: 145 PKSPLSPEQAQQYNWTDGCIAITNAEMDEVWKVVDEGT--------PIEIWP 188


>gi|54302191|ref|YP_132184.1| hypothetical protein PBPRB0511 [Photobacterium profundum SS9]
 gi|46915612|emb|CAG22384.1| hypothetical protein PBPRB0511 [Photobacterium profundum SS9]
          Length = 246

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 19/200 (9%)

Query: 25  LIDKAEHPLSENLIISMQKKRT-SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKIC 83
           +I +    L   + +  ++     P     +   K E  +E+W ++    +V +K Y I 
Sbjct: 52  VIKRYSPILEPRISLMFEQVGVQYPPEQIAMFALKEEMQVELWAKD-GEAWVYIKRYDIA 110

Query: 84  AWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA------HNRT 137
             SG  GPK+  GD Q PEG Y +    LNPNSKY LS+ + +PNEFD         NR 
Sbjct: 111 KISGKSGPKLREGDHQVPEGIYQV--IGLNPNSKYHLSMQLNYPNEFDLKYAQLEKRNRP 168

Query: 138 GADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQ 197
           GA++ IHG+  S GC AM +  ++E++ +V  +       ++Q+   P       +    
Sbjct: 169 GANIFIHGKAKSVGCLAMGDIAIEELFLLVERAQI----QNVQVVISPSDPRKGPLVPAY 224

Query: 198 NNPNYSFWNMLKLGHDYFEK 217
             P   FW      +   EK
Sbjct: 225 GQP---FWVT--QLYRDIEK 239


>gi|153874627|ref|ZP_02002774.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152068908|gb|EDN67225.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 172

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/127 (38%), Positives = 71/127 (55%), Gaps = 9/127 (7%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
            P     +  FK E  LE+W       +  ++ Y I A SG  GPK+  GD Q PEG Y 
Sbjct: 3   YPPQRLALLGFKAEKRLEVWAEQQT-TWQFIRNYPILAASGVAGPKLREGDRQVPEGIYR 61

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHN----RT--GADLMIHGECASAGCYAMNNKQM 160
           I +  LNPNS+Y LS+ I +PNEFD+       RT  G ++ IHG+  S GC A+ ++ +
Sbjct: 62  INF--LNPNSRYHLSMQINYPNEFDRRKAALENRTDLGGEIFIHGKAVSIGCLAIGDEAI 119

Query: 161 QEIYAIV 167
           +E++ +V
Sbjct: 120 EELFVLV 126


>gi|256823749|ref|YP_003147712.1| hypothetical protein Kkor_2536 [Kangiella koreensis DSM 16069]
 gi|256797288|gb|ACV27944.1| conserved hypothetical protein [Kangiella koreensis DSM 16069]
          Length = 243

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/197 (27%), Positives = 89/197 (45%), Gaps = 14/197 (7%)

Query: 12  LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNENILEIWKRNV 70
           L+I + G      ++          ++   +   +S P     +   K E  LE+W  + 
Sbjct: 31  LYIKVAGARTVEDVVQTYGEEARNRMVPYFEAAGSSYPPGSVALIAIKEEATLELWDTSA 90

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEF 130
               V +++Y + A SG  GPK+  GD Q PEG Y I +  LNPNS Y LS+ + +PN+F
Sbjct: 91  ANP-VFIRKYSVLAQSGVAGPKLREGDMQVPEGIYRIEY--LNPNSSYHLSMKLNYPNDF 147

Query: 131 DKAHNR------TGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAF 184
           D  H R       G ++ IHG+  S GC AM ++  +E++ +  D        +I +   
Sbjct: 148 DLTHARAEGRSEPGTNIFIHGKAVSIGCLAMGDEVAEELFVLASD----IGHRNIDVAIA 203

Query: 185 PFRMTSKNMQLYQNNPN 201
           P     + +Q     P 
Sbjct: 204 PKDPRKEQLQPISELPW 220


>gi|308535397|ref|YP_002140778.2| peptidoglycan L,D-transpeptidase lipoprotein [Geobacter
           bemidjiensis Bem]
 gi|308052742|gb|ACH40982.2| peptidoglycan L,D-transpeptidase lipoprotein, YkuD family, TPR
           domain-containing protein [Geobacter bemidjiensis Bem]
          Length = 335

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/153 (26%), Positives = 63/153 (41%), Gaps = 26/153 (16%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
                 +            + I K E  L +  +       ++K YKI       GPK  
Sbjct: 181 AAQEEEISPPPVPTGPADKVLIEKKERRLTLLSKG-----EVIKSYKISLGENPNGPKER 235

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--- 146
            GD + PEG Y I     N +S+Y LS++I +PNE DK   +      G ++MIHG    
Sbjct: 236 QGDNKTPEGIYRIDSR--NNDSQYHLSLHISYPNEQDKKRAKQLGVAPGGNIMIHGMRNG 293

Query: 147 -----------CASAGCYAMNNKQMQEIYAIVR 168
                        + GC A+ ++++QEI  +V 
Sbjct: 294 FSWFGEHHTLIDWTKGCIAVTDEEIQEIAELVP 326


>gi|83649037|ref|YP_437472.1| hypothetical protein HCH_06401 [Hahella chejuensis KCTC 2396]
 gi|83637080|gb|ABC33047.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 178

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 71/191 (37%), Gaps = 41/191 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M   +  L   LF     C         +        +  +  K         +++ K  
Sbjct: 1   MRKGFLFLTGVLF----ACSAGAEQAQTSLALSESAYMAPLVDK---------VQVKKAS 47

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            +L + K          + Y I       G K   GDE+ PEG Y + W   NPNS +  
Sbjct: 48  RLLILLKEG-----KPFRVYPIALGDKPLGHKQFEGDERTPEGTYSLDWR--NPNSAFHK 100

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC----------------ASAGCYAMNNKQ 159
           SI++ +PN+ D  + +      G  +MIHG                   + GC A+NN+ 
Sbjct: 101 SIHVSYPNDQDIEYAKSQGREPGGMIMIHGWPNGFNHDRDSIWLYEFDWTDGCIAVNNQA 160

Query: 160 MQEIYAIVRDS 170
           M EI+++V D 
Sbjct: 161 MDEIWSLVPDG 171


>gi|330959130|gb|EGH59390.1| hypothetical protein PMA4326_11282 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 187

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/189 (25%), Positives = 90/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLFALF-IFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF L  + L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 1   MRWLLALFCLSCVPLSQAAFTQTIVPKGSEQKIINNRVINTESIASKKIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++   +       LK Y+I       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGSEA-----LKTYRISLGKNPKGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNITDAARARSEGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           E++ +V+D 
Sbjct: 172 EVWDLVKDG 180


>gi|262371690|ref|ZP_06064969.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter junii SH205]
 gi|262311715|gb|EEY92800.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter junii SH205]
          Length = 179

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 66/163 (40%), Gaps = 30/163 (18%)

Query: 31  HPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG 90
            P+   L     ++       T I +FK +     W+  +     +++ Y I       G
Sbjct: 17  APIHPALSAQEIEEINKTKPVTTIEVFKQQ-----WQLKLKHHDQIIRSYPIRLGFNPMG 71

Query: 91  PKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG 145
            K   GD + PEG Y I W   NP S Y+ S++I +PN  D  + +      G D+MIHG
Sbjct: 72  HKQFEGDGKTPEGTYTIDWR--NPQSAYYKSLHISYPNPNDLTYAKQRQKSAGGDVMIHG 129

Query: 146 E------------------CASAGCYAMNNKQMQEIYAIVRDS 170
                                + GC A+ N  M EI+ +V++ 
Sbjct: 130 TVPTPATALPASSTYMPRKDWTLGCIAVTNADMDEIWQLVKNG 172


>gi|119386750|ref|YP_917805.1| ErfK/YbiS/YcfS/YnhG family protein [Paracoccus denitrificans
           PD1222]
 gi|119377345|gb|ABL72109.1| ErfK/YbiS/YcfS/YnhG family protein [Paracoccus denitrificans
           PD1222]
          Length = 169

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 70/147 (47%), Gaps = 25/147 (17%)

Query: 42  QKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQA 100
            K +T    P   + + K    + +   N      +LK Y+I   +   G K   GD + 
Sbjct: 23  SKFKTYSGPPVTQVVVNKGARQMLLLNGNT-----VLKAYRIGLGNEPLGHKQFEGDGKT 77

Query: 101 PEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK----AHNRT-GADLMIHG---------- 145
           PEG YYI     NP+S+Y LSI I +PN  D        R+ G+D+ IHG          
Sbjct: 78  PEGLYYIDRR--NPDSRYHLSIGISYPNPHDAVLASELGRSAGSDIFIHGQGPEGRALSR 135

Query: 146 --ECASAGCYAMNNKQMQEIYAIVRDS 170
             +  +AGC A+ + ++++IYA+VRD 
Sbjct: 136 LRQDWTAGCIAVTDAEVEDIYAMVRDG 162


>gi|294140531|ref|YP_003556509.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella violacea DSS12]
 gi|293327000|dbj|BAJ01731.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella violacea DSS12]
          Length = 185

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/187 (21%), Positives = 81/187 (43%), Gaps = 34/187 (18%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R    + A+ IF  G     S +   ++ LS + ++++ K         ++ + K+ + 
Sbjct: 7   MRLFFSV-AILIFFAGISLPVSAVSSMQNSLSSSTLVNIGKID-------LVVVTKSTSS 58

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           + + +        +L+ Y I       G K + GD++ PEG Y + +     +S Y+ +I
Sbjct: 59  MALMRNG-----KVLRRYHIALGDRPRGHKTQEGDQRTPEGRYTLDYK--KFDSAYYRAI 111

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCYAMNNKQMQEI 163
           +I +PNE D+        + G  +MIHG+                + GC A+ N QM E+
Sbjct: 112 HISYPNEEDRLRASALGIQPGGQIMIHGQNPRSSLSAEEAQKYNWTDGCIAITNPQMDEL 171

Query: 164 YAIVRDS 170
           +  + + 
Sbjct: 172 WRAIDEG 178


>gi|319784695|ref|YP_004144171.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170583|gb|ADV14121.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 163

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 64/137 (46%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++R+ K E  LE+       +  +L+ Y I       G K + GD++ PEG Y + W   
Sbjct: 27  LVRVHKAERRLELI-----GDGKVLRNYGIALGGDPVGHKHQEGDQRTPEGNYVLDWR-- 79

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCY 153
           NPNS    SI+I +PN  D+A  +      G  +MIHG+                + GC 
Sbjct: 80  NPNSIAHKSIHISYPNADDEAAAKARNVGAGGMIMIHGQPNGYGWWGWLLQLVDWTDGCI 139

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ +  M EI+A+V D 
Sbjct: 140 AVTDSDMDEIWALVADG 156


>gi|146308430|ref|YP_001188895.1| hypothetical protein Pmen_3411 [Pseudomonas mendocina ymp]
 gi|145576631|gb|ABP86163.1| conserved hypothetical protein [Pseudomonas mendocina ymp]
          Length = 167

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 75/187 (40%), Gaps = 46/187 (24%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + L  L   L                +  +   ++            + + K+E  
Sbjct: 1   MRWLLPLLCLIFSL---------------DVLASTTPAISSHAVDK-----VLVLKSERK 40

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L + +R        +K Y+I       G K   GD + PEGFY+I W    P+ KY LS+
Sbjct: 41  LHLQRRGET-----IKSYRISLGKQPNGAKQREGDLRTPEGFYWIDWR--KPSDKYQLSL 93

Query: 123 NIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A  +      G+ +MIHG                 + GC AM N  M+E+
Sbjct: 94  HISYPNARDLARAKEAGVPPGSMIMIHGTPLDEEYPEWFFHTLDWTEGCIAMKNDDMREV 153

Query: 164 YAIVRDS 170
           +++V+D 
Sbjct: 154 WSLVKDG 160


>gi|126174741|ref|YP_001050890.1| hypothetical protein Sbal_2528 [Shewanella baltica OS155]
 gi|153001040|ref|YP_001366721.1| hypothetical protein Shew185_2521 [Shewanella baltica OS185]
 gi|217973000|ref|YP_002357751.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica OS223]
 gi|125997946|gb|ABN62021.1| conserved hypothetical protein [Shewanella baltica OS155]
 gi|151365658|gb|ABS08658.1| conserved hypothetical protein [Shewanella baltica OS185]
 gi|217498135|gb|ACK46328.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella baltica OS223]
          Length = 188

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 34/172 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           ++   ++S     +      ++ I K+E+ + + +        +LK+Y+I       G K
Sbjct: 32  VTIAALVSPVLHASGMGKVDLVVITKSESSMALLRDG-----KILKQYRIAMGDLPAGHK 86

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE- 146
           ++ GD++ P+G Y + +    P+S Y+ SI+I +PNE DK        R G  +MIHG+ 
Sbjct: 87  LKEGDQRTPQGRYTLDYK--KPDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQN 144

Query: 147 -------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                          + GC A+ N +M E++ +V +           I+ +P
Sbjct: 145 PKSPLPPEQAQQYNWTDGCIAITNAEMDEVWKVVDEGT--------PIEIWP 188


>gi|319957168|ref|YP_004168431.1| erfk/ybis/ycfs/ynhg family protein [Nitratifractor salsuginis DSM
           16511]
 gi|319419572|gb|ADV46682.1| ErfK/YbiS/YcfS/YnhG family protein [Nitratifractor salsuginis DSM
           16511]
          Length = 182

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 77/186 (41%), Gaps = 33/186 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           MT R  +LLFA    +     S      A   +SE +      K+ S      + I K+E
Sbjct: 1   MTLR-LLLLFAFGSLIFAAGPS------AFKAVSETVQSLSVSKKPSIPKAQKVLIIKSE 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L + +          +EY I       GPK    D++ PEG Y + +     +S Y+ 
Sbjct: 54  RKLYLLRNG-----KPYREYHIALGKHPVGPKRREHDQKTPEGNYTLDFK--KADSSYYR 106

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           +I++ +PN  DKA  +      G  +MIHG+                +AGC A++N  M 
Sbjct: 107 AIHVSYPNSTDKARAKRLGVNPGGAIMIHGQPNWFGWLSIIRQRFYWTAGCIAVSNGDMD 166

Query: 162 EIYAIV 167
           EI+  V
Sbjct: 167 EIWQAV 172


>gi|120598543|ref|YP_963117.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella sp. W3-18-1]
 gi|146293378|ref|YP_001183802.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella putrefaciens CN-32]
 gi|120558636|gb|ABM24563.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella sp. W3-18-1]
 gi|145565068|gb|ABP76003.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella putrefaciens CN-32]
 gi|319426681|gb|ADV54755.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella putrefaciens 200]
          Length = 171

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 71/152 (46%), Gaps = 34/152 (22%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++ I K+E+ + + +        +LK+Y+I       G K++ GD++ P+G Y + +   
Sbjct: 35  LVVITKSESNMALLRDG-----KVLKQYRIAMGDLPAGHKLKEGDQRTPQGRYILDYK-- 87

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
            P+S Y+ SI+I +PNE DK        + G  +MIHG+                + GC 
Sbjct: 88  KPDSAYYKSIHISYPNEEDKLRAKALGIKPGGMIMIHGQDPKSPLSPAQAQQFNWTNGCI 147

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           A+ N +M E++  V +           I+ +P
Sbjct: 148 ALTNAEMDELWKAVDEGT--------PIEIWP 171


>gi|222055904|ref|YP_002538266.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. FRC-32]
 gi|221565193|gb|ACM21165.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. FRC-32]
          Length = 174

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/183 (24%), Positives = 73/183 (39%), Gaps = 39/183 (21%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAE-HPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           LL A  + + G      ++ K E  PL   ++               + I K    L ++
Sbjct: 4   LLLAFVLIIIGSVAVIWMLGKPESKPLPAGVVADR------------VLIEKGPRRLTLF 51

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           ++        LK Y++       G K E GD + PEG Y I       +S+Y  +++I +
Sbjct: 52  RQG-----KRLKTYEVALGRNPQGKKTEEGDCRTPEGIYTIDRR--KQSSRYHRALHISY 104

Query: 127 PNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIV 167
           P+  D A  +      G D+MIHG                 + GC A+ N  ++EI+ +V
Sbjct: 105 PSSADVAQAKARSVSPGGDVMIHGLPNALGFVGKVHLIRDWTLGCVAVTNPDIEEIWRVV 164

Query: 168 RDS 170
            D 
Sbjct: 165 PDG 167


>gi|167623553|ref|YP_001673847.1| hypothetical protein Shal_1622 [Shewanella halifaxensis HAW-EB4]
 gi|167353575|gb|ABZ76188.1| conserved hypothetical protein [Shewanella halifaxensis HAW-EB4]
          Length = 169

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 68/159 (42%), Gaps = 34/159 (21%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            +     ++ + K+E  + + ++       + K+Y+I       G K+  GD++ PEG Y
Sbjct: 26  MANGKADLVIVTKSEASMTLLRQG-----KVFKKYRIAMGDNPVGHKLTEGDQRTPEGRY 80

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE-------------- 146
            + +     +S Y+ +I+I +PN+ D+          G  +MIHGE              
Sbjct: 81  LLDYK--KSDSAYYRAIHISYPNDEDRLRADALGISPGGQIMIHGENPNSSLSPEEAQMY 138

Query: 147 CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
             + GC A+ N +M E++  + +           I+ +P
Sbjct: 139 NWTDGCIAVTNAEMDELWRAIDEGT--------PIEIWP 169


>gi|212634603|ref|YP_002311128.1| ErfK/YbiS/YcfS/YnhG protein [Shewanella piezotolerans WP3]
 gi|212556087|gb|ACJ28541.1| ErfK/YbiS/YcfS/YnhG [Shewanella piezotolerans WP3]
          Length = 137

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 67/152 (44%), Gaps = 34/152 (22%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++ + K+E+ L + +        +LK Y+I       G K+  GD++ PEG Y + +   
Sbjct: 1   MVVVTKSESSLSLLREG-----KVLKSYRIAMGDNPVGHKLTEGDQRTPEGRYLLDYK-- 53

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
             +S Y+ SI+I +PN+ D+          G  +MIHGE                + GC 
Sbjct: 54  KSDSAYYRSIHISYPNDEDRLRANALGIEPGGQIMIHGENPNSSLSPIEAQQYNWTDGCI 113

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           A+ N +M E++  + +           I+ +P
Sbjct: 114 AVTNAEMDELWRAIDEGT--------PIEIWP 137


>gi|331019743|gb|EGH99799.1| hypothetical protein PLA106_27216 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 187

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLF-ALFIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF   FI L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 1   MRWLLALFYVSFIPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKKIDKVL--VLKSA 58

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y++       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 59  RQLQLISGGEA-----LKTYRVSLGKNPTGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 111

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 112 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 171

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 172 EIWDLVKDG 180


>gi|13476231|ref|NP_107801.1| hypothetical protein mlr7497 [Mesorhizobium loti MAFF303099]
 gi|14026991|dbj|BAB53587.1| mlr7497 [Mesorhizobium loti MAFF303099]
          Length = 163

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 63/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++R+ K E  LE+       +  +L+ Y I   S     K + GD++ PEG Y + W   
Sbjct: 27  LVRVHKAERRLELI-----GDGKVLRSYGIALGSDPVDHKHQEGDQRTPEGRYMLDWR-- 79

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCY 153
           NPNS    SI+I +PN  D A  +      G  +MIHG+                + GC 
Sbjct: 80  NPNSIAHRSIHISYPNADDLAAAKARNVDAGGMIMIHGQPNGFGWWGWLLQLVDWTDGCI 139

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ +  M EI+A+V D 
Sbjct: 140 AVTDSDMDEIWAMVADG 156


>gi|260460299|ref|ZP_05808551.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033944|gb|EEW35203.1| ErfK/YbiS/YcfS/YnhG family protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 163

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++R+ K E  LE+       +  +++ Y I       G K + GD++ PEG Y + W   
Sbjct: 27  LVRVHKAERRLELI-----GDGKVVRSYGIALGGAPVGHKHQEGDQRTPEGRYILDWR-- 79

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCY 153
           NPNS  + SI++ +PN  D A  +      G  +MIHG+                + GC 
Sbjct: 80  NPNSIAYKSIHVSYPNADDLAAAKRRNVDAGGMIMIHGQPNGFGWWGWLLQLVDWTDGCI 139

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ +  M EI+A V D 
Sbjct: 140 AVTDSDMDEIWAKVADG 156


>gi|83950747|ref|ZP_00959480.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
 gi|83838646|gb|EAP77942.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
          Length = 161

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 76/181 (41%), Gaps = 44/181 (24%)

Query: 7   ILLFAL--FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
           +L+ AL   + L+GC       +  E                     T + + K    + 
Sbjct: 1   MLMVALIGAVALSGCSSKFKTYNGPEV--------------------THVLVNKGARRMY 40

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +   N      +LK Y I       G K   GD + PEG Y I     NPNS + LSI +
Sbjct: 41  LLHHN-----QVLKAYDIDLGFAPEGHKQFQGDGKTPEGRYVIDRR--NPNSDFHLSIGL 93

Query: 125 GFPNEFDK----AHNRT-GADLMIHGEC----------ASAGCYAMNNKQMQEIYAIVRD 169
            +PN  D+    A  +T G D+ IHG             +AGC ++ ++++++IYA+V++
Sbjct: 94  DYPNMRDRAYALAQGKTPGGDIFIHGRPNTKKKGNGPDWTAGCISVKDREIEDIYAMVKN 153

Query: 170 S 170
            
Sbjct: 154 G 154


>gi|114562765|ref|YP_750278.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella frigidimarina NCIMB
           400]
 gi|114334058|gb|ABI71440.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella frigidimarina NCIMB
           400]
          Length = 167

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 79/202 (39%), Gaps = 54/202 (26%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R   +LF   IF      + S    A+  L                    + + K+E+ 
Sbjct: 1   MRALYILFIALIFSPSLAVASSSQTTAKVDL--------------------VVVNKSESR 40

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L + +        ++K Y I       G K++ GD++ P+G Y + +     +S ++ SI
Sbjct: 41  LSVMRDG-----RVVKSYLIAMGDVPSGHKLKEGDQRTPQGRYVLDYK--KSDSAFYKSI 93

Query: 123 NIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCYAMNNKQMQEI 163
           +I +PNE DK        R G  +MIHGE                + GC A+ NK+M E+
Sbjct: 94  HISYPNEEDKLRADALGIRAGGMIMIHGENPRSTLPPEEAQKYNWTNGCIAVTNKEMDEL 153

Query: 164 YAIVRDSLRGNMQSHIQIQAFP 185
           + ++             I+ +P
Sbjct: 154 WQMIDAGT--------PIEIWP 167


>gi|28868668|ref|NP_791287.1| hypothetical protein PSPTO_1461 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851907|gb|AAO54982.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 208

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 3   NRYNILLF-ALFIFLNGCHHSRSLIDK-AEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
            R+ + LF   FI L+    +++++ K +E  +  N +I+ +   +      +  + K+ 
Sbjct: 22  MRWLLALFYVSFIPLSQAAFTQTIVPKGSEQKIINNKVINTESIASKKIDKVL--VLKSA 79

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L++           LK Y++       G K++ GD++ PEGFY++ W    P++ Y L
Sbjct: 80  RQLQLISGGEA-----LKTYRVSLGKNPTGTKLQEGDQRTPEGFYWLDWR--KPSNNYNL 132

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G+ +MIHG                 + GC A+ N  M+
Sbjct: 133 SMHISYPNISDSARARREGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNGCIALKNNDMR 192

Query: 162 EIYAIVRDS 170
           EI+ +V+D 
Sbjct: 193 EIWDLVKDG 201


>gi|149204353|ref|ZP_01881320.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. TM1035]
 gi|149142238|gb|EDM30285.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. TM1035]
          Length = 167

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 66/131 (50%), Gaps = 21/131 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K E  + +   N       L+ YK+       G K   GD + PEG Y+I     N
Sbjct: 37  VIVNKGEREMFLLHHNRT-----LERYKVDLGFSPSGHKQFEGDGRTPEGEYHIDRR--N 89

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC---------ASAGCYAMNNKQ 159
           PNS + LS+ I +PNE D A+ +      G D+ IHGE           +AGC ++ N++
Sbjct: 90  PNSAFHLSLGISYPNEADIAYAKALGKSPGGDIFIHGEPNALAFLSPDWTAGCISVKNRE 149

Query: 160 MQEIYAIVRDS 170
           M+++YA+VRD 
Sbjct: 150 MEDVYAMVRDG 160


>gi|294651441|ref|ZP_06728755.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822687|gb|EFF81576.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 212

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 31/159 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           +    +   +        P   I +FK++ IL++   N      +++EY +       G 
Sbjct: 51  VMPQSLSDEEIIYIRDNTPITKIEVFKHQRILQLKHHN-----EIIREYPMRLGFNPLGH 105

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE 146
           K   GD + PEG Y I W   NPNS Y+ S++I +PNE D A+ +      G D+MIHG 
Sbjct: 106 KQFEGDGKTPEGTYSIDWR--NPNSAYYKSLHISYPNEQDAAYAKQQGRSAGGDIMIHGS 163

Query: 147 ------------------CASAGCYAMNNKQMQEIYAIV 167
                               + GC A+ N  M EI+ +V
Sbjct: 164 VPKEYLNLPTSMTYFPQGDWTLGCIAVRNIDMDEIWQLV 202


>gi|298506428|gb|ADI85151.1| lipoprotein, putative [Geobacter sulfurreducens KN400]
          Length = 174

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 68/164 (41%), Gaps = 38/164 (23%)

Query: 26  IDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAW 85
             + E+PL  N                 + I K++  L +  +N       LK Y++   
Sbjct: 23  ARRLENPLPANATADK------------VLIEKSKRQLTLLNKNT-----PLKTYEVSLG 65

Query: 86  SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGAD 140
               G K E GD + PEG Y I    LN  SKY  ++++ +P+  D A  +      G D
Sbjct: 66  KEPVGKKTEEGDGRTPEGIYSIDRRKLN--SKYHRALHVSYPSAEDTAQAKARGVSPGGD 123

Query: 141 LMIHGEC--------------ASAGCYAMNNKQMQEIYAIVRDS 170
           +MIHG                 + GC A+ N +++EI+ +V D 
Sbjct: 124 IMIHGLPNGIGFIGKLHTKRDWTLGCIAVTNPEIEEIWRVVPDG 167


>gi|77457235|ref|YP_346740.1| ErfK/YbiS/YcfS/YnhG [Pseudomonas fluorescens Pf0-1]
 gi|77381238|gb|ABA72751.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 171

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 77/188 (40%), Gaps = 44/188 (23%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + LF L           + +  +  PL E ++                 + K+ + 
Sbjct: 1   MRWLLALFCLSFVTVSQASFVTTVTPSNTPLIEKVL-----------------VLKSAHQ 43

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
           L++           LK Y+I    G   GPK+  GD++ PEGFY+I W   +   K+ LS
Sbjct: 44  LQLIADG-----KPLKSYRISLGKGAKKGPKLIEGDKRTPEGFYWIDWRKTSE--KFNLS 96

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G  +MIHG                 + GC AM N  M+E
Sbjct: 97  MHISYPNISDSARARREGVEPGGMIMIHGTPDSEDNPEQLFHTLDWTDGCIAMRNVDMRE 156

Query: 163 IYAIVRDS 170
           ++ +V D 
Sbjct: 157 VWNLVPDG 164


>gi|94970797|ref|YP_592845.1| ErfK/YbiS/YcfS/YnhG [Candidatus Koribacter versatilis Ellin345]
 gi|94552847|gb|ABF42771.1| ErfK/YbiS/YcfS/YnhG [Candidatus Koribacter versatilis Ellin345]
          Length = 174

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K+ + + +++  +     L+ +YK+       GPK   GD + PEG Y+I     N
Sbjct: 39  IVIEKSAHRMALYRSGL-----LVHQYKVSLGGQPVGPKTRQGDHRTPEGQYFIEGR--N 91

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYA 154
            +S Y+ S+ I +PN  D    R      G D+MIHG                 + GC A
Sbjct: 92  EHSHYYKSLRISYPNATDLQRAREQKVSPGGDIMIHGLPNGERFIGKLHLLHDWTEGCIA 151

Query: 155 MNNKQMQEIYAIVR 168
           + +++M EI+A+VR
Sbjct: 152 VTDEEMDEIWALVR 165


>gi|85707820|ref|ZP_01038886.1| ErfK/YbiS/YcfS/YnhG family protein [Erythrobacter sp. NAP1]
 gi|85689354|gb|EAQ29357.1| ErfK/YbiS/YcfS/YnhG family protein [Erythrobacter sp. NAP1]
          Length = 193

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 25/171 (14%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT--VIRIFKNENILEIWKRNVDAEYV 75
           G     +        +          +      P    + I K+E +L  ++        
Sbjct: 23  GTAQQAAATSSFPTQIVPAATRGNASRSIPSRPPVADYLLIDKSERLLVAYQNG-----R 77

Query: 76  LLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA- 133
            +K Y+ +       G K   GDE+ PEG Y I     NP S++ LS+ I +PN  D+A 
Sbjct: 78  PIKAYRGLQFGDTPMGHKRFEGDERTPEGLYTIDTR--NPQSRFHLSLRISYPNRQDRAF 135

Query: 134 ---HNR-TGADLMIHGEC----------ASAGCYAMNNKQMQEIYAIVRDS 170
              + R  G D+ IHG+            + GC A++N +++E++ +V D 
Sbjct: 136 AAQYGRSPGGDIFIHGQPTGRPGRMRGDWTDGCIALSNTEIEELWQLVPDG 186


>gi|294675749|ref|YP_003576364.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter capsulatus SB 1003]
 gi|294474569|gb|ADE83957.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter capsulatus SB 1003]
          Length = 167

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 83/199 (41%), Gaps = 46/199 (23%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  +L  +    L  C    +       P                     I++FK +
Sbjct: 1   MHRRTLLLGLSSLTLLAACGGDSAKFRNYSGPRVTQ-----------------IQVFKRK 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + ++  +      ++++YKI       G K   GD + PEG Y+I  +  NPNS Y L
Sbjct: 44  RKMFLFVGDD-----VVRKYKIALGGNPVGKKRFEGDGKTPEGLYHI--SMHNPNSAYHL 96

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGE---------CASAGCYAMNNKQMQEIYAI 166
           S+ + +PNE D A+      + G D+MIHG+           +AGC A+ + +++EI+A+
Sbjct: 97  SLRVSYPNEADTAYAEAHGRKPGGDIMIHGQGRKYRGTRGDWTAGCIAVKDDEIEEIFAM 156

Query: 167 VRDSLRGNMQSHIQIQAFP 185
           V +           I  FP
Sbjct: 157 VPNGT--------PIFIFP 167


>gi|288941780|ref|YP_003444020.1| ErfK/YbiS/YcfS/YnhG family protein [Allochromatium vinosum DSM 180]
 gi|288897152|gb|ADC62988.1| ErfK/YbiS/YcfS/YnhG family protein [Allochromatium vinosum DSM 180]
          Length = 210

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 75/191 (39%), Gaps = 55/191 (28%)

Query: 17  NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVL 76
           NGC  +     +   P+                    + + K++  LE+          +
Sbjct: 53  NGCTTAPPPTTQFNGPVDT------------------VVVKKSQRRLELLSGG-----KV 89

Query: 77  LKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR 136
           +++Y++       G K   GD++ PEG Y + W   NP S ++ +I+I +P   D+A +R
Sbjct: 90  VRQYRVALGGAPVGHKYREGDQRTPEGRYTLNWR--NPKSNFYKAIHISYPTAKDRATSR 147

Query: 137 ------TGADLMIHGEC----------------ASAGCYAMNNKQMQEIYAIVRDSLRGN 174
                  G  +MIHG                   + GC A+ N +M EI+++V+D     
Sbjct: 148 QLGYSNPGGMIMIHGLPNYIQSASLRQQYANRDWTQGCIAVQNHEMDEIWSLVKDGT--- 204

Query: 175 MQSHIQIQAFP 185
                 IQ  P
Sbjct: 205 -----PIQIMP 210


>gi|157374959|ref|YP_001473559.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella sediminis HAW-EB3]
 gi|157317333|gb|ABV36431.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella sediminis HAW-EB3]
          Length = 179

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 78/191 (40%), Gaps = 37/191 (19%)

Query: 14  IFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
            FL  C    SL   A   ++     S     TS     ++ + K+++ + + +      
Sbjct: 7   FFLLACTIGFSLQSVA---VTSLQSASYSSSNTSIGKIDLVVVDKSQSSMALMRNGQT-- 61

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA 133
              L++Y+I       G K+  GD++ PEG Y + +     +S Y+ +I+I +PNE D  
Sbjct: 62  ---LRKYRIAMGDRPVGHKVTEGDQRTPEGRYLLDYK--KSDSAYYRAIHISYPNEEDSL 116

Query: 134 HNR-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVRDSLRGN 174
             +      G  +MIHG+                + GC A+ N QM E++  + +     
Sbjct: 117 RAKALGLDPGGQIMIHGQNPNSSLSPEEAQRFNWTDGCIAITNAQMDELWRAIDEGT--- 173

Query: 175 MQSHIQIQAFP 185
                 I+ +P
Sbjct: 174 -----PIEIWP 179


>gi|327479744|gb|AEA83054.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 167

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 72/187 (38%), Gaps = 46/187 (24%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + L  L        H+ +       P+ +                  + + K+E  
Sbjct: 1   MRWLLALLCLTF--TAFSHANATPSLGGSPIDK------------------VLVIKSERK 40

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L +           LK Y+I       G K   GD + PEGFY+I W     + KY LS+
Sbjct: 41  LHLVSAGQT-----LKSYRISLGKQPNGAKQREGDMRTPEGFYWIDWR--KTSDKYNLSM 93

Query: 123 NIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A  +      G+ +M+HG                 + GC A+ N  M+EI
Sbjct: 94  HISYPNARDLARAQQEGVAPGSMIMLHGTPVDEEYPEWFFHTLDWTEGCIALTNSDMREI 153

Query: 164 YAIVRDS 170
           + +V+D 
Sbjct: 154 WGLVKDG 160


>gi|226946005|ref|YP_002801078.1| ErfK/YbiS/YcfS/YnhG-like protein [Azotobacter vinelandii DJ]
 gi|226720932|gb|ACO80103.1| ErfK/YbiS/YcfS/YnhG-related protein [Azotobacter vinelandii DJ]
          Length = 168

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 43/183 (23%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
            LL +L + + G   +  L    E  + +                  I + K+E  L + 
Sbjct: 3   WLLASLCLSVVGLSQASVLSPGEEQRIVDK-----------------ILVVKSERKLMLL 45

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
            R        LK YK+       GPK   GD++ PEG Y+I W     + KY LS++I +
Sbjct: 46  SRG-----QPLKSYKVSLGKRPTGPKRREGDQRTPEGLYWIDWR--KASDKYNLSMHISY 98

Query: 127 PNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIV 167
           PN  D+A  R      G  +M+HG                 + GC AM N  ++E++++V
Sbjct: 99  PNIRDQAQARAEGVPPGGMIMLHGTPLDENYPEWYFHGLDWTEGCIAMRNDDIREVWSLV 158

Query: 168 RDS 170
           +D 
Sbjct: 159 KDG 161


>gi|78223705|ref|YP_385452.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
 gi|78194960|gb|ABB32727.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
          Length = 175

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + ++K++ +LE+      +   L++ Y++       GPK+  GD + PEG Y +   +L 
Sbjct: 40  VVVYKSKRLLEL-----RSGQNLIRSYRVALGRNPVGPKVRAGDFRTPEGIYRLDRRSL- 93

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT-----GADLMIHGEC--------------ASAGCYA 154
             S++F SI+I +PN  D A  R      G D+MIHG                 + GC A
Sbjct: 94  -QSRFFRSIHISYPNTEDIATARKQGVSAGGDIMIHGLPTGFEDLGPSHASFDWTKGCIA 152

Query: 155 MNNKQMQEIYAIVRDS 170
           + N +M EI+ +VR+ 
Sbjct: 153 VTNAEMTEIWHLVRNG 168


>gi|24373740|ref|NP_717783.1| hypothetical protein SO_2183 [Shewanella oneidensis MR-1]
 gi|24348116|gb|AAN55227.1|AE015660_7 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 171

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 72/170 (42%), Gaps = 34/170 (20%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
             LI       +      ++ I K+E+ + + +        +LK+Y+I       G K+ 
Sbjct: 17  AALISPQVLASSGIGKVDLVVITKSESNMALLRDG-----KVLKQYRIAMGDLPTGHKLT 71

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--- 146
            GD++ P+G Y + +     +S Y+ SI+I +PNE DK        R G  +MIHG+   
Sbjct: 72  EGDQRTPQGRYILDYK--KSDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQNPR 129

Query: 147 -----------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                        + GC A+ N +M E++  V +           I+ +P
Sbjct: 130 SPLPPEQAQQYNWTDGCIAITNAEMDEVWKAVDEGT--------PIEIWP 171


>gi|113970547|ref|YP_734340.1| hypothetical protein Shewmr4_2210 [Shewanella sp. MR-4]
 gi|113885231|gb|ABI39283.1| conserved hypothetical protein [Shewanella sp. MR-4]
          Length = 171

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 72/171 (42%), Gaps = 34/171 (19%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
              LI       +      ++ I K+E+ + + +        +LK+Y+I       G K+
Sbjct: 16  VAALISPQVLASSGIGKVDLVVITKSESNMALLRDG-----KILKQYRIAMGDLPTGHKL 70

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE-- 146
             GD++ P+G Y + +     +S Y+ SI+I +PNE DK        R G  +MIHG+  
Sbjct: 71  TEGDQRTPQGRYILDYK--KSDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQNP 128

Query: 147 ------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                         + GC A+ N +M E++  V +           I+ +P
Sbjct: 129 RSPLSPEQAQQYNWTDGCIAITNAEMDEVWKAVDEGT--------PIEIWP 171


>gi|114047782|ref|YP_738332.1| hypothetical protein Shewmr7_2287 [Shewanella sp. MR-7]
 gi|113889224|gb|ABI43275.1| conserved hypothetical protein [Shewanella sp. MR-7]
          Length = 171

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 72/170 (42%), Gaps = 34/170 (20%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
             LI       +      ++ I K+E+ + + +        +LK+Y+I       G K+ 
Sbjct: 17  AALISPQVLASSGIGKVDLVVITKSESNMALLRDG-----KILKQYRIAMGDLPTGHKLT 71

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--- 146
            GD++ P+G Y + +     +S Y+ SI+I +PNE DK        R G  +MIHG+   
Sbjct: 72  EGDQRTPQGRYILDYK--KSDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQNPR 129

Query: 147 -----------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                        + GC A+ N +M E++  V +           I+ +P
Sbjct: 130 SPLSPEQAQQYNWTDGCIAITNAEMDEVWKAVDEGT--------PIEIWP 171


>gi|253702667|ref|YP_003023856.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. M21]
 gi|251777517|gb|ACT20098.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacter sp. M21]
          Length = 331

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 62/152 (40%), Gaps = 26/152 (17%)

Query: 36  NLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIET 95
                +            I I K    L +  +       ++K YKI       GPK   
Sbjct: 178 AQEEEVSPPAVPTGPADKILIEKKARRLTLLSKG-----EVIKSYKISLGENPNGPKERQ 232

Query: 96  GDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE---- 146
           GD + PEG Y I     N +S+Y LS++I +PNE DK   +      G ++MIHG     
Sbjct: 233 GDNKTPEGIYRIDSR--NNDSQYHLSLHISYPNEQDKRRAKQLGVSPGGNVMIHGMRNGF 290

Query: 147 ----------CASAGCYAMNNKQMQEIYAIVR 168
                       + GC A+ ++++QEI  +V 
Sbjct: 291 SWFGEHHTSIDWTKGCIAVTDEEIQEIAELVP 322


>gi|119385305|ref|YP_916361.1| hypothetical protein Pden_2578 [Paracoccus denitrificans PD1222]
 gi|119375072|gb|ABL70665.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 171

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 74/162 (45%), Gaps = 31/162 (19%)

Query: 40  SMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDE 98
           S+Q  +T    P   I + K +  + +          ++K YK+   +  FGPK   GD 
Sbjct: 25  SLQPSKTYQGPPITQIVVKKADRKMYLVSGK-----EVVKSYKVNLGNQPFGPKQFEGDG 79

Query: 99  QAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHG-------- 145
           + PEG Y+I     NP S+Y LS+ I +P+  D A       R G D+ IHG        
Sbjct: 80  RTPEGMYFIDR--FNPRSRYHLSVGISYPSAQDVAKAAAMGLRPGGDIFIHGLGPEGRAL 137

Query: 146 --ECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                +AGC A+ +++++EI+ ++R          + I  +P
Sbjct: 138 NRADWTAGCIAVTDEEIEEIFTMLR--------PGVPIFIYP 171


>gi|330504649|ref|YP_004381518.1| hypothetical protein MDS_3735 [Pseudomonas mendocina NK-01]
 gi|328918935|gb|AEB59766.1| hypothetical protein MDS_3735 [Pseudomonas mendocina NK-01]
          Length = 167

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K+E  L + +R        +K Y+I       G K   GD + PEGFY+I W    
Sbjct: 32  VLVLKSERKLHLQQRGET-----IKSYRISLGKQPDGAKQREGDLRTPEGFYWIDWR--K 84

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYA 154
           P+ KY LS++I +PN  D A  +      G+ +MIHG                 + GC A
Sbjct: 85  PSDKYQLSLHISYPNARDLAKAKEAGVPPGSMIMIHGTPLDEEYPEWFFHTLDWTEGCIA 144

Query: 155 MNNKQMQEIYAIVRDS 170
           M N  M+E++++V+D 
Sbjct: 145 MKNDDMREVWSLVKDG 160


>gi|226954427|ref|ZP_03824891.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter sp. ATCC 27244]
 gi|226834776|gb|EEH67159.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter sp. ATCC 27244]
          Length = 198

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 65/137 (47%), Gaps = 30/137 (21%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +FK++ IL++   N      +++EY +       G K   GD + PEG Y I W   N
Sbjct: 59  IEVFKHQRILQLKHHN-----EIIREYPMRLGFNPLGHKQFEGDGKTPEGTYSIDWR--N 111

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------------CASA 150
           PNS Y+ S++I +PNE D A+ +      G D+MIHG                     + 
Sbjct: 112 PNSAYYKSLHISYPNEQDAAYAKQQGRSAGGDIMIHGSVPKEYLNLPTSMTYFPQGDWTL 171

Query: 151 GCYAMNNKQMQEIYAIV 167
           GC A+ N  M EI+ +V
Sbjct: 172 GCIAVRNIDMDEIWQLV 188


>gi|117920863|ref|YP_870055.1| hypothetical protein Shewana3_2420 [Shewanella sp. ANA-3]
 gi|117613195|gb|ABK48649.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 186

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 72/170 (42%), Gaps = 34/170 (20%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
             LI       +      ++ I K+E+ + + +        +LK+Y+I       G K+ 
Sbjct: 32  AALISPQVLASSGIGKVDLVVITKSESNMALLRDG-----KILKQYRIAMGDLPTGHKLT 86

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--- 146
            GD++ P+G Y + +     +S Y+ SI+I +PNE DK        R G  +MIHG+   
Sbjct: 87  EGDQRTPQGRYILDYK--KSDSAYYKSIHISYPNEEDKLRAKALGIRPGGMIMIHGQNPR 144

Query: 147 -----------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                        + GC A+ N +M E++  V +           I+ +P
Sbjct: 145 SPLTPEQAQQYNWTDGCIAITNAEMDEVWKAVDEGT--------PIEIWP 186


>gi|42523534|ref|NP_968914.1| hypothetical protein Bd2061 [Bdellovibrio bacteriovorus HD100]
 gi|39575740|emb|CAE79907.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 204

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 78/199 (39%), Gaps = 37/199 (18%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHP---------LSENLIISMQKKRTSPFHP 51
           M      L+       N        +DK+            L +    S+ + +      
Sbjct: 1   MKKTLLPLIALSLFATNSFAAGSKALDKSFRYCQDISQVDKLLDRSRESVDRLQAEELKV 60

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I + K+   L +          LLK Y +       G K   GD + PEG Y I +  
Sbjct: 61  ERIVVSKDRKELYLISGET-----LLKVYPVAFGRNPVGHKQFEGDNKTPEGLYSIDYK- 114

Query: 112 LNPNSKYFLSINIGFPNEFD----KAHNRT-GADLMIHGEC----------------ASA 150
            NP S+Y  ++++ +PN+ D    KA  ++ G D+MIHG                   + 
Sbjct: 115 -NPQSQYTKALHVSYPNKADVEFAKAQGKSAGGDIMIHGLPSEERKGQAVGLIHPMNWTQ 173

Query: 151 GCYAMNNKQMQEIYAIVRD 169
           GC A+ N +++EIY++V++
Sbjct: 174 GCVAVTNPEIEEIYSLVKE 192


>gi|311696719|gb|ADP99592.1| ErfK/YbiS/YcfS/YnhG family protein [marine bacterium HP15]
          Length = 187

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 63/171 (36%), Gaps = 30/171 (17%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPT----VIRIFKNENILEIWKRNVDAEYVLLK 78
            +        L       M                + + K E  L +          +++
Sbjct: 17  AAAPTAVATELLAKADTRMPVATMYEPAEIQNVSRVVVRKGERRLYLMDGED-----VVR 71

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN--- 135
            Y+I       G K+  GDE+ PEG Y + W   N  S ++ SI+I +P+E D+      
Sbjct: 72  SYRISLGDNPEGHKLYEGDERTPEGDYTLDWR--NAESDFYKSIHISYPSERDRELASAW 129

Query: 136 --RTGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIVRDS 170
               G  +MIHG                 + GC A+ N++M EI+ +V + 
Sbjct: 130 GLDPGGSIMIHGLPNNVGDMAFAYTGLDWTDGCIAVTNEEMDEIWQLVSNG 180


>gi|327192576|gb|EGE59525.1| hypothetical protein RHECNPAF_213007 [Rhizobium etli CNPAF512]
          Length = 179

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 75/189 (39%), Gaps = 38/189 (20%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +  +L  A             +   +  P++     +            +IR++K+E
Sbjct: 1   MRTKIIVLAVATGSLFVYTKVMARIGSGSPPPVAPTEQRA-----------DLIRVYKSE 49

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + + +       +  Y+I   S    GPK   GDE+ PEG Y I W   NP S   
Sbjct: 50  RRMVLLRGD-----APIATYQISLGSAADAGPKQREGDEKTPEGRYEIDWR--NPKSMAH 102

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQM 160
           LS++I +PN  ++          G  +MIHG                 + GC A+ N +M
Sbjct: 103 LSLHISYPNPKERRAAEANGFPPGGSIMIHGLPNGWGLLGQAHRLWDWTDGCIAVTNTEM 162

Query: 161 QEIYAIVRD 169
           +EI+A V D
Sbjct: 163 REIWARVPD 171


>gi|157961382|ref|YP_001501416.1| hypothetical protein Spea_1556 [Shewanella pealeana ATCC 700345]
 gi|157846382|gb|ABV86881.1| conserved hypothetical protein [Shewanella pealeana ATCC 700345]
          Length = 171

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 34/159 (21%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            +     ++ + K+E  + I ++       +LK+Y+I       G K+  GD++ PEG Y
Sbjct: 28  MASGKADLVVVTKSEASMAILRQG-----KVLKKYRIAMGDNPVGHKLTEGDQRTPEGRY 82

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE-------------- 146
            + +     +S Y+ +I+I +PN+ DK          G  +MIHGE              
Sbjct: 83  ILDYK--KSDSAYYRAIHISYPNDEDKLRADALGISPGGQIMIHGENPNSSLTPEEAQMY 140

Query: 147 CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
             + GC A+ N +M E++  +             I+ +P
Sbjct: 141 NWTDGCIAITNAEMDELWRAIE--------PGTPIEIWP 171


>gi|15598951|ref|NP_252445.1| hypothetical protein PA3756 [Pseudomonas aeruginosa PAO1]
 gi|107103271|ref|ZP_01367189.1| hypothetical protein PaerPA_01004340 [Pseudomonas aeruginosa PACS2]
 gi|116051754|ref|YP_789407.1| hypothetical protein PA14_15840 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218889966|ref|YP_002438830.1| hypothetical protein PLES_12241 [Pseudomonas aeruginosa LESB58]
 gi|254236665|ref|ZP_04929988.1| hypothetical protein PACG_02669 [Pseudomonas aeruginosa C3719]
 gi|254242447|ref|ZP_04935769.1| hypothetical protein PA2G_03196 [Pseudomonas aeruginosa 2192]
 gi|296387735|ref|ZP_06877210.1| hypothetical protein PaerPAb_06264 [Pseudomonas aeruginosa PAb1]
 gi|313109166|ref|ZP_07795136.1| hypothetical protein PA39016_001690005 [Pseudomonas aeruginosa
           39016]
 gi|9949925|gb|AAG07143.1|AE004794_8 hypothetical protein PA3756 [Pseudomonas aeruginosa PAO1]
 gi|115586975|gb|ABJ12990.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168596|gb|EAZ54107.1| hypothetical protein PACG_02669 [Pseudomonas aeruginosa C3719]
 gi|126195825|gb|EAZ59888.1| hypothetical protein PA2G_03196 [Pseudomonas aeruginosa 2192]
 gi|218770189|emb|CAW25951.1| hypothetical protein PLES_12241 [Pseudomonas aeruginosa LESB58]
 gi|310881638|gb|EFQ40232.1| hypothetical protein PA39016_001690005 [Pseudomonas aeruginosa
           39016]
          Length = 166

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 49/188 (26%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + L  L    L   + + SL  K +                       + + K+E 
Sbjct: 1   MRWLLALLCLTFASLTQANAAPSLEGKVDK----------------------VLVLKSER 38

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L +  +       +LK Y++       GPK+  GD + PEGFY+I W   + N  Y LS
Sbjct: 39  KLLLLNKGN-----VLKSYRVSLGKRPTGPKLAEGDNRTPEGFYWIDWRKTSNN--YNLS 91

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G  +MIHG                 + GC AMNN  M+E
Sbjct: 92  MHISYPNARDVAKAREKGLPAGGMIMIHGTPLDDEYPEWYFSTLDWTNGCIAMNNTDMRE 151

Query: 163 IYAIVRDS 170
           ++++V+D 
Sbjct: 152 VWSVVKDG 159


>gi|49081476|gb|AAT50138.1| PA3756 [synthetic construct]
          Length = 167

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 49/188 (26%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + L  L    L   + + SL  K +                       + + K+E 
Sbjct: 1   MRWLLALLCLTFASLTQANAAPSLEGKVDK----------------------VLVLKSER 38

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L +  +       +LK Y++       GPK+  GD + PEGFY+I W   + N  Y LS
Sbjct: 39  KLLLLNKGN-----VLKSYRVSLGKRPTGPKLAEGDNRTPEGFYWIDWRKTSNN--YNLS 91

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G  +MIHG                 + GC AMNN  M+E
Sbjct: 92  MHISYPNARDVAKAREKGLPAGGMIMIHGTPLDDEYPEWYFSTLDWTNGCIAMNNTDMRE 151

Query: 163 IYAIVRDS 170
           ++++V+D 
Sbjct: 152 VWSVVKDG 159


>gi|260576138|ref|ZP_05844131.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter sp. SW2]
 gi|259021618|gb|EEW24921.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacter sp. SW2]
          Length = 165

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 21/129 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I++ K    + +   +      +L++Y I       G K   GD + PEG Y I +   N
Sbjct: 35  IQVHKAARKMYLLHND-----KVLEQYDIALGFAPIGHKQFEGDGKTPEGAYQINFR--N 87

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG---------ECASAGCYAMNNKQ 159
           P+S Y LS+ I +P+E D+A        TG D+ IHG            +AGC A+ +++
Sbjct: 88  PDSDYHLSLKISYPDENDRAFADEAGKPTGGDIFIHGHSNWKGRNKGDWTAGCIAVTDRE 147

Query: 160 MQEIYAIVR 168
           M+ IY++VR
Sbjct: 148 MEVIYSMVR 156


>gi|78224670|ref|YP_386417.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
 gi|78195925|gb|ABB33692.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
          Length = 341

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K    + +  +       +LK Y+I       GPK   GD + PEG Y I     N
Sbjct: 206 ILIEKQARRMMLISKG-----AVLKTYRIALGGDPIGPKERQGDNKTPEGAYTIDAR--N 258

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIH--------------GECASAGCYA 154
            +S+Y  +++I +PNE D+   R      G ++MIH              G   + GC A
Sbjct: 259 RDSRYHRALHISYPNERDRKRARELGVSPGGNIMIHGIKNGFSWVGDAHAGVDWTKGCIA 318

Query: 155 MNNKQMQEIYAIVRDS 170
           + +++++EI  +  + 
Sbjct: 319 VTDEEIEEIDTLAPNG 334


>gi|146281566|ref|YP_001171719.1| hypothetical protein PST_1182 [Pseudomonas stutzeri A1501]
 gi|145569771|gb|ABP78877.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
          Length = 167

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 71/187 (37%), Gaps = 46/187 (24%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ + L  L        H+ +       P+ +                  + + K+E  
Sbjct: 1   MRWLLALLCLTF--TAFSHANATPSLGGSPIDK------------------VLVIKSERK 40

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L +           LK Y+I       G K   GD + PEG Y+I W     + KY LS+
Sbjct: 41  LHLVSAGQT-----LKSYRISLGKQPNGAKQREGDMRTPEGLYWIDWR--KTSDKYNLSM 93

Query: 123 NIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEI 163
           +I +PN  D A  +      G+ +M+HG                 + GC A+ N  M+EI
Sbjct: 94  HISYPNARDLARAQQEGVAPGSMIMLHGTPVDEEYPEWFFHTLDWTEGCIALTNSDMREI 153

Query: 164 YAIVRDS 170
           + +V+D 
Sbjct: 154 WGLVKDG 160


>gi|255066178|ref|ZP_05318033.1| ErfK/YbiS/YcfS/YnhG [Neisseria sicca ATCC 29256]
 gi|255049723|gb|EET45187.1| ErfK/YbiS/YcfS/YnhG [Neisseria sicca ATCC 29256]
          Length = 194

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 38/170 (22%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
                 S+ + +E PL EN +I              + + K++  +  + +       LL
Sbjct: 35  ATSGESSVAEPSETPLPENAVIDR------------LVVHKSKRTMSAYSQG-----KLL 77

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK----A 133
           K Y I       G K   GD + PEG Y I     NPNS Y  ++ + +PNE DK    A
Sbjct: 78  KTYPIALGKQPVGHKHFEGDGKTPEGKYRINDR--NPNSAYHKNLGVSYPNEADKAYAAA 135

Query: 134 HNR-TGADLMIHG--------------ECASAGCYAMNNKQMQEIYAIVR 168
             +  G  + IHG                 + GC A+ ++++ E+Y  V+
Sbjct: 136 QGKSPGGLIKIHGIKNGWGSIGKRHLQRDWTDGCIAVTDEEIDELYRSVK 185


>gi|114769815|ref|ZP_01447425.1| hypothetical protein OM2255_09611 [alpha proteobacterium HTCC2255]
 gi|114549520|gb|EAU52402.1| hypothetical protein OM2255_09611 [alpha proteobacterium HTCC2255]
          Length = 169

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 36/183 (19%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   +L  +    +GC +S ++     +     +                I + K++  
Sbjct: 1   MKLFNILLFMAFIFSGCFNSSTVYKSIPNYNGPKITK--------------IVVNKSQRK 46

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L ++  +      +++++K+         K + GD + PEG Y+I     N NSKYFLS+
Sbjct: 47  LFLFHND-----KIIRKFKVGLGFNPKSHKSKQGDGRTPEGLYFIDRK--NYNSKYFLSL 99

Query: 123 NIGFPNEFDKAHNR-----TGADLMIHGEC----------ASAGCYAMNNKQMQEIYAIV 167
            I +PN  DK + +      G D+ IHG             +AGC ++++K M+ IY++V
Sbjct: 100 GISYPNTEDKKYAKSLDIDPGGDIFIHGGPRYKGEFGKRDWTAGCISVSDKNMKVIYSMV 159

Query: 168 RDS 170
           +  
Sbjct: 160 KAG 162


>gi|170727112|ref|YP_001761138.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella woodyi ATCC 51908]
 gi|169812459|gb|ACA87043.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella woodyi ATCC 51908]
          Length = 179

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 72/152 (47%), Gaps = 34/152 (22%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++ + K+E  + + +        ++++Y+I       G K++ GD++ PEG Y + +   
Sbjct: 43  LVVVTKSEAKMVLMRNG-----KVMRQYRIAMGDRPKGHKLKEGDQRTPEGRYILDYK-- 95

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S Y+ +I+I +PN+ DK   +      G  +MIHG+                + GC 
Sbjct: 96  KSDSAYYRAIHISYPNDEDKLRAKALGISPGGQIMIHGQNPNSSLTPEEAQKFNWTDGCI 155

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           A+ N+QM E++        G+++    I+ +P
Sbjct: 156 AITNRQMDELW--------GSIEPGTPIEIWP 179


>gi|257454799|ref|ZP_05620050.1| ErfK/YbiS/YcfS/YnhG family protein [Enhydrobacter aerosaccus SK60]
 gi|257447732|gb|EEV22724.1| ErfK/YbiS/YcfS/YnhG family protein [Enhydrobacter aerosaccus SK60]
          Length = 185

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 78/183 (42%), Gaps = 32/183 (17%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
             ++LFA   FL G      ++           +  + + +        + + K+  I++
Sbjct: 7   ILVILFAWLYFL-GLPKPEKIVKANNSDKP--TMNYLAQNKIYADK---VYVKKSARIMQ 60

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +   N      +++EY I       G K + GDE+ PEG+Y + W   N  S  + S+++
Sbjct: 61  LLHNNS-----VIREYNIALGDNPKGHKQQEGDERTPEGWYTLDWA--NEQSAAYRSLHV 113

Query: 125 GFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYA 165
            +PN  D+A+ +      G  +MIHG+                + GC A+ N +M EI  
Sbjct: 114 SYPNSKDRANAKMLGVSPGGAIMIHGQMNGTELLTAFNQKRDWTNGCIAVTNSEMDEIMT 173

Query: 166 IVR 168
           +V+
Sbjct: 174 LVK 176


>gi|127512419|ref|YP_001093616.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella loihica PV-4]
 gi|126637714|gb|ABO23357.1| ErfK/YbiS/YcfS/YnhG family protein [Shewanella loihica PV-4]
          Length = 194

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 72/171 (42%), Gaps = 34/171 (19%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           S  L       ++      ++ + K+E  + + ++       +L+ YKI       G K+
Sbjct: 39  SSGLSSPHSTSKSQIGKVDLVVVNKSEASMLLMRQG-----KVLRRYKIALGDRPVGHKL 93

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE-- 146
           + GD++ PEG Y + +     +S Y+ +I+I +PN+ DK          G  +MIHG+  
Sbjct: 94  QEGDQRTPEGRYILDYK--KADSAYYRAIHISYPNDEDKLRAAALGINPGGQIMIHGQNP 151

Query: 147 ------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                         + GC A+ N+++ E++  V             I+ +P
Sbjct: 152 NSSLTPDEAQRLNWTDGCIAIKNEEIDELWRAVDTGT--------PIEIWP 194


>gi|308270259|emb|CBX26871.1| hypothetical protein N47_A09000 [uncultured Desulfobacterium sp.]
          Length = 337

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K E  L +  +N      +LK YKI       GPK   GD + PEG Y+I     N
Sbjct: 202 ILIEKKERRLTLMSKN-----KVLKTYKIALGENPDGPKERQGDYKTPEGIYFIDSR--N 254

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
            + +Y LS++I +PNE DK   +      G D++IHG                 + GC A
Sbjct: 255 NSRRYHLSLHISYPNENDKKRAKALGISPGGDIVIHGIKNGFSWVGDLHTKFNWTKGCIA 314

Query: 155 MNNKQMQEIYAIVRDS 170
           + + +++EI  +V + 
Sbjct: 315 VTDDEIEEIDKLVPNG 330


>gi|257459222|ref|ZP_05624341.1| protein erfk [Campylobacter gracilis RM3268]
 gi|257443607|gb|EEV18731.1| protein erfk [Campylobacter gracilis RM3268]
          Length = 186

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 74/188 (39%), Gaps = 31/188 (16%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +  + L  +   L     +       E  ++  + +              IR++K++
Sbjct: 1   MKFKILLPLIIIAAGLAWALDNYLSYKNIET-INSEIPLKQALDGEQISK---IRVYKSK 56

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            ILEI          + K YKI       G K   GD + PEG Y I     NPNS Y L
Sbjct: 57  RILEILTSKG-----VAKSYKIALGREPEGHKEVQGDGKTPEGNYTINGK--NPNSAYHL 109

Query: 121 SINIGFPNEFDKAHNRT-----GADLMIHGEC---------------ASAGCYAMNNKQM 160
           ++ I +PN+ D AH ++     G D+ IHG                  + GC A+ N  M
Sbjct: 110 NLGISYPNKADVAHAKSLGKSAGGDIKIHGLPNKFSYLGQSIAAFGDWTEGCIALVNDDM 169

Query: 161 QEIYAIVR 168
            E++  V+
Sbjct: 170 DELFEHVK 177


>gi|261379335|ref|ZP_05983908.1| putative lipoprotein [Neisseria subflava NJ9703]
 gi|284797774|gb|EFC53121.1| putative lipoprotein [Neisseria subflava NJ9703]
          Length = 186

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 69/183 (37%), Gaps = 32/183 (17%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT-VIRIFKNENILE 64
             L  A+   +       +   +     S   + +  +           + + K++  + 
Sbjct: 7   IGLAVAMLSAVAALVFWFAAPIR-----STTTVATPSEAALPENAVIDRLVVHKSKRTMS 61

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
            + +       LLK Y I       G K   GD + PEG Y I     NPNS Y  ++ +
Sbjct: 62  AYSQG-----RLLKTYPISLGKQPVGHKQFEGDGKTPEGKYRINER--NPNSGYHKNLGV 114

Query: 125 GFPNEFDK----AHNR-TGADLMIHG--------------ECASAGCYAMNNKQMQEIYA 165
            +PNE DK    A  +  G  + IHG              +  + GC A+ ++++ E+Y 
Sbjct: 115 SYPNEADKAYAAAQGKSPGGLIKIHGMKNGWGFIGKKHLQKDWTNGCIAVTDEEVDELYR 174

Query: 166 IVR 168
            V+
Sbjct: 175 SVK 177


>gi|93005670|ref|YP_580107.1| hypothetical protein Pcryo_0840 [Psychrobacter cryohalolentis K5]
 gi|92393348|gb|ABE74623.1| conserved hypothetical protein [Psychrobacter cryohalolentis K5]
          Length = 187

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 78/183 (42%), Gaps = 38/183 (20%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
           + ++ F+L I  +    +   + + +  +  N++I              + + K+   L+
Sbjct: 15  FIVIGFSLAIMTSTSAIAAEGVSENKQAMLNNIMIDK------------VFVDKSARTLQ 62

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +   N      ++K Y I       G K + GD++ P G Y + +   N  SK++ SI++
Sbjct: 63  LLSDN-----KVIKSYHIALGGNPVGHKQQQGDKRTPTGSYILDYK--NEKSKFYRSIHV 115

Query: 125 GFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYA 165
            +PN  DKA  +      G D+MIHG+                + GC A+ + +M EI A
Sbjct: 116 SYPNAADKARAKSRGISPGGDIMIHGQKNGFGHLAAINQQRDWTDGCIAVTDNEMDEIMA 175

Query: 166 IVR 168
            V 
Sbjct: 176 AVE 178


>gi|310817141|ref|YP_003965105.1| ErfK/YbiS/YcfS/YnhG family protein [Ketogulonicigenium vulgare Y25]
 gi|308755876|gb|ADO43805.1| ErfK/YbiS/YcfS/YnhG family protein [Ketogulonicigenium vulgare Y25]
          Length = 142

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 21/142 (14%)

Query: 47  SPFHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            P  P   +  +K    L +   +      +++ Y         G K   GD + PEG Y
Sbjct: 5   DPNTPVTHLLAYKGNRSLYLMANDT-----VVRSYNFGLGFQPVGHKQFEGDGKTPEGIY 59

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------ASAGC 152
            +     NP S Y LS+ I +PN  D+ + +      G D+ IHG           + GC
Sbjct: 60  TMDRR--NPRSAYHLSVGISYPNLADREYAKQYNRSPGGDIFIHGTPQRFVGAGDWTVGC 117

Query: 153 YAMNNKQMQEIYAIVRDSLRGN 174
            A+ N +++EIY +V    R +
Sbjct: 118 MAVTNAEVEEIYRLVPLGARIH 139


>gi|241667037|ref|YP_002985121.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862494|gb|ACS60159.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 179

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 75/188 (39%), Gaps = 38/188 (20%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M N++ IL   +            +   +  P +     + +           IR++K E
Sbjct: 1   MRNKFVILAAVVVSLFAYTKLMARIGAGSPPPDAPLEQQADR-----------IRVYKTE 49

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + K +       +  Y+I        GPK   GDE+ PEG Y I W   NP S   
Sbjct: 50  RRMVLLKGDT-----PISTYRISLGQAADEGPKQREGDEKTPEGRYEIDWR--NPKSMAH 102

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQM 160
           LS++I +P+  D+ +        G ++MIHG                 + GC A+ N +M
Sbjct: 103 LSLHISYPDPDDRRNAEAGGFPPGGNIMIHGLPNGWGLFGNAHQLWDWTDGCIAVTNAEM 162

Query: 161 QEIYAIVR 168
           +EI+A V 
Sbjct: 163 REIWARVP 170


>gi|119775248|ref|YP_927988.1| ErfK/YbiS/YcfS/YnhG [Shewanella amazonensis SB2B]
 gi|119767748|gb|ABM00319.1| ErfK/YbiS/YcfS/YnhG [Shewanella amazonensis SB2B]
          Length = 165

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 35/167 (20%)

Query: 39  ISMQKKRTSPFHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGD 97
            S+Q     P     ++ + K E  ++++ R       L+K Y+I       G K++ GD
Sbjct: 14  ASVQANAIKPGQKVDLVVVNKAEAQMQVFYRG-----ELIKSYRIAMGDNPKGHKLKEGD 68

Query: 98  EQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------ 146
           ++ P+G Y + +     +S Y+ SI+I +PN+ D    +      G  +MIHG+      
Sbjct: 69  QRTPQGRYLLDFK--KADSAYYRSIHISYPNDEDILRAKALGISPGGAIMIHGQDPKSPL 126

Query: 147 --------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                     + GC A+ N+ M E++ ++             I+ +P
Sbjct: 127 SAEEAQKYNWTNGCIAVTNRDMDELWQLID--------PGTPIEIWP 165


>gi|148266084|ref|YP_001232790.1| hypothetical protein Gura_4074 [Geobacter uraniireducens Rf4]
 gi|146399584|gb|ABQ28217.1| Uncharacterized protein-like protein [Geobacter uraniireducens Rf4]
          Length = 171

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 64/134 (47%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K+E ++++ K        ++K Y+I       G K + GD++ PEG Y +     N
Sbjct: 36  VVVIKSERVMKLLKEGT-----VVKSYEIALGKEPVGAKAQKGDKKTPEGTYILDRR--N 88

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYA 154
            NSK++ SI++ +PN  D  + +      G D+MIHG                 + GC A
Sbjct: 89  SNSKFYRSIHVSYPNRSDLENAQKYGVSPGGDIMIHGLPKGLERVGELHTLINWTKGCIA 148

Query: 155 MNNKQMQEIYAIVR 168
           + N QM EI+ +V 
Sbjct: 149 VTNAQMDEIWQMVP 162


>gi|152991672|ref|YP_001357393.1| hypothetical protein SUN_0076 [Sulfurovum sp. NBC37-1]
 gi|151423533|dbj|BAF71036.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 215

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 34/194 (17%)

Query: 1   MTNRYNILL--FALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT-VIRIF 57
           M N+   L+    L +F +GC  S     K ++ LSE     M  +  S       I + 
Sbjct: 26  MNNKIYFLIYSIVLVLFFSGCEPSG---PKNQYNLSECKKELMTAEDYSEADAIDRIVVV 82

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E  + ++K        +   + I       G K + GD + PEG ++I     +P  K
Sbjct: 83  KKERKMYLYKDG-----KVKGTFPISLGRNPVGHKQQKGDYRTPEGEFFIHRKLCSP--K 135

Query: 118 YFLSINIGFPNEFDKAHNR-----TGADLMIHGEC----------------ASAGCYAMN 156
           Y+ S+ I +P   DKA  R      G D+ IH +                  + GC A+ 
Sbjct: 136 YYRSLCISYPRPEDKARARARGVNPGGDITIHAQPKWNADGKGDKYTLNRNWTQGCVAVT 195

Query: 157 NKQMQEIYAIVRDS 170
           N  M++++  VR+ 
Sbjct: 196 NSSMKKLWYAVREG 209


>gi|152986155|ref|YP_001346746.1| hypothetical protein PSPA7_1362 [Pseudomonas aeruginosa PA7]
 gi|150961313|gb|ABR83338.1| hypothetical protein PSPA7_1362 [Pseudomonas aeruginosa PA7]
          Length = 166

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 48/188 (25%), Positives = 78/188 (41%), Gaps = 49/188 (26%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + +  L    L   + + +L  K +                       + + K+E 
Sbjct: 1   MRWLLAVLCLTFASLIQANAAPTLDGKVDK----------------------VLVLKSER 38

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L +  +       +LK Y++       GPK+  GD + PEGFY+I W   + N  Y LS
Sbjct: 39  KLLLLNKGN-----VLKSYRVSLGKRPTGPKLAEGDNRTPEGFYWIDWRKTSNN--YNLS 91

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G  +MIHG                 + GC AMNN  M+E
Sbjct: 92  MHISYPNARDVAKAREKGLPAGGMIMIHGTPLDDEYPEWYFSTLDWTNGCIAMNNTDMRE 151

Query: 163 IYAIVRDS 170
           ++++V+D 
Sbjct: 152 VWSVVKDG 159


>gi|206889453|ref|YP_002248809.1| ErfK/YbiS/YcfS/YnhG [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741391|gb|ACI20448.1| ErfK/YbiS/YcfS/YnhG [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 160

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 49/183 (26%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +LLF++ IF+   + S +                            ++ + K++  + + 
Sbjct: 1   MLLFSILIFIFSVNTSLAYETVD-----------------------LVVVIKSKRAMFLM 37

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           K        ++K YK+       G K+  GD + PEG YYI     NPNS ++ ++ I +
Sbjct: 38  KEG-----KIVKAYKVALGKTPVGKKVSQGDGKTPEGRYYIIGR--NPNSNFYKALKISY 90

Query: 127 PNEFDKAHN-----RTGADLMIHG--------------ECASAGCYAMNNKQMQEIYAIV 167
           PNE D           G  +MIHG              +  + GC A+ N++M EI+ +V
Sbjct: 91  PNEQDIEQAIKLHVNPGGGIMIHGLSKHVEYLGKYHIIDDWTEGCIAVTNEEMDEIWKLV 150

Query: 168 RDS 170
            D 
Sbjct: 151 PDG 153


>gi|161170313|gb|ABX59283.1| uncharacterized protein conserved in bacteria [uncultured marine
           bacterium EB000_55B11]
          Length = 190

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 80/182 (43%), Gaps = 36/182 (19%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           +   +L  +    +GC +S ++     +     +                I + K++  L
Sbjct: 23  KLFNILLFMAFIFSGCFNSSTVYKSIPNYNGPKITK--------------IVVNKSQRKL 68

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN 123
            ++  +      +++++K+         K + GD + PEG Y+I     N NSKYFLS+ 
Sbjct: 69  FLFHND-----KIIRKFKVGLGFNPKSHKSKQGDGRTPEGLYFIDRK--NYNSKYFLSLG 121

Query: 124 IGFPNEFDKAHNR-----TGADLMIHGEC----------ASAGCYAMNNKQMQEIYAIVR 168
           I +PN  DK + +      G D+ IHG             +AGC ++++K M+ IY++V+
Sbjct: 122 ISYPNTEDKKYAKSLDIDPGGDIFIHGGPRYKGEFGKRDWTAGCISVSDKNMKVIYSMVK 181

Query: 169 DS 170
             
Sbjct: 182 AG 183


>gi|308050605|ref|YP_003914171.1| ErfK/YbiS/YcfS/YnhG family protein [Ferrimonas balearica DSM 9799]
 gi|307632795|gb|ADN77097.1| ErfK/YbiS/YcfS/YnhG family protein [Ferrimonas balearica DSM 9799]
          Length = 248

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 67/138 (48%), Gaps = 12/138 (8%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +   K +  +E+W +  D ++  L+ Y I   SG+  PK+  GD   PEG Y I     N
Sbjct: 60  LVAIKADRRMEVWLQGADGQWGELRSYPILEASGSLRPKMRQGDFLVPEGVYRIEAA--N 117

Query: 114 PNSKYFLSINIGFPNEFDK------AHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIV 167
           PNS Y LS+ I +PN  D+           G D+ IHG   S GC AM ++ ++E++ + 
Sbjct: 118 PNSLYHLSLKIDYPNAMDQHYGAMEQRGDLGGDIFIHGRDVSQGCLAMGDRYIEELFVLA 177

Query: 168 RDSLRGNMQSHIQIQAFP 185
            D        +I++   P
Sbjct: 178 HD----IGLENIEVVISP 191


>gi|150395748|ref|YP_001326215.1| hypothetical protein Smed_0524 [Sinorhizobium medicae WSM419]
 gi|150027263|gb|ABR59380.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 180

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 26/173 (15%)

Query: 15  FLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEY 74
           FL GC     ++  A         ++      +      + +FK   +L++++       
Sbjct: 6   FLWGCWFWMRIVKIAWMMTLFAATVAFPLSALAAETADKVIVFKERRVLQLFQGE----- 60

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH 134
            LL+EY +       GPK   GD++ PEG Y + W   NP S ++ SI+I +P   D   
Sbjct: 61  KLLREYPVVLGGNPVGPKRREGDQKTPEGSYVLDWR--NPGSSFYKSIHISYPAPKDLEE 118

Query: 135 N-----RTGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIVR 168
                   G  +MIHG+                + GC A+ N +M EI+ +V 
Sbjct: 119 AAARYVEPGGMIMIHGQPNYLGWLAFLTQMFDWTNGCIAVTNAEMDEIWDMVP 171


>gi|330811494|ref|YP_004355956.1| hypothetical protein PSEBR_a4539 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379602|gb|AEA70952.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 168

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 77/188 (40%), Gaps = 47/188 (25%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            R+ ++LF L           S +      + E ++                 + K+ + 
Sbjct: 1   MRWLLVLFCLSFT---AMSQASAVGTYNGKVIEKVL-----------------VLKSAHQ 40

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
           L++           LK Y+I    G   GPK+  GD++ PEGFY+I W   + N  Y+LS
Sbjct: 41  LQLINDG-----KPLKTYRISLGRGAKKGPKLIEGDKRTPEGFYWIDWRKTSEN--YYLS 93

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G  +MIHG                 + GC AM N  M+E
Sbjct: 94  MHISYPNISDAARARREGVEPGGMIMIHGTPDSEENPEQLFHTLDWTDGCIAMRNVDMRE 153

Query: 163 IYAIVRDS 170
           ++ +V D 
Sbjct: 154 VWNLVPDG 161


>gi|253559443|gb|ACT32405.1| hypothetical protein [Pseudomonas fluorescens]
          Length = 168

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 49/189 (25%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT-VIRIFKNEN 61
            R+ ++LF L                         +       T        + + K+ +
Sbjct: 1   MRWLLVLFCLSF---------------------TTVSQASAVGTYNGKVIEKVLVLKSAH 39

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            L++           LK Y+I    G   GPK+  GD++ PEGFY++ W     + +++L
Sbjct: 40  QLQLINDG-----KPLKTYRISLGKGAKKGPKLIEGDKRTPEGFYWLDWR--KTSDRFYL 92

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +PN  D A  R      G  +MIHG                 + GC AM N  M+
Sbjct: 93  SMHISYPNISDAARARREGVEPGGMIMIHGTPDSEENPEQLFHTLDWTDGCIAMRNVDMR 152

Query: 162 EIYAIVRDS 170
           E++ +V D 
Sbjct: 153 EVWNLVPDG 161


>gi|237751635|ref|ZP_04582115.1| ERFK [Helicobacter bilis ATCC 43879]
 gi|229373001|gb|EEO23392.1| ERFK [Helicobacter bilis ATCC 43879]
          Length = 174

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/179 (29%), Positives = 79/179 (44%), Gaps = 39/179 (21%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +LLF +   L     S +     E+P+  +L   + K          I + K + ILE++
Sbjct: 1   MLLFCILTLLY--QISIATERGQEYPIDLSLKGRVAK----------IVVHKQKRILELY 48

Query: 67  KRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
               D +  LLK Y  I       G K   GD + PEG YYI     NP S+YFL++ I 
Sbjct: 49  ----DDKNKLLKSYPHIALGKNPQGHKEFEGDSKTPEGLYYIDSK--NPKSRYFLNLGIS 102

Query: 126 FPNEFDKAHNRT-----GADLMIHGEC---------------ASAGCYAMNNKQMQEIY 164
           +PN+ D A+ +      G D+ IHG                  + GC A++N  M+E+Y
Sbjct: 103 YPNKLDIANAKKHNKNAGGDIKIHGLPNGMNIAKELFKQYGDWTDGCIALDNASMKELY 161


>gi|91793728|ref|YP_563379.1| ErfK/YbiS/YcfS/YnhG [Shewanella denitrificans OS217]
 gi|91715730|gb|ABE55656.1| ErfK/YbiS/YcfS/YnhG [Shewanella denitrificans OS217]
          Length = 181

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 71/170 (41%), Gaps = 35/170 (20%)

Query: 36  NLIISMQKKRTSPFHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
            +  S  +   +      ++ + K+ + + I +         +K Y I       G K++
Sbjct: 27  QVQASSNQHFITKTSKVDLVVVNKSASRMSIIRDG-----KTIKSYLIAMGDAPNGHKLK 81

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--- 146
            GD++ P+G Y++ +     +S ++ SI+I +PNE DK          G  +MIHGE   
Sbjct: 82  EGDQRTPQGRYFLDYK--KSDSAFYKSIHISYPNEEDKLRADALGISPGGMIMIHGENPK 139

Query: 147 -----------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                        + GC A+ NK+M E++ ++             I+ +P
Sbjct: 140 STLPPEEAQKYNWTNGCIAVTNKEMDELWRMIE--------PGTPIEIWP 181


>gi|119713560|gb|ABL97612.1| ErfK/YbiS/YcfS/YnhG family protein [uncultured marine bacterium
           EB0_39F01]
          Length = 160

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 36/174 (20%)

Query: 12  LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVD 71
           +    +GC +S ++     +     +                I + K++  L ++  +  
Sbjct: 1   MAFIFSGCFNSSTVYKSIPNYNGPKITK--------------IVVNKSQRKLFLFHND-- 44

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFD 131
               ++K++K+         K + GD + PEG Y+I     N NSKYFLS+ I +PN  D
Sbjct: 45  ---KIIKKFKVGLGFNPKSHKSKQGDGRTPEGLYFIDRK--NYNSKYFLSLGISYPNTED 99

Query: 132 KAHNR-----TGADLMIHGEC----------ASAGCYAMNNKQMQEIYAIVRDS 170
           K + +      G D+ IHG             +AGC ++++K M+ IY++V+  
Sbjct: 100 KKYAKSLDIDPGGDIFIHGGPRYKGEFGKRDWTAGCISVSDKNMKVIYSMVKAG 153


>gi|254466238|ref|ZP_05079649.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacterales bacterium Y4I]
 gi|206687146|gb|EDZ47628.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodobacterales bacterium Y4I]
          Length = 175

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 68/172 (39%), Gaps = 33/172 (19%)

Query: 14  IFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
           +FL G     +    A  P+                   +I   K+   L     +   E
Sbjct: 11  VFLTG-AAWMAWQAFAPRPVPPQATA------VDRIDRILIE--KSARRL---TASRGGE 58

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA 133
            VL  E+ I       G KI+ GD + PEG + I     NPNS Y LS+ I +P   D+A
Sbjct: 59  TVL--EFPIALGFEPAGDKIQEGDGKTPEGTFRIDRR--NPNSAYHLSLGIDYPQPGDRA 114

Query: 134 HNR-----TGADLMIHGEC------------ASAGCYAMNNKQMQEIYAIVR 168
             R      G D+ IHG+              +AGC A++N QM+ ++ +  
Sbjct: 115 RARAAGVSPGGDIFIHGQPNSLGTLITLPGDWTAGCIAVSNDQMETLWRLAE 166


>gi|325123406|gb|ADY82929.1| hypothetical protein BDGL_002343 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 193

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/176 (26%), Positives = 75/176 (42%), Gaps = 39/176 (22%)

Query: 34  SENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           S   + + + +      P   I +FKN+ +L + K N D    ++++Y I       G K
Sbjct: 33  SHQALSNEEIQEIIKTKPVTSIEVFKNQRLL-LLKSNQD----VIRQYPIRLGFNPKGHK 87

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE- 146
               D + PEG Y I W   N  S Y+ S++I +P+  D A+ +     TG D+MIHG  
Sbjct: 88  HFENDGRTPEGIYSIDWR--NSQSAYYKSLHISYPDAKDIAYAKQHNQPTGGDIMIHGSV 145

Query: 147 -----------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                              + GC A+ N  + EI+ +V         +H +I  +P
Sbjct: 146 PKSLLSMPFSSTYMPHKDWTLGCIAVRNVDIDEIWQLVP--------NHTKIIIYP 193


>gi|299768812|ref|YP_003730838.1| hypothetical protein AOLE_02820 [Acinetobacter sp. DR1]
 gi|298698900|gb|ADI89465.1| hypothetical protein AOLE_02820 [Acinetobacter sp. DR1]
          Length = 193

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 80/209 (38%), Gaps = 40/209 (19%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV-IRIFKN 59
           M  R  I+   L + L    +          P S   +   +        P   I +FK+
Sbjct: 1   MKIRPIIICTLLIVPLGITFYKYEKYLPTFTP-SHQALSREEISDLIKTKPVTSIEVFKS 59

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           + IL + K N D    +++ Y I       G K    D + PEG Y I W   N  S ++
Sbjct: 60  QRIL-LLKSNQD----VIRRYPIRLGLNPKGHKHFENDGKTPEGIYSIDWR--NSQSVFY 112

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGE------------------CASAGCYAMN 156
            S++I +P+  D A+ +     TG D+MIHG                     + GC A+ 
Sbjct: 113 KSLHISYPDMKDIAYAKQHNQPTGGDIMIHGSVPKSFLSMPFSSTYMPHKDWTLGCIAVR 172

Query: 157 NKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           N  + EI+  V         +H +I  +P
Sbjct: 173 NTDIDEIWQFVP--------NHTKIIIYP 193


>gi|209546383|ref|YP_002278273.1| hypothetical protein Rleg2_6003 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209539240|gb|ACI59173.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 179

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 74/189 (39%), Gaps = 38/189 (20%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +   L   +            +   +  P +     +             IR++K+E
Sbjct: 1   MRKKLIALAIVIVSLFTYTKLMARIGSGSPPPDAPLAQQADS-----------IRVYKSE 49

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + K +     V +  Y+I        GPK   GDE+ PEG Y I W   NP S   
Sbjct: 50  RRMVLLKGD-----VPISTYRISLGKAADAGPKQREGDEKTPEGHYEIDWR--NPKSMAH 102

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQM 160
           LS++I +P+  D+ +        G ++MIHG                 + GC A+ N +M
Sbjct: 103 LSLHISYPSPDDQRNAAAGSFPPGGNIMIHGLPNGWGLFRQAHRLWDWTDGCIAVTNAEM 162

Query: 161 QEIYAIVRD 169
           ++I+A V D
Sbjct: 163 RDIWARVPD 171


>gi|254452444|ref|ZP_05065881.1| ErfK/YbiS/YcfS/YnhG family protein [Octadecabacter antarcticus 238]
 gi|198266850|gb|EDY91120.1| ErfK/YbiS/YcfS/YnhG family protein [Octadecabacter antarcticus 238]
          Length = 162

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 70/180 (38%), Gaps = 41/180 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R      A    L  C     +                          T + + K  
Sbjct: 1   MNRRIF-TSAAALFALTACSSEFRVYTGP--------------------AVTSVVVQKGR 39

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + ++  N      +L++Y         G K   GD + PEG Y+I     NPNS ++L
Sbjct: 40  RKMFLFHNN-----EVLEQYDFELGFAPTGHKEVEGDGRTPEGAYFIDRK--NPNSSFYL 92

Query: 121 SINIGFPNEFDKAH----NR-TGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           SI I +PN  D+A      +  G D+ IHG           +AGC A+ +++M++IYA+V
Sbjct: 93  SIGISYPNAADRARARAMGKSPGGDIFIHGTPRASLNRDDWTAGCLAVKDREMEDIYAMV 152


>gi|126665583|ref|ZP_01736565.1| hypothetical protein MELB17_23360 [Marinobacter sp. ELB17]
 gi|126630211|gb|EBA00827.1| hypothetical protein MELB17_23360 [Marinobacter sp. ELB17]
          Length = 187

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 70/185 (37%), Gaps = 27/185 (14%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
              LF L   L      ++L           L              T + + K E  L++
Sbjct: 3   LGRLFVLCSLLLTLLTPQALASDLLARADTRLPFPHSSDIDQLPSITKVLVQKGERSLQL 62

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
                     ++++Y+I       G K+  GD + PEG Y + W   N  S ++ SI+I 
Sbjct: 63  LSGE-----QVIRQYRISLGDNPLGHKLYEGDSRTPEGEYSLDWR--NAGSSFYKSIHIS 115

Query: 126 FPNEFDKAHNR-----TGADLMIHGEC---------------ASAGCYAMNNKQMQEIYA 165
           +P+  D+          G  +MIHG                  + GC A++N+++ EI+ 
Sbjct: 116 YPSAKDREMAENWGLNPGGSIMIHGLPNGTDDDFAFAFFGLDWTDGCIAVSNQEIDEIWQ 175

Query: 166 IVRDS 170
           +V D 
Sbjct: 176 LVSDG 180


>gi|301167780|emb|CBW27364.1| putative exported protein [Bacteriovorax marinus SJ]
          Length = 171

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 33/146 (22%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             + + K+  ++E+    +D +  +++ Y +       GPK++ GD + PEG Y I W  
Sbjct: 25  VRVEVRKSNRVMEL----IDHKGEVIRTYDVMLGQSPIGPKVQRGDNKTPEGKYKINWR- 79

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------------------- 145
            NP S YFLS++I +PN+ D+ ++R      G ++ IHG                     
Sbjct: 80  -NPKSSYFLSLHISYPNKEDRQNSRDLGVDPGDNIFIHGLPNKIQRLSSFERRIAESILL 138

Query: 146 -ECASAGCYAMNNKQMQEIYAIVRDS 170
               + GC A++NK MQEI+ +V + 
Sbjct: 139 STDWTNGCIAVSNKDMQEIWDLVPNG 164


>gi|218672529|ref|ZP_03522198.1| hypothetical protein RetlG_13267 [Rhizobium etli GR56]
          Length = 179

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 73/189 (38%), Gaps = 38/189 (20%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +  +L                +   +  P +     +            +IR++K+E
Sbjct: 1   MRTKLIVLALVAISLFAYTKVMARIGSGSPSPDAPLEQRA-----------DLIRVYKSE 49

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + + +       +  Y+I        GPK   GDE+ PEG Y I W   NP S   
Sbjct: 50  RRMVLLRAD-----APIATYRISLGRAADAGPKQREGDEKTPEGRYEIDWR--NPKSMAH 102

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQM 160
           LS++I +P   ++   +      G ++MIHG                 + GC A+ N +M
Sbjct: 103 LSLHISYPKPEEQRAAQVNGFPPGGNIMIHGLPNGWGLLGDVHRLLDWTDGCIAVTNAEM 162

Query: 161 QEIYAIVRD 169
           ++I+A V D
Sbjct: 163 RDIWARVPD 171


>gi|293611082|ref|ZP_06693381.1| predicted protein [Acinetobacter sp. SH024]
 gi|292826734|gb|EFF85100.1| predicted protein [Acinetobacter sp. SH024]
          Length = 178

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/176 (26%), Positives = 75/176 (42%), Gaps = 39/176 (22%)

Query: 34  SENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           S   + + + +      P   I +FKN+ +L + K N D    ++++Y I       G K
Sbjct: 18  SHQALSNEEIQEIIKTKPVTSIEVFKNQRLL-LLKSNQD----VIRQYPIRLGFNPKGHK 72

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE- 146
               D + PEG Y I W   N  S Y+ S++I +P+  D A+ +     TG D+MIHG  
Sbjct: 73  HFENDGRTPEGIYSIDWR--NSQSAYYKSLHISYPDAKDIAYAKQHNQPTGGDIMIHGSV 130

Query: 147 -----------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                              + GC A+ N  + EI+ +V         +H +I  +P
Sbjct: 131 PKSLLSMPFSSTYMPHKDWTLGCIAVRNVDIDEIWQLVP--------NHTKIIIYP 178


>gi|227821108|ref|YP_002825078.1| lipoprotein, putative [Sinorhizobium fredii NGR234]
 gi|227340107|gb|ACP24325.1| lipoprotein, putative [Sinorhizobium fredii NGR234]
          Length = 200

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K   +L++++        LL+E+ I       G K++ GD + PEG Y + W   N
Sbjct: 65  VVVHKERRVLQLFQGE-----RLLREFPIALGGNPVGDKLQEGDRRTPEGLYVLDWR--N 117

Query: 114 PNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYA 154
             S ++ S+++ +P   D           G  +MIHG+                + GC A
Sbjct: 118 DASSFYRSMHVSYPAPEDVQAAAAKVVDPGGMIMIHGQPNYLGWLAFLTQMFDWTDGCIA 177

Query: 155 MNNKQMQEIYAIVR 168
           + N +M EI+ +V 
Sbjct: 178 VTNAEMDEIWDMVP 191


>gi|254225243|ref|ZP_04918856.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125622342|gb|EAZ50663.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 194

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 68/158 (43%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNSDEREPSFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|297579707|ref|ZP_06941634.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535353|gb|EFH74187.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 194

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 68/158 (43%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|153214388|ref|ZP_01949359.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124115337|gb|EAY34157.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 194

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+          G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDQQLAHLRGVNPGGDIKIHGLKNGDEREPSFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|126734435|ref|ZP_01750182.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. CCS2]
 gi|126717301|gb|EBA14165.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. CCS2]
          Length = 121

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 52/108 (48%), Gaps = 15/108 (13%)

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           LL  YKI       G K++ GD + PEG Y +     NPNS + LS+ I +P+  D A  
Sbjct: 9   LLSSYKIDLGFAPVGHKVQEGDGRTPEGGYRVDRR--NPNSSFHLSLGISYPDANDIASA 66

Query: 136 R-----TGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRDS 170
           R      G D+ IHG           + GC A+ N QM E+YA+V   
Sbjct: 67  RAKGVNPGGDIFIHGTPAVWERTPDWTWGCIAVTNDQMDEVYAMVNTG 114


>gi|117921827|ref|YP_871019.1| hypothetical protein Shewana3_3390 [Shewanella sp. ANA-3]
 gi|117614159|gb|ABK49613.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 157

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 67/143 (46%), Gaps = 26/143 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K+E+ + +          ++KEY +   +   G K + GDE+ PEG Y + +   
Sbjct: 21  LVKVDKSESKMYLLDGE-----QVIKEYHVAFGANPKGHKQKEGDEKTPEGSYTLDYK-- 73

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ +++I +PN  D+A+ +      G  +M+HG+                + GC 
Sbjct: 74  KEDSSFYRAMHINYPNAQDEANAKKLGVSPGGFIMVHGQRNKLGWLSFITQRFNWTNGCI 133

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQ 176
           A+ N +M E   +V    +  +Q
Sbjct: 134 ALTNSEMDEFMELVNVGTKIEIQ 156


>gi|327485387|gb|AEA79793.1| Uncharacterized protein conserved in bacteria [Vibrio cholerae
           LMA3894-4]
          Length = 187

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 68/158 (43%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 43  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 97

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 98  YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNGDEREPSFVQS 155

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 156 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 185


>gi|153816794|ref|ZP_01969461.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227811790|ref|YP_002811800.1| hypothetical protein VCM66_A0162 [Vibrio cholerae M66-2]
 gi|229506670|ref|ZP_04396179.1| hypothetical protein VCF_001892 [Vibrio cholerae BX 330286]
 gi|298500021|ref|ZP_07009827.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|126512597|gb|EAZ75191.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227010932|gb|ACP07143.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229357021|gb|EEO21939.1| hypothetical protein VCF_001892 [Vibrio cholerae BX 330286]
 gi|297542002|gb|EFH78053.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 194

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+          G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDQQLAHLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|262403345|ref|ZP_06079905.1| hypothetical protein VOA_001335 [Vibrio sp. RC586]
 gi|262350844|gb|EEY99977.1| hypothetical protein VOA_001335 [Vibrio sp. RC586]
          Length = 160

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 34/150 (22%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + + N      +++EY+I       G K + GD++ PEG Y++ +   
Sbjct: 24  LVKVDKSKRRMYLLQGN-----EVIREYRIALGKSPKGHKQQEGDQRTPEGHYFLDFII- 77

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ SI+I +PN  D+   +      G D+ IHG                 + GC 
Sbjct: 78  -DDSSFYRSIHISYPNARDQQLAQLRGVNPGGDIKIHGLKNSDEREPAFVQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
           A+ N++M E  ++V        Q  I IQ 
Sbjct: 137 AITNQEMDEFLSLV--------QPGIPIQI 158


>gi|312962870|ref|ZP_07777357.1| hypothetical protein PFWH6_4793 [Pseudomonas fluorescens WH6]
 gi|311282897|gb|EFQ61491.1| hypothetical protein PFWH6_4793 [Pseudomonas fluorescens WH6]
          Length = 167

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 71/188 (37%), Gaps = 48/188 (25%)

Query: 3   NRYNILLFALFIF-LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + L  L    L+     ++L  K                         + + K+ +
Sbjct: 1   MRWLLALICLSFATLSPASTPQTLGGKTVEK---------------------VLVLKSAH 39

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L++            K Y+I       G K+  GD + PEG Y+I W     + ++ L+
Sbjct: 40  QLQLINDG-----KPFKTYRISLGKNPKGHKLIEGDRRTPEGLYWIDWR--KTSDRFNLA 92

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G+ +MIHG                 + GC  M N  M+E
Sbjct: 93  MHISYPNISDAARARREGVKPGSMIMIHGTPDTEDYPEQWFHTLDWTDGCIGMRNVDMRE 152

Query: 163 IYAIVRDS 170
           ++ +V+D 
Sbjct: 153 VWNLVKDG 160


>gi|189499065|ref|YP_001958535.1| ErfK/YbiS/YcfS/YnhG family protein [Chlorobium phaeobacteroides
           BS1]
 gi|189494506|gb|ACE03054.1| ErfK/YbiS/YcfS/YnhG family protein [Chlorobium phaeobacteroides
           BS1]
          Length = 192

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 58/151 (38%), Gaps = 34/151 (22%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +   K E +L ++          +K Y+I       G K+  GD + PEG Y I     N
Sbjct: 57  LVAQKGERLLHLYSGGAA-----VKSYRIALGFNPVGAKLRQGDGKTPEGRYSISER--N 109

Query: 114 PNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYA 154
           P S Y LS+ I +P+  D+          G D+ IHG                 + GC A
Sbjct: 110 PQSSYHLSLRISYPDTKDRNRAGKAGVSPGGDIFIHGWPDSIVRKHASPPAGDWTQGCIA 169

Query: 155 MNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           + N +++E++  V             +  +P
Sbjct: 170 VTNDEIEELWKAVPVGT--------PVIIYP 192


>gi|229592409|ref|YP_002874528.1| hypothetical protein PFLU5023 [Pseudomonas fluorescens SBW25]
 gi|229364275|emb|CAY52000.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 167

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 72/188 (38%), Gaps = 48/188 (25%)

Query: 3   NRYNILLFAL-FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
            R+ + L  L F+ L+      +L  K                         + + K+ +
Sbjct: 1   MRWLLALICLSFVTLSSASTVETLGGKTVEK---------------------VLVLKSAH 39

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            L++            K Y+I       G K+  GD + PEG Y+I W   +   ++ L+
Sbjct: 40  QLQLINDG-----KPFKTYRISLGKNPKGHKLIEGDRRTPEGLYWIDWRKTSE--RFNLA 92

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQE 162
           ++I +PN  D A  R      G+ +MIHG                 + GC  M N  M+E
Sbjct: 93  MHISYPNISDAARARREGVKPGSMIMIHGTPDTEDYPEQWFHTLDWTDGCIGMRNVDMRE 152

Query: 163 IYAIVRDS 170
           ++ +V+D 
Sbjct: 153 VWTLVKDG 160


>gi|87200697|ref|YP_497954.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium aromaticivorans DSM 12444]
 gi|87136378|gb|ABD27120.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium aromaticivorans DSM 12444]
          Length = 167

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 23/151 (15%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIET 95
           +  S       P     +R+ K+   L +   +       L+ +  I       G K   
Sbjct: 16  VQASASANEIRPEDIASVRVEKSARRLLLLDADG----ATLRSFSNIQLGDAPLGHKRFE 71

Query: 96  GDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK----AHNR-TGADLMIHGEC--- 147
           GDE+ PEG Y I   + N  S Y LS++I +P+  D+    A  R  G  + IHG+    
Sbjct: 72  GDERTPEGRYVID--HGNARSAYHLSLHISYPDASDRAYAEARGRSPGGQIFIHGQPNSL 129

Query: 148 --------ASAGCYAMNNKQMQEIYAIVRDS 170
                    + GC A++N ++ EI+A+V D 
Sbjct: 130 ASGRIEGDWTDGCIALSNAEIDEIWALVGDG 160


>gi|262281096|ref|ZP_06058878.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257327|gb|EEY76063.1| ErfK/YbiS/YcfS/YnhG family protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 181

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 72/176 (40%), Gaps = 39/176 (22%)

Query: 34  SENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           S   + + +        P   I +FKN+ IL + K N D    +++ Y I       G K
Sbjct: 21  SHKALSTEEIFELIKTKPITSIEVFKNQRIL-LLKSNQD----VIRRYPIRLGFNPEGHK 75

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE- 146
               D + PEG Y I W   N  S Y+ S++I +P+  D A+ +     TG D+MIHG  
Sbjct: 76  HFENDGKTPEGVYSIDWR--NSQSAYYKSLHISYPDAKDIAYAKQHNQPTGGDIMIHGSV 133

Query: 147 -----------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                              + GC A+ N  + EI+  V         +H +I  +P
Sbjct: 134 PKSLISMPFSSTYMPHKDWTLGCIAVRNADIDEIWQFVP--------NHTKIIIYP 181


>gi|153830346|ref|ZP_01983013.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|148874189|gb|EDL72324.1| conserved hypothetical protein [Vibrio cholerae 623-39]
          Length = 194

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|121728201|ref|ZP_01681235.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|254286657|ref|ZP_04961612.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|121629524|gb|EAX61948.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|150423241|gb|EDN15187.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
          Length = 194

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 192


>gi|147672199|ref|YP_001215949.1| hypothetical protein VC0395_1113 [Vibrio cholerae O395]
 gi|262167801|ref|ZP_06035502.1| hypothetical protein VIJ_000972 [Vibrio cholerae RC27]
 gi|146314582|gb|ABQ19122.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227014791|gb|ACP11000.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|262023709|gb|EEY42409.1| hypothetical protein VIJ_000972 [Vibrio cholerae RC27]
          Length = 160

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+          G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDQQLAHLRGVNPGGDIKIHGLKNGDEREPSFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 158


>gi|229526209|ref|ZP_04415613.1| hypothetical protein VCA_000324 [Vibrio cholerae bv. albensis
           VL426]
 gi|229527855|ref|ZP_04417246.1| hypothetical protein VCG_000929 [Vibrio cholerae 12129(1)]
 gi|229334217|gb|EEN99702.1| hypothetical protein VCG_000929 [Vibrio cholerae 12129(1)]
 gi|229336367|gb|EEO01385.1| hypothetical protein VCA_000324 [Vibrio cholerae bv. albensis
           VL426]
          Length = 160

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 68/158 (43%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNGDEREPSFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 158


>gi|119382801|ref|YP_913857.1| hypothetical protein Pden_0044 [Paracoccus denitrificans PD1222]
 gi|119372568|gb|ABL68161.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 188

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 27/137 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNL 112
           I + K +  + + + +      +LK Y+I   S    G K   GDE+ PEG Y I W   
Sbjct: 48  IVVSKGDKTMYLLRGD-----RILKTYRIAMGSNWNQGHKQREGDERTPEGTYRIDWR-- 100

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCY 153
           NP S   LS+++ +PN  D    R      G ++MIHG                 + GC 
Sbjct: 101 NPRSIAHLSLHVSYPNAEDSERARQAGYSPGGNIMIHGLPNGWGAMGRLHRLLDWTDGCI 160

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N +M+EI+++  + 
Sbjct: 161 AVTNDEMREIWSLTPNG 177


>gi|121587991|ref|ZP_01677744.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121547789|gb|EAX57878.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
          Length = 197

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      ++ EY+I       G K + GD++ PEG 
Sbjct: 53  NLSYAQVDLVKVDKSKRRMYLLQGN-----EVISEYRIALGKSPKGHKQQEGDQRTPEGH 107

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 108 YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNGDEREPSFVQS 165

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 166 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 195


>gi|152991674|ref|YP_001357395.1| hypothetical protein SUN_0078 [Sulfurovum sp. NBC37-1]
 gi|151423535|dbj|BAF71038.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 196

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 32/197 (16%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV---IRIF 57
           + N   + +    +F++GC   R+       P +           T      +   I ++
Sbjct: 2   IKNIVLLSILGTAVFISGCGEPRAYGKVDNTPYAIGECRQELSHGTDVDQGKLADKIVVY 61

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAW-SGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           K +  L ++++       LL   KI    +G  G KI+ GD + PEG Y+I     +P  
Sbjct: 62  KKKRKLSMYRQG-----KLLYACKISLGKNGDKGNKIQAGDYRTPEGSYWIVRKKCDP-- 114

Query: 117 KYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC----------------ASAGCYAM 155
           + + S+ I +PNE DKA  R      G  + IHG+                  + GC A+
Sbjct: 115 RLYKSLMISYPNEADKARARAHGAKPGGYITIHGQPKWNADGHADRYTLAHDWTEGCMAV 174

Query: 156 NNKQMQEIYAIVRDSLR 172
            NK +  ++  V++ ++
Sbjct: 175 PNKAIDTLWRSVKNGVK 191


>gi|254505691|ref|ZP_05117837.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus 16]
 gi|219551344|gb|EED28323.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus 16]
          Length = 159

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 66/134 (49%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          +++EY++       G K + GD++ PEG YY+ +   
Sbjct: 23  LVKVDKSKRRMYLMDGK-----EVVREYRVALGQSPKGHKRQEGDQKTPEGRYYLDFVI- 76

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S+Y+ SI+I +PN  D+ + R      G D+ IHG                 + GC 
Sbjct: 77  -EDSQYYKSIHISYPNLRDRTYARVHNLDPGGDIKIHGLKNGERRPANYVQSFDWTDGCI 135

Query: 154 AMNNKQMQEIYAIV 167
           A+ N++M E+ ++V
Sbjct: 136 AITNQEMDELLSLV 149


>gi|99078481|ref|YP_611739.1| hypothetical protein TM1040_3505 [Ruegeria sp. TM1040]
 gi|99035619|gb|ABF62477.1| hypothetical protein TM1040_3505 [Ruegeria sp. TM1040]
          Length = 186

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I + K+   L + +         ++ Y I   +   G K   GDE+ PEG Y I W   N
Sbjct: 49  ILVIKSTRALHLLRDGET-----IRSYDISLGAAPEGHKQSEGDERTPEGRYEIDWR--N 101

Query: 114 PNSKYFLSINIGFPN-----EFDKAHNRTGADLMIHGEC--------------ASAGCYA 154
           PNS   LS++I +PN         A    G ++MIHG                 + GC A
Sbjct: 102 PNSIAHLSLHISYPNAADQAAAKAAARDPGGNIMIHGLPNGWGALGALHLMLDWTDGCIA 161

Query: 155 MNNKQMQEIYAIVRDS 170
           + N +M+EI+++V D 
Sbjct: 162 VTNAEMREIWSLVPDG 177


>gi|241760216|ref|ZP_04758312.1| ErfK/YbiS/YcfS/YnhG [Neisseria flavescens SK114]
 gi|241319327|gb|EER55792.1| ErfK/YbiS/YcfS/YnhG [Neisseria flavescens SK114]
          Length = 182

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K++  +  + +       LLK Y I       G K   GD + PEG Y I     N
Sbjct: 47  LVVHKSKRTMSAYSQG-----RLLKTYPISLGKQPVGHKQFEGDGKTPEGKYRINER--N 99

Query: 114 PNSKYFLSINIGFPNEFDK----AHNR-TGADLMIHG--------------ECASAGCYA 154
           PNS Y  ++ + +PNE DK    A  +  G  + IHG              +  + GC A
Sbjct: 100 PNSGYHKNLGVSYPNEADKAYAAAQGKSPGGLIKIHGMKNGWGFIGKKHLQKDWTNGCIA 159

Query: 155 MNNKQMQEIYAIVR 168
           + ++++ E+Y  V+
Sbjct: 160 VTDEEVDELYRSVK 173


>gi|114762228|ref|ZP_01441696.1| ErfK/YbiS/YcfS/YnhG family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114545252|gb|EAU48255.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius sp. HTCC2601]
          Length = 133

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 54/121 (44%), Gaps = 27/121 (22%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDK-- 132
            +LK Y I       G K   GD + PEG Y+I     NPNS + LS+ I +PN  D+  
Sbjct: 8   KVLKSYDIGLGFQPQGHKQFEGDGKTPEGLYFIDRR--NPNSSFHLSLGISYPNPNDRAF 65

Query: 133 --AHNR-TGADLMIHGEC--------------------ASAGCYAMNNKQMQEIYAIVRD 169
             A  +  G D+ IHG                       + GC A+++ Q++ IYA+V+ 
Sbjct: 66  AAAAGKSPGGDIFIHGGPPKDRKRLGGGDWMTKGNSVDWTWGCIAVSDDQIEHIYAMVKT 125

Query: 170 S 170
            
Sbjct: 126 G 126


>gi|229522834|ref|ZP_04412248.1| hypothetical protein VIF_003402 [Vibrio cholerae TM 11079-80]
 gi|229340051|gb|EEO05059.1| hypothetical protein VIF_003402 [Vibrio cholerae TM 11079-80]
          Length = 160

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 34/158 (21%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQA 183
              + GC A+ N++M E  ++V        Q  + I  
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLV--------QPGVPIHI 158


>gi|29654462|ref|NP_820154.1| putative lipoprotein [Coxiella burnetii RSA 493]
 gi|153211349|ref|ZP_01947691.1| putative lipoprotein [Coxiella burnetii 'MSU Goat Q177']
 gi|154707148|ref|YP_001424614.1| hypothetical protein CBUD_1254 [Coxiella burnetii Dugway 5J108-111]
 gi|161830363|ref|YP_001597027.1| putative lipoprotein [Coxiella burnetii RSA 331]
 gi|212218590|ref|YP_002305377.1| hypothetical protein CbuK_1024 [Coxiella burnetii CbuK_Q154]
 gi|29541729|gb|AAO90668.1| hypothetical exported protein [Coxiella burnetii RSA 493]
 gi|120575062|gb|EAX31686.1| putative lipoprotein [Coxiella burnetii 'MSU Goat Q177']
 gi|154356434|gb|ABS77896.1| hypothetical exported protein [Coxiella burnetii Dugway 5J108-111]
 gi|161762230|gb|ABX77872.1| putative lipoprotein [Coxiella burnetii RSA 331]
 gi|212012852|gb|ACJ20232.1| hypothetical exported protein [Coxiella burnetii CbuK_Q154]
          Length = 233

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 22/195 (11%)

Query: 10  FALFIFLNGCHH--------SRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNE 60
             L +   GC            S I K      +NL    ++   S P     + +FKN 
Sbjct: 17  ILLTLTFTGCASIHHGPQRSMSSAISKYRGYAFKNLGPYFKRAGVSYPPKDISLLVFKNS 76

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           + +++W ++    +  ++ + I A SG  GPK+  GD Q PEG Y I     NP S++ L
Sbjct: 77  HRVQLWAKDR-GPWRYIRSFPILASSGGPGPKLHDGDHQVPEGVYKIVG--FNPASRFDL 133

Query: 121 SINIGFPNEFDKAHNR------TGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGN 174
           S+ + +PN  D+ + R       G D+ IHG  AS GC  + NK +++++ +        
Sbjct: 134 SLMLNYPNSADRYYARLDHRHDLGDDIFIHGSDASIGCIPIGNKAIEQLFVLA----YLV 189

Query: 175 MQSHIQIQAFPFRMT 189
            + HI++   P  + 
Sbjct: 190 GERHIKVIIAPDDLR 204


>gi|163751492|ref|ZP_02158715.1| hypothetical protein KT99_14104 [Shewanella benthica KT99]
 gi|161328613|gb|EDP99763.1| hypothetical protein KT99_14104 [Shewanella benthica KT99]
          Length = 127

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 21/115 (18%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH 134
            +L+ Y I       G K++ GD++ PEG Y + +     +S Y+ +I+I +PNE D+  
Sbjct: 8   KVLRRYHIALGDRPLGHKLQEGDQRTPEGRYTLDYK--KSDSAYYRAIHISYPNEEDQLR 65

Query: 135 NR-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVRDS 170
            R      G  +MIHG+                + GC A+ N QM E++  + + 
Sbjct: 66  ARALGIQPGGQIMIHGQNPRSSLSAAEAQQYNWTDGCIAITNPQMDELWRAIDEG 120


>gi|259415196|ref|ZP_05739118.1| ErfK/YbiS/YcfS/YnhG family protein [Silicibacter sp. TrichCH4B]
 gi|259349106|gb|EEW60860.1| ErfK/YbiS/YcfS/YnhG family protein [Silicibacter sp. TrichCH4B]
          Length = 186

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 61/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I + K+   L + ++        ++ Y I   +   G K   GDE+ PEG Y I W   N
Sbjct: 49  ILVIKSTRALHLLRQGET-----IRSYDISLGAAPEGHKQSEGDERTPEGRYKIDWR--N 101

Query: 114 PNSKYFLSINIGFPN-----EFDKAHNRTGADLMIHGEC--------------ASAGCYA 154
           PNS   LS++I +PN         A    G ++MIHG                 + GC A
Sbjct: 102 PNSVAHLSLHISYPNAADQAAAKAAARDPGGNIMIHGLPNGWGALGALHLMRDWTDGCIA 161

Query: 155 MNNKQMQEIYAIVRDS 170
           + N +M+EI+++V + 
Sbjct: 162 VTNAEMREIWSLVPNG 177


>gi|70728465|ref|YP_258214.1| hypothetical protein PFL_1083 [Pseudomonas fluorescens Pf-5]
 gi|68342764|gb|AAY90370.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 167

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K+ + L++           LK Y+I       GPK+  GD++ PEG Y++ W    
Sbjct: 32  VLVLKSAHQLQLINGG-----KPLKTYRISLGKKPKGPKLMEGDKRTPEGLYWLDWR--K 84

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYA 154
            + +Y L+++I +PN  D A +R      G  +MIHG                 + GC A
Sbjct: 85  TSDRYNLAMHISYPNITDAARSRREGVDPGGMIMIHGTPDTEEFPEQYFHTLDWTDGCIA 144

Query: 155 MNNKQMQEIYAIVRDS 170
           M N  M+E++ +V+D 
Sbjct: 145 MRNVDMREVWGLVKDG 160


>gi|260777335|ref|ZP_05886229.1| hypothetical protein VIC_002729 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607001|gb|EEX33275.1| hypothetical protein VIC_002729 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 154

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 64/137 (46%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          ++KE++I       G K + GD + PEG YY+ +   
Sbjct: 18  LVKVDKSKRRMYLIDNG-----QVVKEFRIALGKHPKGHKTQEGDHRTPEGRYYLDFVI- 71

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
             NS+++ SI+I +PN  D A+        G D+ IHG                 + GC 
Sbjct: 72  -DNSEFYRSIHISYPNPRDIAYAAKLRVDPGGDIKIHGLRNGEKRPAKFVQSFDWTNGCI 130

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E+  +V+  
Sbjct: 131 AITNEEMDELLTLVKTG 147


>gi|329120497|ref|ZP_08249162.1| ErfK/YbiS/YcfS/YnhG family protein [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327461955|gb|EGF08285.1| ErfK/YbiS/YcfS/YnhG family protein [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 235

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 63/156 (40%), Gaps = 26/156 (16%)

Query: 33  LSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           LS      +Q+    P      + + K+   ++ +    D    LLK Y +       G 
Sbjct: 77  LSPRRQTLLQQPALPPDTEIAKLVVRKSAREMDAY----DHSGRLLKTYPVALGRAPVGH 132

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN----EFDKAHNR-TGADLMIHG- 145
           K   GD + PEG Y I     NP+S Y  ++ + +PN        A  R  G D+ IHG 
Sbjct: 133 KQFEGDGKTPEGRYTISGR--NPHSGYHKNLGVSYPNRADRARAAAQGRSPGGDIKIHGL 190

Query: 146 -------------ECASAGCYAMNNKQMQEIYAIVR 168
                           + GC A+ ++++ E+YA+V 
Sbjct: 191 KNGLGAIGAQHLRRDWTDGCIAVTDREIDELYALVE 226


>gi|261414486|ref|YP_003248169.1| ErfK/YbiS/YcfS/YnhG family protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261370942|gb|ACX73687.1| ErfK/YbiS/YcfS/YnhG family protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326024|gb|ADL25225.1| ErfK/YbiS/YcfS/YnhG family protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 174

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/154 (25%), Positives = 65/154 (42%), Gaps = 29/154 (18%)

Query: 39  ISMQKKRTSPFHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGD 97
              +  +     P   I + K +  + +       E  ++K YKI       G K+++GD
Sbjct: 21  SEKESPKVMLTSPVDNILVEKAKRQMHL----RSGE-NIVKTYKISLGKNPVGAKVKSGD 75

Query: 98  EQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC----- 147
            + PEG Y I  +  NP S + LS+ + +PN       +      G D+MIHG       
Sbjct: 76  NKTPEGNYTIERH--NPKSIFHLSLKVSYPNAEQIKAAKEGNYEPGGDIMIHGYPNKIPA 133

Query: 148 -----------ASAGCYAMNNKQMQEIYAIVRDS 170
                       +AGC A+ N +++EIY  V+D 
Sbjct: 134 FLFKFWHKWKDWTAGCIAVTNDEIEEIYDAVKDG 167


>gi|310780465|ref|YP_003968797.1| ErfK/YbiS/YcfS/YnhG family protein [Ilyobacter polytropus DSM 2926]
 gi|309749788|gb|ADO84449.1| ErfK/YbiS/YcfS/YnhG family protein [Ilyobacter polytropus DSM 2926]
          Length = 164

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 63/129 (48%), Gaps = 20/129 (15%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K+   + +   N      ++K Y I       G K ++GD + PEG Y + +   
Sbjct: 33  LVKVDKSSKKMFLMSGN-----QVIKIYDISLGIDPIGHKGKSGDNKTPEGIYTLDYK-- 85

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGEC--------ASAGCYAMNNKQ 159
           N  S Y+ SI+I +PNE DKA         G D+ IHG+          + GC  + N++
Sbjct: 86  NSQSIYYKSIHISYPNEKDKAAAAQKGWDPGGDITIHGQKKGSLSKEEWTEGCIGVTNEE 145

Query: 160 MQEIYAIVR 168
           M EI+ +++
Sbjct: 146 MDEIWELLQ 154


>gi|212212447|ref|YP_002303383.1| hypothetical protein CbuG_0852 [Coxiella burnetii CbuG_Q212]
 gi|212010857|gb|ACJ18238.1| hypothetical exported protein [Coxiella burnetii CbuG_Q212]
          Length = 233

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 88/195 (45%), Gaps = 22/195 (11%)

Query: 10  FALFIFLNGCHH--------SRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNE 60
             L +   GC            S I K      +NL    ++   S P     + +FKN 
Sbjct: 17  ILLTLTFTGCASIHHGPQRSMSSAISKYRGYAFKNLGPCFKRAGVSYPPKDISLLVFKNS 76

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           + +++W ++    +  ++ + I A SG  GPK+  GD Q PEG Y I     NP S++ L
Sbjct: 77  HRVQLWAKDR-GPWRYIRSFPILASSGGPGPKLHDGDHQVPEGVYKIVG--FNPASRFDL 133

Query: 121 SINIGFPNEFDKAHNR------TGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGN 174
           S+ + +PN  D+ + R       G ++ IHG  AS GC  + NK +++++ +        
Sbjct: 134 SLMLNYPNSADRYYARLDHRHDLGDNIFIHGSDASIGCIPIGNKAIEQLFVLA----YLV 189

Query: 175 MQSHIQIQAFPFRMT 189
            + HI++   P  + 
Sbjct: 190 GERHIKVIIAPDDLR 204


>gi|153802363|ref|ZP_01956949.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124122082|gb|EAY40825.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 194

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 26/143 (18%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D+   +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDQQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVR 168
              + GC A+ N++M E  ++V+
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLVQ 185


>gi|71906556|ref|YP_284143.1| ErfK/YbiS/YcfS/YnhG [Dechloromonas aromatica RCB]
 gi|71846177|gb|AAZ45673.1| ErfK/YbiS/YcfS/YnhG [Dechloromonas aromatica RCB]
          Length = 431

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 56/149 (37%), Gaps = 17/149 (11%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNV--DAEYVLLKEYKICAW 85
           KA         +     +  P     I +    + L +++ +   D     + +Y I   
Sbjct: 143 KAYREKPPADFVPRYLLQMQPDQRYAIVVDTKRSRLYLYENDTKHDGRPRFVADYYITH- 201

Query: 86  SGTFG-PKIETGDEQAPEGFYYIG---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADL 141
            G  G  K+  GD++ P G Y++          +     +  + +PNE+DK   R G+ +
Sbjct: 202 -GKLGAEKLVEGDKKTPVGVYHVTANLPKQKLADLYGTGAYPLNYPNEWDKRQGRGGSGI 260

Query: 142 MIHGECA---------SAGCYAMNNKQMQ 161
            +HG  +         S GC  + N+ + 
Sbjct: 261 WLHGTPSNTFARPPRASDGCVVLTNQDLD 289


>gi|119945545|ref|YP_943225.1| hypothetical protein Ping_1849 [Psychromonas ingrahamii 37]
 gi|119864149|gb|ABM03626.1| conserved hypothetical protein [Psychromonas ingrahamii 37]
          Length = 166

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 81/189 (42%), Gaps = 52/189 (27%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M N + I+LF +   + G +           PL++                  + + K++
Sbjct: 4   MKNLFIIILF-MLPLIAGANT--------LLPLADQ-----------------VVVEKSK 37

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             + + K+      V+ +EY I       G K + GD++ PEG Y I +   NP S+++L
Sbjct: 38  RKMYLIKQG-----VVYREYPIALGYRPIGHKGKEGDKRTPEGRYIIDYR--NPESRFYL 90

Query: 121 SINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQ 161
           S++I +P+E D           G ++ IHG+                + GC A+ N+ ++
Sbjct: 91  SLHINYPSEKDLQSAADNNVSPGGEIFIHGQPNNTKHHPSKFRGRDWTDGCIAITNQDIK 150

Query: 162 EIYAIVRDS 170
           + + +V+D 
Sbjct: 151 QFWTLVKDG 159


>gi|27367809|ref|NP_763336.1| hypothetical protein VV2_1455 [Vibrio vulnificus CMCP6]
 gi|27359382|gb|AAO08326.1|AE016813_78 Uncharacterized protein conserved in bacteria [Vibrio vulnificus
           CMCP6]
          Length = 161

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +++ K++  L +          +++EY+I       G K++ GD++ PEG Y + +  + 
Sbjct: 26  VKVDKSKRRLYLMSGE-----EVIREYRIALGKQPKGHKVQEGDQRTPEGIYTLDY--VT 78

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
             S ++ S++I +PN  D    +      G D+ +HG                 + GC A
Sbjct: 79  EESAFYRSVHISYPNPIDSLLAKEKGLSPGGDIKVHGLRDGEQRDPRFVQSFDWTNGCIA 138

Query: 155 MNNKQMQEIYAIVRDS 170
           + N++M E   +V+  
Sbjct: 139 LTNQEMDEFIRLVKMG 154


>gi|37675934|ref|NP_936330.1| hypothetical protein VVA0274 [Vibrio vulnificus YJ016]
 gi|37200474|dbj|BAC96300.1| uncharacterized protein conserved in bacteria [Vibrio vulnificus
           YJ016]
          Length = 161

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +++ K++  L +          +++EY+I       G K++ GD++ PEG Y + +  + 
Sbjct: 26  VKVDKSKRRLYLMSGE-----EVIREYRIALGKQPKGHKVQEGDQRTPEGIYTLDY--VT 78

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
             S ++ S++I +PN  D    +      G D+ +HG                 + GC A
Sbjct: 79  EESAFYRSVHISYPNPIDSLLAKEKGISPGGDIKVHGLRDGEQRDPRFVQSFDWTNGCIA 138

Query: 155 MNNKQMQEIYAIVRDS 170
           + N++M E   +V+  
Sbjct: 139 LTNQEMDEFIRLVKMG 154


>gi|262275516|ref|ZP_06053326.1| hypothetical protein VHA_002498 [Grimontia hollisae CIP 101886]
 gi|262220761|gb|EEY72076.1| hypothetical protein VHA_002498 [Grimontia hollisae CIP 101886]
          Length = 139

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 64/135 (47%), Gaps = 26/135 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K+   + + + +      ++K Y I   +   G K+  GD++ PEG Y + +  +
Sbjct: 3   LVKVDKSARKMYLIQGD-----RIVKRYHISLGANPKGHKLREGDQRTPEGHYLLDF--I 55

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
           N  S+++ SI I +PNE D    +      G  +MIHG+                + GC 
Sbjct: 56  NEKSRFYRSIRINYPNENDVKRAQKLGVNPGGQIMIHGQKNNNDSLPGSGRSKDWTDGCI 115

Query: 154 AMNNKQMQEIYAIVR 168
           A+ N+++ E   +V+
Sbjct: 116 AITNEEIDEFLRLVK 130


>gi|323499297|ref|ZP_08104274.1| hypothetical protein VISI1226_03725 [Vibrio sinaloensis DSM 21326]
 gi|323315685|gb|EGA68719.1| hypothetical protein VISI1226_03725 [Vibrio sinaloensis DSM 21326]
          Length = 159

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  L +          +++EY+I       G K + GD++ PEG YY+ +   
Sbjct: 23  LVKVDKSKRRLYLLDGQ-----QVVREYRIALGKSPKGHKQQEGDQKTPEGRYYLDFVL- 76

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S+++ SI+I +PN  D+          G D+ IHG                 + GC 
Sbjct: 77  -NDSQFYRSIHISYPNLKDRTQAMSNKVDPGGDIKIHGLKNGETRPANYVQSFDWTDGCI 135

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M ++ ++V   
Sbjct: 136 ALTNQEMDDLLSLVSTG 152


>gi|320158079|ref|YP_004190457.1| hypothetical protein VVM_00523 [Vibrio vulnificus MO6-24/O]
 gi|319933391|gb|ADV88254.1| uncharacterized protein conserved in bacteria [Vibrio vulnificus
           MO6-24/O]
          Length = 160

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 26/136 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +++ K++  L +          +++EY+I       G K++ GD++ PEG Y + +  + 
Sbjct: 25  VKVDKSKRRLYLMSGE-----EVIREYRIALGKQPKGHKVQEGDQRTPEGIYTLDY--VT 77

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
             S ++ S++I +PN  D    +      G D+ +HG                 + GC A
Sbjct: 78  EESAFYRSVHISYPNPIDSLLAKEKGISPGGDIKVHGLRDGEQRDPRFVQSFDWTNGCIA 137

Query: 155 MNNKQMQEIYAIVRDS 170
           + N++M E   +V+  
Sbjct: 138 LTNQEMDEFIRLVKMG 153


>gi|15600934|ref|NP_232564.1| hypothetical protein VCA0164 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|153822669|ref|ZP_01975336.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|254850432|ref|ZP_05239782.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|9657554|gb|AAF96077.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|126519826|gb|EAZ77049.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|254846137|gb|EET24551.1| conserved hypothetical protein [Vibrio cholerae MO10]
          Length = 194

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 26/143 (18%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 50  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 104

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 105 YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 162

Query: 147 -CASAGCYAMNNKQMQEIYAIVR 168
              + GC A+ N++M E  ++V+
Sbjct: 163 FDWTNGCIAITNQEMDEFLSLVQ 185


>gi|91228120|ref|ZP_01262162.1| hypothetical protein V12G01_03532 [Vibrio alginolyticus 12G01]
 gi|91188238|gb|EAS74538.1| hypothetical protein V12G01_03532 [Vibrio alginolyticus 12G01]
          Length = 160

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + ++       +LKEY+I   +   G K E GD + PEG Y + +   
Sbjct: 24  LVKVDKSKRRMYLMEQG-----AVLKEYRIALGANPQGHKQEEGDNRTPEGEYTLDYVI- 77

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D    +      G ++ IHG                 + GC 
Sbjct: 78  -EDSAFYRSVHISYPDAIDTLEAKRRGVSPGGNIKIHGLKNGESQLPIYIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V   
Sbjct: 137 AITNEEMDEFIQLVEMG 153


>gi|167644675|ref|YP_001682338.1| hypothetical protein Caul_0707 [Caulobacter sp. K31]
 gi|167347105|gb|ABZ69840.1| conserved hypothetical protein-like protein [Caulobacter sp. K31]
          Length = 178

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 69/206 (33%), Gaps = 49/206 (23%)

Query: 1   MTNRYNILLFALFIFLNG--CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           M  R           L G  C    +    A  P  E                  I I K
Sbjct: 1   MIRRPRFRFGTARAALLGSLCAGIAACTRPAPAPAVE-------------GSVDHILIEK 47

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
             + + +   +       L+ Y+I    G   PK   GD + PEG Y I     NP S Y
Sbjct: 48  AAHRMTLLAGH-----RPLRTYRISLGRGGLAPKAREGDGRTPEGDYRIAGR--NPKSAY 100

Query: 119 FLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQ 159
            LS+ IG+P     A  R      G D+MIHG                 + GC A+ + +
Sbjct: 101 HLSLRIGYPTPAQTADARGRGVDPGGDIMIHGLPNGRGALARYYAGRDWTDGCVAVTDAE 160

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFP 185
           ++EI+ +         Q   ++   P
Sbjct: 161 VEEIWRLT--------QDDARVHIAP 178


>gi|326389097|ref|ZP_08210679.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206697|gb|EGD57532.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium nitrogenifigens DSM 19370]
          Length = 174

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 22/133 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           + I K    L +      A    ++ Y  I       GPK   GD + PEG Y I W   
Sbjct: 41  VLIEKGARRLTLLDAEGGA----VRVYDHIRLGWEPVGPKRFEGDGRTPEGHYRIDWGL- 95

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC----------ASAGCYAMNN 157
             +S Y LS++I +P   D+A+ R      G  + IHG             +AGC A++N
Sbjct: 96  -ESSAYHLSLHISYPGPSDQAYARSRGRSPGGAIFIHGWPNGARDAPEGDWTAGCIALDN 154

Query: 158 KQMQEIYAIVRDS 170
            +++EI+ +V D 
Sbjct: 155 AEIEEIWGLVGDG 167


>gi|126738023|ref|ZP_01753744.1| hypothetical protein RSK20926_05802 [Roseobacter sp. SK209-2-6]
 gi|126720520|gb|EBA17225.1| hypothetical protein RSK20926_05802 [Roseobacter sp. SK209-2-6]
          Length = 177

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 67/184 (36%), Gaps = 34/184 (18%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R   L     + L            A  P    L+   Q+          I I K+ 
Sbjct: 1   MLRRALQLS---ALCLTAALGWGLWHAFAPAPSIPTLVEDAQRVDQ-------IVIDKSA 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L     +   E VL  E+ I       G K E GD + PEG + +     N NS + L
Sbjct: 51  RRL---LASRQGETVL--EFDIALGFEPVGDKAEEGDGKTPEGIFRVNRR--NANSSFHL 103

Query: 121 SINIGFPNEFDKAHN-----RTGADLMIHGEC------------ASAGCYAMNNKQMQEI 163
           S+ + +P   D           G D+ IHG+              +AGC A++N +M+ +
Sbjct: 104 SLGLDYPQAEDLQRAEDAGIDPGGDIFIHGQPNAVGGALTLPGDWTAGCIAISNSEMERL 163

Query: 164 YAIV 167
           + +V
Sbjct: 164 WQLV 167


>gi|291279132|ref|YP_003495967.1| hypothetical protein DEFDS_0732 [Deferribacter desulfuricans SSM1]
 gi|290753834|dbj|BAI80211.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 168

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 26/135 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + + K+++ + + K        +LK + I       G K + GDE+ PEG Y++ +   
Sbjct: 32  YVLVKKSKHKIYLLKSG-----KILKSFHIALGGNPKGAKQKQGDEKTPEGIYFLDYK-- 84

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
           N  S+Y+ SI+I +PN  D    +      G D+MIHG+                + GC 
Sbjct: 85  NERSRYYKSIHISYPNTSDVKRAKKMGVSPGGDIMIHGQKKGWGWLSFISQKFDWTKGCI 144

Query: 154 AMNNKQMQEIYAIVR 168
           A++NK M  I+ +V+
Sbjct: 145 AVSNKDMDVIWKMVK 159


>gi|229514664|ref|ZP_04404125.1| hypothetical protein VCB_002316 [Vibrio cholerae TMA 21]
 gi|229348644|gb|EEO13602.1| hypothetical protein VCB_002316 [Vibrio cholerae TMA 21]
          Length = 160

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 26/143 (18%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDHQLAQLRGVNPGGDIKIHGLKNGDEREPSFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVR 168
              + GC A+ N++M E  ++V+
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLVQ 151


>gi|71281133|ref|YP_269221.1| ErfK/YbiS/YcfS/YnhG family protein [Colwellia psychrerythraea 34H]
 gi|71146873|gb|AAZ27346.1| ErfK/YbiS/YcfS/YnhG family protein [Colwellia psychrerythraea 34H]
          Length = 171

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 65/141 (46%), Gaps = 26/141 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +++I K+E  + + +         +KEY +       G K + GDE+ PEG Y + +   
Sbjct: 35  LVKIDKSERRMYLLENG-----KTIKEYHVAFGENPKGHKEKEGDEKTPEGIYILDYK-- 87

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ +++I +PN+ D  + +      G  +MIHG+                + GC 
Sbjct: 88  KEDSSFYRAMHISYPNQADLDNAKIKGFSAGGLIMIHGQRNELAGVSAFTQRFNWTNGCI 147

Query: 154 AMNNKQMQEIYAIVRDSLRGN 174
           A+ N +M +  ++V+   + +
Sbjct: 148 ALTNSEMDQFMSLVKVGTKIH 168


>gi|153834888|ref|ZP_01987555.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio harveyi HY01]
 gi|148868659|gb|EDL67741.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio harveyi HY01]
          Length = 160

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 60/137 (43%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          ++KEY+I   +   G K E GD + PEG Y + +   
Sbjct: 24  LVKVDKSKRRMYLMDNG-----EVVKEYRIALGANPKGHKQEEGDNRTPEGDYTLDYVI- 77

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D+          G  + IHG                 + GC 
Sbjct: 78  -NDSAFYRSVHISYPDAIDRLEAHRRGVSPGGAIKIHGLKNGETQAPQFIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V+  
Sbjct: 137 AITNEEMDEFIRLVKMG 153


>gi|153825032|ref|ZP_01977699.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio cholerae MZO-2]
 gi|149741357|gb|EDM55391.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio cholerae MZO-2]
          Length = 160

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 26/143 (18%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNSDEREPGFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVR 168
              + GC A+ N++M E  ++V+
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLVQ 151


>gi|254227859|ref|ZP_04921289.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio sp. Ex25]
 gi|262396152|ref|YP_003288005.1| hypothetical protein VEA_000854 [Vibrio sp. Ex25]
 gi|151939355|gb|EDN58183.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio sp. Ex25]
 gi|262339746|gb|ACY53540.1| hypothetical protein VEA_000854 [Vibrio sp. Ex25]
          Length = 153

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + ++       +LKEY+I   +   G K E GD + PEG Y + +   
Sbjct: 17  LVKVDKSKRRMYLMEQGT-----ILKEYRIALGASPKGHKQEEGDNRTPEGEYTLDYVI- 70

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D    +      G ++ IHG                 + GC 
Sbjct: 71  -EDSAFYRSVHISYPDAIDTLEAKRRGVSPGGNIKIHGLKNGESQLPIYIQSFDWTNGCI 129

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V   
Sbjct: 130 AITNEEMDEFIQLVEMG 146


>gi|229510533|ref|ZP_04400013.1| hypothetical protein VCE_001941 [Vibrio cholerae B33]
 gi|229517335|ref|ZP_04406780.1| hypothetical protein VCC_001356 [Vibrio cholerae RC9]
 gi|229605146|ref|YP_002875850.1| hypothetical protein VCD_000084 [Vibrio cholerae MJ-1236]
 gi|255746022|ref|ZP_05419969.1| hypothetical protein VCH_002389 [Vibrio cholera CIRS 101]
 gi|262162139|ref|ZP_06031154.1| hypothetical protein VIG_003319 [Vibrio cholerae INDRE 91/1]
 gi|229345371|gb|EEO10344.1| hypothetical protein VCC_001356 [Vibrio cholerae RC9]
 gi|229352978|gb|EEO17918.1| hypothetical protein VCE_001941 [Vibrio cholerae B33]
 gi|229371632|gb|ACQ62054.1| hypothetical protein VCD_000084 [Vibrio cholerae MJ-1236]
 gi|255735776|gb|EET91174.1| hypothetical protein VCH_002389 [Vibrio cholera CIRS 101]
 gi|262028214|gb|EEY46872.1| hypothetical protein VIG_003319 [Vibrio cholerae INDRE 91/1]
          Length = 160

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 26/143 (18%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     ++++ K++  + + + N      +++EY+I       G K + GD++ PEG 
Sbjct: 16  NLSYAQVDLVKVDKSKRRMYLLQGN-----EIIREYRIALGKSPKGHKQQEGDQRTPEGH 70

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE------------- 146
           Y + +     +S ++ SI+I +PN  D    +      G D+ IHG              
Sbjct: 71  YLLDFII--EDSSFYRSIHISYPNTRDLQLAQLRGVNPGGDIKIHGLKNGDEREPGFVQS 128

Query: 147 -CASAGCYAMNNKQMQEIYAIVR 168
              + GC A+ N++M E  ++V+
Sbjct: 129 FDWTNGCIAITNQEMDEFLSLVQ 151


>gi|119383401|ref|YP_914457.1| ErfK/YbiS/YcfS/YnhG family protein [Paracoccus denitrificans
           PD1222]
 gi|119373168|gb|ABL68761.1| ErfK/YbiS/YcfS/YnhG family protein [Paracoccus denitrificans
           PD1222]
          Length = 209

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 63/154 (40%), Gaps = 25/154 (16%)

Query: 33  LSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           L         +       P   I + K+   + +++ +        + ++I       G 
Sbjct: 54  LPPIFQRPPVQPEAPIASPVRRILVEKSARRMTVYQESGPP-----RTFRIALGFSPEGD 108

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE 146
           K   GD + PEG + I    LN  S Y LS+ I +P +  +   R      G D+MIHG+
Sbjct: 109 KSREGDGRTPEGIFRIDR--LNRQSAYHLSLGIDYPQKHHREAARRLGLSPGGDIMIHGQ 166

Query: 147 C------------ASAGCYAMNNKQMQEIYAIVR 168
                         +AGC A++N +++EI+A  R
Sbjct: 167 PNQVPDGYRVKGDWTAGCIAVDNAEIEEIFAHAR 200


>gi|152982143|ref|YP_001352557.1| hypothetical protein mma_0867 [Janthinobacterium sp. Marseille]
 gi|151282220|gb|ABR90630.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 393

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 14/153 (9%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG 87
           K+     +  ++     +       V+ +    + L ++ + V+ ++ L  +Y I     
Sbjct: 104 KSLRERPDPDMVPRAILQMREDQKNVLLVDAKRSRLYVY-QRVNGQFKLTSDYYISQGRL 162

Query: 88  TFGPKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
               K + GD++ P G YYI         P      ++ I +PNE+DKA+ R+G+ + +H
Sbjct: 163 GV-NKFKEGDQKTPLGVYYITARLPGARLPEFYGPGALPINYPNEWDKANGRSGSGIWLH 221

Query: 145 GEC---------ASAGCYAMNNKQMQEIYAIVR 168
           G           +S GC  + N  ++E+ A V 
Sbjct: 222 GTPSDSYSRPPLSSDGCVVLTNPDLKELSASVE 254


>gi|269961393|ref|ZP_06175758.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833944|gb|EEZ88038.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 168

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + +        ++KEY+I   +   G K E GD + PEG Y + +   
Sbjct: 32  LVKVDKSKRRMYLMENG-----EVVKEYRIALGANPKGHKQEEGDNRTPEGDYTLDYVI- 85

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D+          G ++ IHG                 + GC 
Sbjct: 86  -NDSAFYRSVHISYPDAIDRLEAHRRGVSPGGEIKIHGLKNGETQSPQFIQSFDWTNGCI 144

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V+  
Sbjct: 145 AITNEEMDEFIKLVKMG 161


>gi|256830867|ref|YP_003159595.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256580043|gb|ACU91179.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 409

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/177 (22%), Positives = 63/177 (35%), Gaps = 24/177 (13%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  IL+ A    L            +  P  +   + M     +     V+R     
Sbjct: 1   MDTRTFILIAAFLSLLFAAPARPQSWTASLAPHPKAPPLFMAV-DMARQRAFVVR----- 54

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN---NLNPNSK 117
                   N D E   +K+   C      G K+  GD + PEG Y++       L+ +S 
Sbjct: 55  --------NKDGELKKMKDMS-CTTGMHGGGKLLEGDRKTPEGVYFLQGKATGGLDFDSF 105

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECAS------AGCYAMNNKQMQEIYAIVR 168
              +  + +PN  D+   +TG  +MIHG   S       GC  + N  +  +   VR
Sbjct: 106 GNTAFPLNYPNPVDRIQGKTGNGIMIHGRGRSFGPRQTLGCVVLENDDVDTLDRHVR 162


>gi|260769479|ref|ZP_05878412.1| hypothetical protein VFA_002537 [Vibrio furnissii CIP 102972]
 gi|260614817|gb|EEX40003.1| hypothetical protein VFA_002537 [Vibrio furnissii CIP 102972]
          Length = 159

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 26/135 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          +++E++I       G K + GD++ PEG YY+ +  +
Sbjct: 23  LVKVDKSKRRMYLIDDG-----HVIREFRIALGKAPKGHKQQEGDQRTPEGRYYLDF--I 75

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +PN  D+ H        G ++ IHG                 + GC 
Sbjct: 76  TEHSNFYRSMHISYPNLRDQRHAESLGVDPGGEIKIHGLKLDYQGRPEFIQSFDWTNGCI 135

Query: 154 AMNNKQMQEIYAIVR 168
           A+ N++M E   +V+
Sbjct: 136 AITNQEMDEFLRLVK 150


>gi|83951624|ref|ZP_00960356.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
 gi|83836630|gb|EAP75927.1| ErfK/YbiS/YcfS/YnhG family protein [Roseovarius nubinhibens ISM]
          Length = 185

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 68/182 (37%), Gaps = 32/182 (17%)

Query: 2   TNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN 61
             R   L   + + L G    RS        +S                  +I + K+E 
Sbjct: 8   RRRLIRLTALMLVVLIGVALWRS--------VSIAPPPPPAPLPPLTGTIDLIELDKSER 59

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS 121
            + +++         L+ Y++       G K   GD + PEG + I     N  S++ LS
Sbjct: 60  RMTVYREGEA-----LRSYEVALGFAPEGDKQIEGDGKTPEGEFRIDRR--NDQSQFHLS 112

Query: 122 INIGFPNEFDKAHNR-----TGADLMIHGEC------------ASAGCYAMNNKQMQEIY 164
           + I +P   D+A         G D+  HG+              +AGC A+ N +++E++
Sbjct: 113 LGINYPRAEDRARAAAQGVSPGGDIFFHGQPNKLPDILRRKGDWTAGCIALTNAEIEELW 172

Query: 165 AI 166
            +
Sbjct: 173 RV 174


>gi|254459078|ref|ZP_05072501.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
 gi|207084349|gb|EDZ61638.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
          Length = 322

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 81/206 (39%), Gaps = 30/206 (14%)

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTF-GPKIETGDEQAPEGFYYIGWNNLNPN 115
            K ++ L ++ ++ +  Y   KEY   A++G   G KI+ GD + P G Y I       N
Sbjct: 68  DKEKSTLNLYVKDNNNSYGFKKEY--SAYTGKIKGDKIKEGDLKTPIGIYQITKKLSTEN 125

Query: 116 S----KYFLSINIGFPNEFDKAHNRTGADLMIHGECA-------SAGCYAMNNKQMQEI- 163
                   L+    +PN +D    + G  + IHG          + GC A+NN  ++ + 
Sbjct: 126 KLDSFYGPLAFVTSYPNVYDTYRGKNGHGIWIHGLPTEQDRDEFTKGCIAINNPNIECLN 185

Query: 164 -------------YAIVRDSLRGNMQSHI--QIQAFPFRMTSKNMQLYQNNPNYSFWNML 208
                         + V+  +   + S I  Q+ ++ +     ++  Y N  +  F    
Sbjct: 186 KRIDIDNTLLIINSSEVKKGISKEILSSILAQLYSWRYSWLFDDIDRYLNFYSSDFVRFD 245

Query: 209 KLGHDYFEKNHQEPFIQIINKQYVFF 234
            +  D F+K     F +I  K  +F 
Sbjct: 246 GMNFDRFKKYKTRIFKKIEKKTIIFN 271


>gi|170727585|ref|YP_001761611.1| hypothetical protein Swoo_3246 [Shewanella woodyi ATCC 51908]
 gi|169812932|gb|ACA87516.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
          Length = 160

 Score =  128 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 64/134 (47%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K+E+ + +          ++KEY +   +   G K++ GDE+ PEG Y + +   
Sbjct: 24  LVKVDKSESKMYLLDSG-----QIVKEYDVAFGANPKGHKVQEGDEKTPEGTYTLDYK-- 76

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ +++I +PN+ D  +        G  +M+HG+                + GC 
Sbjct: 77  KEDSSFYRAMHISYPNKQDIENAAKRGVSPGGFIMVHGQRNWLGWFAPITQSFNWTNGCI 136

Query: 154 AMNNKQMQEIYAIV 167
           A++N +M E   +V
Sbjct: 137 ALSNSEMDEFMDLV 150


>gi|315182009|gb|ADT88922.1| hypothetical protein vfu_B00702 [Vibrio furnissii NCTC 11218]
          Length = 159

 Score =  128 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 26/135 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          +++E++I       G K + GD++ PEG YY+ +  +
Sbjct: 23  LVKVDKSKRRMYLIDDG-----HVIREFRIALGKSPKGHKQQEGDQRTPEGRYYLDF--I 75

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +PN  D+ H        G ++ IHG                 + GC 
Sbjct: 76  TEHSNFYRSMHISYPNLRDQRHAESLGVDPGGEIKIHGLKLDYQGRPEFIQSFDWTNGCI 135

Query: 154 AMNNKQMQEIYAIVR 168
           A+ N++M E   +V+
Sbjct: 136 AITNQEMDEFLRLVK 150


>gi|119897349|ref|YP_932562.1| hypothetical protein azo1058 [Azoarcus sp. BH72]
 gi|119669762|emb|CAL93675.1| conserved hypothetical secreted protein [Azoarcus sp. BH72]
          Length = 398

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 56/153 (36%), Gaps = 14/153 (9%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG 87
           +A        ++     +  P     + +      L ++ RN + +   + +Y       
Sbjct: 113 RAYRERPPTEVVPRYLMQMGPDQRYAVVVDTRRARLYVY-RNDNGKPRFVADYYASHGKA 171

Query: 88  TFGPKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
               K+  GD + P G Y++         P+     +  + +PN++DK   RTG  + +H
Sbjct: 172 GA-EKMREGDNRTPLGVYHVTSFIEPKRLPDFYGSGAFPLNYPNDWDKRLGRTGHGIWLH 230

Query: 145 GECA---------SAGCYAMNNKQMQEIYAIVR 168
           G  +         S GC  + N+    + + V 
Sbjct: 231 GTPSDTYSRPPKASEGCVVLTNQDFTSLSSYVE 263


>gi|239831254|ref|ZP_04679583.1| Hypothetical protein OINT_1000435 [Ochrobactrum intermedium LMG
           3301]
 gi|239823521|gb|EEQ95089.1| Hypothetical protein OINT_1000435 [Ochrobactrum intermedium LMG
           3301]
          Length = 224

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 76/190 (40%), Gaps = 37/190 (19%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +    +  + I L G     + I  AE PL+            S      IR+ K  
Sbjct: 45  MFKKTLFAVVLIAIALFGYTKVMARISLAEPPLAAP----------SEQQADAIRVEKAN 94

Query: 61  NILEIWKRNVDAEYVLLKEYKICAW-SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + +         +  Y+I    +G  G K   GDE+ PEG Y I W   NP S   
Sbjct: 95  RQMTLLRDGRT-----IGTYRISLGSNGDGGHKQREGDEKTPEGHYVIDWR--NPRSMAH 147

Query: 120 LSINIGFPNEFDKA-----HNRTGADLMIHGEC--------------ASAGCYAMNNKQM 160
           LS++I +PNE DK       +  G ++MIHG                 + GC A+ + +M
Sbjct: 148 LSLHISYPNENDKQAAAAAGHAPGGNIMIHGLPNGWGWLKSAHRLWDWTDGCIAVTDAEM 207

Query: 161 QEIYAIVRDS 170
           ++I+A V   
Sbjct: 208 RDIWARVPTG 217


>gi|329906069|ref|ZP_08274352.1| hypothetical protein IMCC9480_2761 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547344|gb|EGF32175.1| hypothetical protein IMCC9480_2761 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 416

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 62/148 (41%), Gaps = 16/148 (10%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG-PK 92
            +  ++     +          +    + L ++ +N   +  LL +Y I    G  G  K
Sbjct: 136 PDPELVPRALLKLRDDQRFAFVVDTKRSRLYVY-QNTRGQLKLLSDYYI--TQGKLGSNK 192

Query: 93  IETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA- 148
           +  GD++ P G YYI         P+     ++ I +PNE+D+   R+G+ + +HG  + 
Sbjct: 193 LTEGDQKTPVGVYYITGRLGRNRLPDFYGAGALPINYPNEWDRMKGRSGSGIWLHGTPST 252

Query: 149 --------SAGCYAMNNKQMQEIYAIVR 168
                   S GC  + N  +++++  V 
Sbjct: 253 SYSRPPLASDGCVVLTNPDLEKLFRSVE 280


>gi|134094136|ref|YP_001099211.1| hypothetical protein HEAR0900 [Herminiimonas arsenicoxydans]
 gi|133738039|emb|CAL61084.1| conserved hypothetical protein; putative exported protein
           [Herminiimonas arsenicoxydans]
          Length = 420

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 16/166 (9%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           LN       +  K+     +  +I     +       ++ +    + L +++R+ D +  
Sbjct: 118 LNNLRAEAIVRLKSLRERPDPNLIPRVFLQMRADQKKLLLVDAKRSRLYVYERSKD-QVK 176

Query: 76  LLKEYKICAWSGTFG-PKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFD 131
           L+ +Y +    G  G  K++ GD++ P G YYI         P      ++ I +PNE+D
Sbjct: 177 LVSDYYVS--QGKLGVDKLKEGDQKTPLGVYYITARLDGARLPEFYGPGALPINYPNEWD 234

Query: 132 KAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
           KA+ R G+ + +HG           +S GC  + N  ++E+ A V 
Sbjct: 235 KANGRGGSGIWLHGTPSDSYSRPPLSSDGCVVLTNPDLKELSASVE 280


>gi|149909260|ref|ZP_01897917.1| lipoprotein, putative [Moritella sp. PE36]
 gi|149807784|gb|EDM67730.1| lipoprotein, putative [Moritella sp. PE36]
          Length = 162

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 25/136 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + + K++  L +++ N      L+K Y+I       G K + GD++ PEG Y I +   
Sbjct: 27  YVLVKKSDRTLFLFRNN-----QLIKSYRISLGKNPIGAKTQRGDKKTPEGLYNIDFK-- 79

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC-------------ASAGCYA 154
           N  SKY LS++I +PN+ DK  +       G  + IHG                + GC A
Sbjct: 80  NRQSKYHLSLHITYPNKRDKERSFERNLNPGDSIYIHGLPNKNKNAGLLIGSDWTNGCIA 139

Query: 155 MNNKQMQEIYAIVRDS 170
           ++N  +++I   V D 
Sbjct: 140 VSNNAIRDIAKYVPDG 155


>gi|116255215|ref|YP_771048.1| hypothetical protein pRL110015 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259863|emb|CAK02957.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 165

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 67/159 (42%), Gaps = 32/159 (20%)

Query: 35  ENLIISMQKKRTSPFHPT-----VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG-T 88
             L+  +      P  P      +IR++K E  + + K +       +  Y+I       
Sbjct: 5   TKLMARIGAGSPPPDAPLEQQADLIRVYKAERRMILLKGDT-----PISTYRISLGQAAD 59

Query: 89  FGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMI 143
            GPK   GDE+ PEG Y I W   NP S   LS++I +P   D+ +        G ++MI
Sbjct: 60  EGPKQREGDEKTPEGRYEIDWR--NPKSMAHLSLHISYPGSDDRRNADAGGFPPGGNIMI 117

Query: 144 HGEC--------------ASAGCYAMNNKQMQEIYAIVR 168
           HG                 + GC A+ N +M++I+A V 
Sbjct: 118 HGLPNGWGLFGNAHQLWDWTDGCIAVTNSEMRDIWARVP 156


>gi|297537707|ref|YP_003673476.1| ErfK/YbiS/YcfS/YnhG family protein [Methylotenera sp. 301]
 gi|297257054|gb|ADI28899.1| ErfK/YbiS/YcfS/YnhG family protein [Methylotenera sp. 301]
          Length = 408

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 88/235 (37%), Gaps = 37/235 (15%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPT--VIRIFKNENILEIWKRNVDAEYVLLKEYKICAW 85
           + E  LS   +  +     +P      +I +  +++ L ++K N       + +Y +   
Sbjct: 121 RIERYLSNENLDKLPNLLLAPNDQQSHLIVVDTDKSRLYLYKNN-GGNLSYVADYYVTVG 179

Query: 86  SGTFGPKIETGDEQAPEGFYYIGWNNLNP--NSKYFLSINIGFPNEFDKAHNRTGADLMI 143
               G K   GD++ P G Y+       P  +     +  + +PNE+D  HNR+G+ + +
Sbjct: 180 KNGVG-KQTEGDKRTPIGVYFASQKLTKPLADMYGNGAYPLNYPNEWDMQHNRSGSGIWL 238

Query: 144 HGECA---------SAGCYAMNNKQMQEIYAIVRDSL----------------RGNMQSH 178
           HG  +         S GC  + N+ +  I  I++                       +  
Sbjct: 239 HGTPSNTYSRPPNASDGCVVLTNQDLNAIAPILQTGKTPVIIANHLKWIDADNTSADKDT 298

Query: 179 IQI--QAFPFRMTSKNMQLYQNNPNYSFWN---MLKLGHDY-FEKNHQEPFIQII 227
           +Q+   ++     S+N   Y ++ + +F       +   D+ F     +P + I 
Sbjct: 299 LQVAMNSWLSDWKSQNTPKYLSHYSRAFSTDGINFQQWSDHKFTVQASKPKVDIA 353


>gi|117619935|ref|YP_855158.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561342|gb|ABK38290.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 163

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 24/142 (16%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++ + K+   L + K   +     +K Y I       G K   GD++ PEG Y + +   
Sbjct: 29  MVVVKKSSYSLTLMKDGKE-----VKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKT 83

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE------------CASAGCYAM 155
           N  S Y+ +I+I +PN  D         R G  +MIHG+              + GC AM
Sbjct: 84  N--SNYYKAIHINYPNLDDIKAANEMGVRPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAM 141

Query: 156 NNKQMQEIYAIVRDSLRGNMQS 177
            NK + E++  +       +Q 
Sbjct: 142 LNKDLDEVWNAIEPGTPIVIQP 163


>gi|149188458|ref|ZP_01866751.1| hypothetical protein VSAK1_20724 [Vibrio shilonii AK1]
 gi|148837676|gb|EDL54620.1| hypothetical protein VSAK1_20724 [Vibrio shilonii AK1]
          Length = 167

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 62/134 (46%), Gaps = 26/134 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K+   + +   +      +++EY+I       G KI+ GD + PEG YY+ +    
Sbjct: 32  VEVKKSARRMYLMDGDT-----VIREYRIALGKNPRGHKIQEGDNRTPEGKYYLDFVM-- 84

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
            +S ++ S++I +PN  DK   +      G ++ IHG                 + GC A
Sbjct: 85  DDSAFYRSMHISYPNLRDKNRAKSLGVAPGGNIKIHGLKNNNTKPPQFVQSFDWTNGCIA 144

Query: 155 MNNKQMQEIYAIVR 168
           + N +M E+ ++V+
Sbjct: 145 ITNDEMDELVSLVK 158


>gi|323493533|ref|ZP_08098655.1| hypothetical protein VIBR0546_14470 [Vibrio brasiliensis LMG 20546]
 gi|323312356|gb|EGA65498.1| hypothetical protein VIBR0546_14470 [Vibrio brasiliensis LMG 20546]
          Length = 158

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 67/135 (49%), Gaps = 26/135 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +I++ K++  + + + N      ++KE++I       G KI  GD++ PEG Y++ +   
Sbjct: 22  LIKVDKSKRRMYLIENN-----EVVKEFRIALGKRPKGHKIHEGDQRTPEGRYFLDFVL- 75

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S+++ SI+I +PN  D A+        G ++ IHG                 + GC 
Sbjct: 76  -EDSEFYRSIHISYPNAQDMAYAMNRNLDPGGNIKIHGLKNGETRPANYVQSFDWTDGCI 134

Query: 154 AMNNKQMQEIYAIVR 168
           A++N++M ++  +V 
Sbjct: 135 AISNQEMDQLLQLVE 149


>gi|156977970|ref|YP_001448876.1| hypothetical protein VIBHAR_06766 [Vibrio harveyi ATCC BAA-1116]
 gi|156529564|gb|ABU74649.1| hypothetical protein VIBHAR_06766 [Vibrio harveyi ATCC BAA-1116]
          Length = 146

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 60/137 (43%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + +          ++KEY+I   +   G K E GD + PEG Y + +   
Sbjct: 10  LVKVDKSKRRMYLMDNG-----EVVKEYRIALGANPKGHKQEEGDNRTPEGDYTLVYVI- 63

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D+          G  + IHG                 + GC 
Sbjct: 64  -NDSAFYRSVHISYPDAIDRLEAHRRGVSPGGAIKIHGLKNGETQAPQFIQSFDWTNGCI 122

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V+  
Sbjct: 123 AITNEEMDEFIRLVKMG 139


>gi|330831248|ref|YP_004394200.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas veronii B565]
 gi|328806384|gb|AEB51583.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas veronii B565]
          Length = 141

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 24/129 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++ + K+   L + K   +     LK Y I       G K + GD++ PEG Y + +   
Sbjct: 7   LVVVKKSTYSLTLMKDGKE-----LKRYWIALGPAPKGHKQQEGDQRTPEGRYTLDYKKT 61

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE------------CASAGCYAM 155
           N  S Y+ +I+I +PN  D         R G  +MIHG+              + GC AM
Sbjct: 62  N--SGYYKAIHINYPNLDDIKRANELGVRPGGMIMIHGQRNSIGNRRVQPSNWTNGCIAM 119

Query: 156 NNKQMQEIY 164
            N ++ E++
Sbjct: 120 LNHELDEVW 128


>gi|222824134|ref|YP_002575708.1| hypothetical protein Cla_1135 [Campylobacter lari RM2100]
 gi|222539356|gb|ACM64457.1| conserved hypothetical protein [Campylobacter lari RM2100]
          Length = 323

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 98/272 (36%), Gaps = 42/272 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------SPF 49
            +  ++LF+L +F+N    ++  +++    + + L   + KK                  
Sbjct: 2   FKTILVLFSLVVFVNASDLAKIYLNQGIDAVEKVLEQELSKKDFWLDEIKDKNVSLGYYE 61

Query: 50  HPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
               I +  K++ I+ ++  N         +  +       G K   GD + P GFY +G
Sbjct: 62  ENVAIVLTNKSDKIIRVYHYNDGKVEKKFIQKDVLTGLA--GDKEIEGDLKTPIGFYELG 119

Query: 109 WNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNK 158
                 +  Y   +    +PN  DK   +TG  + IHG            + GC A+ N 
Sbjct: 120 KKFYPGDPYYGPFAFATTYPNVLDKTLGKTGGGIWIHGYPLDGTRLDTYKTRGCIAVQND 179

Query: 159 QMQEI---------YAIVRDSLR---GNMQSHI---QIQAFPFRMTSKNMQLYQNNPNYS 203
            +++          YA+  +  +    + +  I    + A+       ++  Y +  +  
Sbjct: 180 LLEDFNKLVADRKSYAMTEEKNKVRANHEEVAILLANLFAWKDSWQKSDISKYLSFYDQK 239

Query: 204 -FWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
            F +  K  ++ F KN Q  F +   K   F 
Sbjct: 240 IFKHNNKFSYEQFAKNKQRIFAKKEEKTIKFS 271


>gi|148978670|ref|ZP_01815073.1| hypothetical protein VSWAT3_16790 [Vibrionales bacterium SWAT-3]
 gi|145962208|gb|EDK27491.1| hypothetical protein VSWAT3_16790 [Vibrionales bacterium SWAT-3]
          Length = 242

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 65/163 (39%), Gaps = 31/163 (19%)

Query: 32  PLSENLIISMQKKRTSPFHPTV-----IRIFKNENILEIWKRNVDAEYVLLKEYKICAWS 86
           P +  L   M     S   P +     +++ K++  + + K +      +++E++I    
Sbjct: 80  PQASLLEPYMAPDSFSEIDPLLQVVTLVKVDKSKRRMYLLKGD-----EVVQEFRIALGK 134

Query: 87  GTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN-----RTGADL 141
              G K   GD + PEG Y + +      S+++ S++I +P   D+          G ++
Sbjct: 135 EPKGHKRFEGDNRTPEGEYTLDYIM--ERSEFYRSVHINYPRSSDRQWAEENDVDPGGNI 192

Query: 142 MIHGE--------------CASAGCYAMNNKQMQEIYAIVRDS 170
            IHG                 + GC A+ N+ M E   +V+  
Sbjct: 193 KIHGIKNGERRSPGFIQSFDWTDGCIALTNQDMDEFIQLVKMG 235


>gi|258624844|ref|ZP_05719772.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262173004|ref|ZP_06040681.1| hypothetical protein VII_000090 [Vibrio mimicus MB-451]
 gi|258582842|gb|EEW07663.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|261890362|gb|EEY36349.1| hypothetical protein VII_000090 [Vibrio mimicus MB-451]
          Length = 160

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 65/134 (48%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + + N      +++EY+I       G K + GD++ PEG Y++ +  +
Sbjct: 24  LVKVDKSKRRMYLLQGN-----EVIREYRIALGKSPKGHKQQEGDQRTPEGHYFLDF--V 76

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
              S ++ SI+I +PN+ D+ +        G D+ IHG                 + GC 
Sbjct: 77  TQESHFYRSIHISYPNQQDEQYAALLGVSPGGDIKIHGLKNGETADPAFIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIV 167
           A+ N +M E  ++V
Sbjct: 137 ALTNLEMDEFLSLV 150


>gi|258622323|ref|ZP_05717349.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258585647|gb|EEW10370.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 160

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 65/134 (48%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + + N      +++EY+I       G K + GD++ PEG Y++ +  +
Sbjct: 24  LVKVDKSKRRMYLLQGN-----EVIREYRIALGKSPKGHKQQEGDQRTPEGHYFLDF--V 76

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
              S ++ SI+I +PN+ D+ +        G D+ IHG                 + GC 
Sbjct: 77  TQESHFYRSIHISYPNQQDERYAALLGVSPGGDIKIHGLKNGETADPAFIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIV 167
           A+ N +M E  ++V
Sbjct: 137 ALTNLEMDEFLSLV 150


>gi|86137252|ref|ZP_01055830.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. MED193]
 gi|85826576|gb|EAQ46773.1| ErfK/YbiS/YcfS/YnhG family protein [Roseobacter sp. MED193]
          Length = 178

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 24/132 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I I K++  L   ++        + +Y I       G K   GD + PEG + I     
Sbjct: 44  YILIEKSKRRLSAHRKGQQ-----VLQYSIALGFAPIGDKSREGDGKTPEGLFKINRR-- 96

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC------------ASAGCYAM 155
           N NS + LS+ I +P   D A         G D+ IHG+              +AGC A+
Sbjct: 97  NSNSSFHLSLGIDYPRPEDIARAEALGLNPGGDIFIHGQPNRLGNHLMLPGDWTAGCIAI 156

Query: 156 NNKQMQEIYAIV 167
           +N +M  ++ + 
Sbjct: 157 SNSEMVALWRLA 168


>gi|218676977|ref|YP_002395796.1| hypothetical protein VS_II1218 [Vibrio splendidus LGP32]
 gi|218325245|emb|CAV27216.1| conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 257

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 64/171 (37%), Gaps = 26/171 (15%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
              S     ++    S  L     +  +     T++++ K++  + + K +      +++
Sbjct: 87  SQGSSKRPPQSSSQQSYTLTGPSSEADSLSQVVTLVKVDKSKRRMYLLKGD-----EVIQ 141

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN--- 135
           E++I       G K   GD + PEG Y + +      S +  S++I +P   D       
Sbjct: 142 EFRIALGKQPKGHKRFEGDNRTPEGEYQLDYVM--EESDFHRSVHISYPQPSDMQWAEEN 199

Query: 136 --RTGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVRDS 170
               G ++ IHG                 + GC A+ N+ M E   +V+  
Sbjct: 200 DVDPGGNIKIHGIKNGERRSPSFIQSFDWTDGCIALTNQDMDEFLQLVKMG 250


>gi|86145077|ref|ZP_01063409.1| uncharacterized protein conserved in bacteria [Vibrio sp. MED222]
 gi|85837976|gb|EAQ56088.1| uncharacterized protein conserved in bacteria [Vibrio sp. MED222]
          Length = 257

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 64/171 (37%), Gaps = 26/171 (15%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
              S     ++    S  L     +  +     T++++ K++  + + K +      +++
Sbjct: 87  SQGSSKRPPQSSSQQSYTLTGPSSEADSLSQVVTLVKVDKSKRRMYLLKGD-----EVIQ 141

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN--- 135
           E++I       G K   GD + PEG Y + +      S +  S++I +P   D       
Sbjct: 142 EFRIALGKQPKGHKRFEGDNRTPEGEYQLDYVM--EESDFHRSVHISYPQPSDMQWAEEN 199

Query: 136 --RTGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVRDS 170
               G ++ IHG                 + GC A+ N+ M E   +V+  
Sbjct: 200 DVDPGGNIKIHGIKNGERRSPSFIQSFDWTDGCIALTNQDMDEFLQLVKMG 250


>gi|42522629|ref|NP_968009.1| hypothetical protein Bd1075 [Bdellovibrio bacteriovorus HD100]
 gi|39575161|emb|CAE79002.1| Uncharacterized conserved [Bdellovibrio bacteriovorus HD100]
          Length = 332

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/267 (19%), Positives = 100/267 (37%), Gaps = 50/267 (18%)

Query: 3   NRYNI---LLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59
            R  +    LFAL + +     + +   + E  L    ++ + +  T  F   VI + K 
Sbjct: 1   MRLLLTGCALFALSLPVLA-GPAVTPSSQIETDLLPASLLQISE--TEAFSRYVILVDKE 57

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN---- 115
           +  L +++RN   +   + EY         G K +  D + PEG Y++      P     
Sbjct: 58  QRKLSVFERN-GEQIQKITEYPADIGKMG-GNKTKRDDHKTPEGIYFLQERLSQPKIPFS 115

Query: 116 SKYFLSINIGFPNEFDKAHNRTGADLMIHGECASA-------GCYAMNNKQMQE------ 162
               L+    +PN FDK  N+TG+ + +H    S        GC  + N  +++      
Sbjct: 116 LYGALAFTTNYPNLFDKRENKTGSGIWLHAIPDSVPLTRGSRGCVVVRNDVIKKLADYIK 175

Query: 163 -------IYAIVRDSLRGNMQSHIQ-----IQAFPFRMTSKNMQLYQNNPNYSF------ 204
                  I+  V    +       Q     ++++     +++++ YQ   +  F      
Sbjct: 176 LGETPILIFDHVNYVSKSEHDKRRQDLSRFVESWRQAWENQDIEKYQTFYDEGFKAPGFN 235

Query: 205 ---W----NMLKLGHDYFEKNHQEPFI 224
              W      LK  ++Y + +  +P+I
Sbjct: 236 YKSWMSHKKNLKSKYEYIKVHLSQPYI 262


>gi|119477590|ref|ZP_01617740.1| hypothetical protein GP2143_09015 [marine gamma proteobacterium
           HTCC2143]
 gi|119449093|gb|EAW30333.1| hypothetical protein GP2143_09015 [marine gamma proteobacterium
           HTCC2143]
          Length = 163

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/143 (27%), Positives = 57/143 (39%), Gaps = 26/143 (18%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + + K E  L + K       V   E+ I       G K E GDE+ PEG Y + +   N
Sbjct: 28  VLVAKAEKKLYLIKDG-----VPFLEFPIALSPKPRGHKREQGDERTPEGRYILDFK--N 80

Query: 114 PNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGEC--------------ASAGCYA 154
            +S ++ SI I +PN+ D           G  +MIHG                 + GC A
Sbjct: 81  QDSDFYKSIRISYPNQQDLHRAELNGVDPGGAIMIHGMPNESSLPASLIQQFNWTDGCIA 140

Query: 155 MNNKQMQEIYAIVRDSLRGNMQS 177
           + N  M EI+A V       +Q 
Sbjct: 141 VTNGAMDEIWAAVETGTPIEIQP 163


>gi|190895329|ref|YP_001985621.1| hypothetical protein RHECIAT_PA0000012 [Rhizobium etli CIAT 652]
 gi|190699274|gb|ACE93358.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 173

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 64/137 (46%), Gaps = 27/137 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNN 111
           +IR++K+E  + + K +       +  Y+I   SG   GPK   GDE+ PEG Y I W  
Sbjct: 36  LIRVYKSERRMVLLKGD-----APIAAYEISLGSGANAGPKQREGDEKTPEGRYEIDWR- 89

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGC 152
            N  S   LS++I +P   ++          G ++MIHG                 + GC
Sbjct: 90  -NAKSTEHLSLHISYPKPEEQRAAEVNGFPAGGNIMIHGLPNGWGLLGKAHRLWDWTDGC 148

Query: 153 YAMNNKQMQEIYAIVRD 169
            A+ N +M++I+A V D
Sbjct: 149 IAVTNAEMRDIWARVPD 165


>gi|163803216|ref|ZP_02197097.1| hypothetical protein 1103602000599_AND4_11960 [Vibrio sp. AND4]
 gi|159172971|gb|EDP57807.1| hypothetical protein AND4_11960 [Vibrio sp. AND4]
          Length = 160

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + +        ++KE++I   S   G K E GD + PEG Y + +   
Sbjct: 24  LVKVDKSKRRMYLIENG-----EVVKEFRIALGSNPKGHKQEEGDNRTPEGDYTLNYVI- 77

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             NS ++ S++I +P+  D+   +      G  + IHG                 + GC 
Sbjct: 78  -NNSAFYRSVHISYPDAIDRLEAQRRGVSPGGAIKIHGLKNGETQAPQFIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N++M E   +V+  
Sbjct: 137 AITNQEMDEFIRLVQMG 153


>gi|82703004|ref|YP_412570.1| ErfK/YbiS/YcfS/YnhG [Nitrosospira multiformis ATCC 25196]
 gi|82411069|gb|ABB75178.1| ErfK/YbiS/YcfS/YnhG [Nitrosospira multiformis ATCC 25196]
          Length = 413

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/203 (19%), Positives = 72/203 (35%), Gaps = 28/203 (13%)

Query: 21  HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY 80
            +R+ + +   P+  ++       +  P     I      + L ++K NVD     L +Y
Sbjct: 120 EARARLQRHLAPIPLDMT-PKYLLQMPPEQKYAIIADTGRSRLYLYK-NVDGSPRYLADY 177

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIG---WNNLNPNSKYFLSINIGFPNEFDKAHNRT 137
            I         K++ GD++ P G Y++          +    ++  I +PNE+DK H R+
Sbjct: 178 YISTGKNGS-QKLKEGDKKTPIGVYFVTDNLPRQRLSDFYGGMAFPINYPNEWDKRHGRS 236

Query: 138 GADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRM 188
           G  + +HG           AS GC  + N  +         +L   +Q  I       +M
Sbjct: 237 GYGIWLHGTPPDTYSRPPRASDGCVVLANDDLN--------ALASTLQVGITSVIISDQM 288

Query: 189 T-----SKNMQLYQNNPNYSFWN 206
                        +   +   W 
Sbjct: 289 EWVKPHDAAALRRKLAQHLERWR 311


>gi|145297687|ref|YP_001140528.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850459|gb|ABO88780.1| ErfK/YbiS/YcfS/YnhG family protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 173

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 57/142 (40%), Gaps = 24/142 (16%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +I + K+   L + K   +     +K Y I       G K   GD++ PEG Y + +   
Sbjct: 39  MIVVKKSSYSLTLMKDGKE-----VKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKT 93

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE------------CASAGCYAM 155
           N  S Y+ +I+I +PN  D           G  +MIHG+              + GC AM
Sbjct: 94  N--SNYYKAIHINYPNLDDIKTANEMGVNPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAM 151

Query: 156 NNKQMQEIYAIVRDSLRGNMQS 177
            N  + E++  +       +Q 
Sbjct: 152 LNHDLDEVWNAIEPGTPIIIQP 173


>gi|39995292|ref|NP_951243.1| putative lipoprotein [Geobacter sulfurreducens PCA]
 gi|39982054|gb|AAR33516.1| lipoprotein, putative [Geobacter sulfurreducens PCA]
 gi|307634660|gb|ADI83018.2| peptidoglycan L,D-transpeptidase lipoprotein, YkuD family, TPR
           domain-containing [Geobacter sulfurreducens KN400]
          Length = 309

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 51/123 (41%), Gaps = 26/123 (21%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K +  L +          +++ YK+       GPK   GD + PEG Y I     N
Sbjct: 174 ILIEKKDRRLSLLSMG-----EVIRTYKVALGGNPVGPKERQGDNKTPEGSYVIEGR--N 226

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------------ECASAGCYA 154
             S+Y LS+ I +PNE DK   R      G D+MIHG                 + GC A
Sbjct: 227 KGSRYHLSLRISYPNEKDKKRAREMGVSPGGDIMIHGIKNGLSQVGAAHAEVDWTQGCIA 286

Query: 155 MNN 157
           + +
Sbjct: 287 VTD 289


>gi|90022704|ref|YP_528531.1| hypothetical protein Sde_3062 [Saccharophagus degradans 2-40]
 gi|89952304|gb|ABD82319.1| ErfK/YbiS/YcfS/YnhG family protein [Saccharophagus degradans 2-40]
          Length = 158

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 58/129 (44%), Gaps = 26/129 (20%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  L + K        ++K+Y +   +   G K + GDE+ PEG Y + +   
Sbjct: 22  LVKVVKSKGALYLMKGET-----VVKQYAVVFGANPKGHKQQEGDERTPEGVYSLDYK-- 74

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ +++I +PN  D    +      G  +M+HG+                + GC 
Sbjct: 75  KEDSAFYRAMHISYPNAEDVRKAKARGVSAGGFIMVHGQRNGLGWLAFVMQNFNWTNGCI 134

Query: 154 AMNNKQMQE 162
           A+ N  M E
Sbjct: 135 ALTNSDMDE 143


>gi|323144996|ref|ZP_08079556.1| ErfK/YbiS/YcfS/YnhG family protein [Succinatimonas hippei YIT
           12066]
 gi|322415275|gb|EFY06049.1| ErfK/YbiS/YcfS/YnhG family protein [Succinatimonas hippei YIT
           12066]
          Length = 212

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 75/200 (37%), Gaps = 46/200 (23%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSP-------FHPTV------ 53
             LFA+  F++ C     +   ++          +  +             P        
Sbjct: 10  FFLFAVGFFVSSCSTYTKIDRSSDLYYEALTEPVIYDRDYDYVNLGRFANLPIYPKGYRG 69

Query: 54  -------IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                  + + K  + + + K++      +++ Y I       G K   GD++ PEG Y 
Sbjct: 70  PKKLIDHVIVNKANHQMFLMKKD-----KVIRSYWIALSDKPVGDKQYEGDKRTPEGTYT 124

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFD-----KAHNRTGADLMIHGEC-------------- 147
           + +  +N NS Y+ S +I +PN+ D     K   R G  +MIHG+               
Sbjct: 125 LDY--INYNSNYYKSFHISYPNDQDIEEAKKLGKRPGGMIMIHGQPYNSSEYHATVQRSD 182

Query: 148 ASAGCYAMNNKQMQEIYAIV 167
            + GC A+ N +M E  ++V
Sbjct: 183 WTDGCIAILNPEMDEFISLV 202


>gi|242280688|ref|YP_002992817.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio salexigens DSM
           2638]
 gi|242123582|gb|ACS81278.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio salexigens DSM
           2638]
          Length = 424

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 56/170 (32%), Gaps = 22/170 (12%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +Y   +F   I L     S +     E  +    ++             ++ + K  
Sbjct: 1   MGMKYFFRVFTAAILLLAGLTSLAFAKGWEPVIDPTPLV----------PDYILAVDKES 50

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN---NLNPNSK 117
             L +              +  CA     G K+  GD + PEG Y+         N    
Sbjct: 51  QKLHLLVHKS--PLHAEASFT-CATGQVAGDKVVEGDLKTPEGIYFTTGKRTGLKNYTLY 107

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQMQ 161
             ++  + FPN  D+   +TG  + IHG         + GC A+ N  M 
Sbjct: 108 GKMAFPLNFPNPVDRIKGKTGYGIWIHGRGKELVPMDTQGCVALVNSDMD 157


>gi|260362135|ref|ZP_05775130.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus K5030]
 gi|260896320|ref|ZP_05904816.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308094839|ref|ZP_05892934.2| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308126143|ref|ZP_05908130.2| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus AQ4037]
 gi|308085138|gb|EFO34833.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308091743|gb|EFO41438.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308110411|gb|EFO47951.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus AQ4037]
 gi|308114649|gb|EFO52189.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus K5030]
 gi|328469985|gb|EGF40896.1| hypothetical protein VP10329_04277 [Vibrio parahaemolyticus 10329]
          Length = 160

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + +  +     +LKEY+I   +   G K E GD + PEG Y + +   
Sbjct: 24  LVKVDKSKRRMYLIEDGI-----ILKEYRIALGASPKGHKQEEGDNRTPEGSYTLDYVI- 77

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D           G ++ IHG                 + GC 
Sbjct: 78  -EDSAFYRSVHISYPDAIDTLEAHRRGVSPGGNIKIHGLKNGETQDPSFIQSFDWTNGCI 136

Query: 154 AMNNKQMQEIYAIV 167
           A+ N++M E   +V
Sbjct: 137 ALTNEEMDEFIQLV 150


>gi|153838809|ref|ZP_01991476.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus AQ3810]
 gi|149747789|gb|EDM58683.1| ErfK/YbiS/YcfS/YnhG family protein [Vibrio parahaemolyticus AQ3810]
          Length = 148

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + +  +     +LKEY+I   +   G K E GD + PEG Y + +   
Sbjct: 12  LVKVDKSKRRMYLIEDGI-----ILKEYRIALGASPKGHKQEEGDNRTPEGSYTLDYVI- 65

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D           G ++ IHG                 + GC 
Sbjct: 66  -EDSAFYRSVHISYPDAIDTLEAHRRGVSPGGNIKIHGLKNGETQDPSFIQSFDWTNGCI 124

Query: 154 AMNNKQMQEIYAIV 167
           A+ N++M E   +V
Sbjct: 125 ALTNEEMDEFIQLV 138


>gi|28900000|ref|NP_799655.1| hypothetical protein VPA0145 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808283|dbj|BAC61488.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 165

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + +  +     +LKEY+I   +   G K E GD + PEG Y + +   
Sbjct: 29  LVKVDKSKRRMYLIEDGI-----ILKEYRIALGASPKGHKQEEGDNRTPEGSYTLDYVI- 82

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S ++ S++I +P+  D           G ++ IHG                 + GC 
Sbjct: 83  -EDSAFYRSVHISYPDAIDTLEAHRRGVSPGGNIKIHGLKNGETQDPSFIQSFDWTNGCI 141

Query: 154 AMNNKQMQEIYAIV 167
           A+ N++M E   +V
Sbjct: 142 ALTNEEMDEFIQLV 155


>gi|305432036|ref|ZP_07401203.1| conserved hypothetical secreted protein [Campylobacter coli JV20]
 gi|304445120|gb|EFM37766.1| conserved hypothetical secreted protein [Campylobacter coli JV20]
          Length = 325

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 89/274 (32%), Gaps = 42/274 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  +     F     L      +  +++    +   +   +  K                
Sbjct: 1   MLKKILAFYFICISALGASDLVKIYLNQGLDAVGVAIEKELTNKDFWLDEIGDRNISLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++  +        ++  I   +G  G K   GD + P GFY 
Sbjct: 61  YNDDVAIVLTNKTDKILRVYSYSDGKIKQDFEQKAI--ITGLMGDKQVEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGTRLDEFKTRGCIALF 178

Query: 157 NKQMQE---------IYAIVRDSLRGNMQSH------IQIQAFPFRMTSKNMQLYQNNP- 200
           N+ ++E         ++A+  +  +   +          + A+    T  ++  Y N   
Sbjct: 179 NENLEEFAKVVQDKKVFAMTEEKEKVRAKKEDIAALLADLFAWKLAWTDSDINTYLNFYD 238

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
              F    K+  + F    +  F +  +K+  F 
Sbjct: 239 EKQFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|57504965|ref|ZP_00370917.1| conserved hypothetical secreted protein [Campylobacter coli RM2228]
 gi|57019237|gb|EAL55943.1| conserved hypothetical secreted protein [Campylobacter coli RM2228]
          Length = 325

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 89/274 (32%), Gaps = 42/274 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  +     F     L      +  +++    +   +   +  K                
Sbjct: 1   MLKKILAFYFICISALGASDLVKIYLNQGLDAVGVAIEKELTNKDFWLDEIGDRNISLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++  +        ++  I   +G  G K   GD + P GFY 
Sbjct: 61  YDDDVAIVLTNKTDKILRVYSYSDGKIKQDFEQKAI--ITGLMGDKQVEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGTRLDEFKTRGCIALF 178

Query: 157 NKQMQE---------IYAIVRDSLRGNMQSH------IQIQAFPFRMTSKNMQLYQNNP- 200
           N+ ++E         ++A+  +  +   +          + A+    T  ++  Y N   
Sbjct: 179 NENLEEFAKVVQDKKVFAMTEEKEKVRAKKEDIAALLADLFAWKLAWTDSDINTYLNFYD 238

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
              F    K+  + F    +  F +  +K+  F 
Sbjct: 239 EKQFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|126664087|ref|ZP_01735081.1| protein ERFK [Flavobacteria bacterium BAL38]
 gi|126624036|gb|EAZ94730.1| protein ERFK [Flavobacteria bacterium BAL38]
          Length = 170

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 26/134 (19%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + ++K+++ L  + +       L+K Y I       G K   GD++ PEG Y I  ++ 
Sbjct: 34  AMIVYKSKHQLLAFSKG-----KLIKTYTISLGRNPVGAKEYEGDQKTPEGTYSI--HDK 86

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHG--------------ECASAGCY 153
           NPNS +  ++ I +PN+ D A  +      G ++ IHG              +  + GC 
Sbjct: 87  NPNSGWHKNLGISYPNQNDMAKAKRLGKPAGGNIKIHGLKNGKGYIGKFHRWQDWTLGCI 146

Query: 154 AMNNKQMQEIYAIV 167
           A+ N ++ E+YA V
Sbjct: 147 AVTNAEIDELYAAV 160


>gi|84393864|ref|ZP_00992608.1| uncharacterized protein conserved in bacteria [Vibrio splendidus
           12B01]
 gi|84375511|gb|EAP92414.1| uncharacterized protein conserved in bacteria [Vibrio splendidus
           12B01]
          Length = 259

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 56/137 (40%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  + + K        +++E++I       G K   GD + PEG Y + +   
Sbjct: 123 LVKVDKSKRRMYLLKGE-----EVVQEFRIALGKQPKGHKRFEGDNRTPEGKYQLDYVM- 176

Query: 113 NPNSKYFLSINIGFPNEFDKAHN-----RTGADLMIHGE--------------CASAGCY 153
              S ++ S++I +P   D           G ++ IHG                 + GC 
Sbjct: 177 -EESDFYRSVHINYPQSSDMQWAQKNDVDPGGNIKIHGIKNGERRSPSFIQSFDWTDGCI 235

Query: 154 AMNNKQMQEIYAIVRDS 170
           A+ N+ M E   +V+  
Sbjct: 236 ALTNQDMDEFIQLVKMG 252


>gi|42523254|ref|NP_968634.1| hypothetical protein Bd1763 [Bdellovibrio bacteriovorus HD100]
 gi|39575459|emb|CAE79627.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 209

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 53/133 (39%), Gaps = 27/133 (20%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + + K   +L + +        +L  Y +       G K   GD++ PEG Y+      
Sbjct: 72  FVLVDKKRRMLHVMRHG-----QVLATYAVALGGNPQGHKKNEGDQRTPEGRYFFD--LK 124

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR------TGADLMIHGEC--------------ASAGC 152
              S+Y L + I +PN  D A  +       G  ++IHG                 + GC
Sbjct: 125 KAKSEYHLGLRINYPNARDLAEAKKNGIKNPGDSILIHGLPNSWVKRKVIRHPRDWTKGC 184

Query: 153 YAMNNKQMQEIYA 165
            A+ N +++EIYA
Sbjct: 185 MAVRNYEIEEIYA 197


>gi|268679011|ref|YP_003303442.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617042|gb|ACZ11407.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfurospirillum deleyianum DSM
           6946]
          Length = 365

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 75/207 (36%), Gaps = 30/207 (14%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +I   K     E+++ + D    L+K + +       G KI+ GD + P G Y I     
Sbjct: 110 LIVCEKERKRCEVYRNSEDEGLELIKGHDVIMGKN--GDKIKRGDLKTPVGVYEITKRFK 167

Query: 113 NPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQ-- 161
             +  Y  L+ ++ +PN FD    + G+ + IHG           S GC  M N  +Q  
Sbjct: 168 PSDPFYGPLAFSLSYPNLFDVLRGKNGSGIWIHGMPLDGKDREDLSKGCVVMENDAIQVL 227

Query: 162 --EIYAIVRDSLRGNMQSHIQ-------------IQAFPFRMTSKNMQLYQNNPNYSFWN 206
             EI      ++    ++ +              +  +       ++ +Y N  +  F  
Sbjct: 228 DTEI--NANKTMTIIGENKVPPMSKEVVATLLSEVYKWQRAWKVNDINMYLNYYSNDFKK 285

Query: 207 MLKLGHDYFEKNHQEPFIQIINKQYVF 233
           +     + F    ++ F +   K   F
Sbjct: 286 VDGSRKEQFAAMKKQIFSRKEKKTITF 312


>gi|253995882|ref|YP_003047946.1| ErfK/YbiS/YcfS/YnhG family protein [Methylotenera mobilis JLW8]
 gi|253982561|gb|ACT47419.1| ErfK/YbiS/YcfS/YnhG family protein [Methylotenera mobilis JLW8]
          Length = 417

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 62/149 (41%), Gaps = 15/149 (10%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPT--VIRIFKNENILEIWKRNVDAEYVLLKEYKICAW 85
           + E  L++           +P      ++ I  +++ L ++    D +   + +Y I   
Sbjct: 129 RIERYLAKQSQAKQPNLILAPNAQQTHLMLIDTSKSRLYLY-EKHDNQLKYVADYYITVG 187

Query: 86  SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGADLMI 143
                 K   GD++ P G Y+           ++   +  + +PNE+DKAHNR G+ + +
Sbjct: 188 KNGV-EKQSEGDKRTPIGVYFASTKLKQQLPDFYGEGAYPLSYPNEWDKAHNRNGSGIWL 246

Query: 144 HGECA---------SAGCYAMNNKQMQEI 163
           HG  +         S GC  + N+ ++ +
Sbjct: 247 HGTPSSTYSRPPRASDGCVVVANQDLKAL 275


>gi|237807104|ref|YP_002891544.1| ErfK/YbiS/YcfS/YnhG family protein [Tolumonas auensis DSM 9187]
 gi|237499365|gb|ACQ91958.1| ErfK/YbiS/YcfS/YnhG family protein [Tolumonas auensis DSM 9187]
          Length = 162

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 64/154 (41%), Gaps = 26/154 (16%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           L   L++      T      ++ + K++  L ++ +      V LK Y +       GPK
Sbjct: 6   LISGLLLGFSVNATIMPKADLVVVKKSQYSLTLYSKG-----VPLKRYWVALGPNPRGPK 60

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE- 146
           I  GD + PEG Y + +  +  +S Y+ + +I +P+  D    +      G  +++HG+ 
Sbjct: 61  IREGDNKTPEGRYLLDYRKM--DSNYYKAFHISYPSLNDMKRAQHLGVEPGGQILLHGQR 118

Query: 147 -------------CASAGCYAMNNKQMQEIYAIV 167
                          + GC A+ N  M E++  V
Sbjct: 119 KGSVMSDETLQRSNWTNGCIALINADMDELWESV 152


>gi|91774853|ref|YP_544609.1| ErfK/YbiS/YcfS/YnhG [Methylobacillus flagellatus KT]
 gi|91708840|gb|ABE48768.1| ErfK/YbiS/YcfS/YnhG [Methylobacillus flagellatus KT]
          Length = 404

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 55/136 (40%), Gaps = 13/136 (9%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            SP     + +   ++ L ++ +N D++   L +Y I         K   GD++ P G Y
Sbjct: 137 MSPEQRYAVVVDTTKSRLYVY-QNRDSQLHHLVDYYITMGKNGS-EKFTEGDKRTPLGIY 194

Query: 106 YIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYA 154
                  +    ++   +  + +PN  DK H + G  + +HG           AS GC  
Sbjct: 195 IADKKLEHKLPDFYGEAAYPLNYPNPLDKRHGKKGHGIWLHGTPQDVYSRPPKASDGCVV 254

Query: 155 MNNKQMQEIYAIVRDS 170
           + N  ++ +  +++  
Sbjct: 255 IANPDIKALAPVLQQG 270


>gi|163852564|ref|YP_001640607.1| hypothetical protein Mext_3148 [Methylobacterium extorquens PA1]
 gi|163664169|gb|ABY31536.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 182

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 62/186 (33%), Gaps = 33/186 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  I      + + G                  L+   ++          + + K  
Sbjct: 1   MGRRGRIAAVIGGLAVLGAGAVVLADFSQVGRTEPPLVAQAERAD-------RVLVEKAA 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L + +        +L  Y I       G K   GD + PEG Y   +   NP S   L
Sbjct: 54  RRLTLLREG-----RVLATYPISLGFAPEGHKAREGDGRTPEGVYTTAFR--NPRSVAHL 106

Query: 121 SINIGFPNEFDKAH----NR-TGADLMIHG--------------ECASAGCYAMNNKQMQ 161
           S+ + +P+  D A         G D+MIHG              +  + GC  + N +M+
Sbjct: 107 SLKVSYPSPADAAAVQAGGYSPGGDIMIHGLMNGFSWLGRLHRLKDWTQGCVGVTNAEMR 166

Query: 162 EIYAIV 167
            IYA V
Sbjct: 167 AIYARV 172


>gi|307720793|ref|YP_003891933.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfurimonas autotrophica DSM
           16294]
 gi|306978886|gb|ADN08921.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfurimonas autotrophica DSM
           16294]
          Length = 330

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/207 (22%), Positives = 82/207 (39%), Gaps = 28/207 (13%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTF-GPKIETGDEQAPEGFYYIGWNNL 112
           +   K+++ L I+ ++ +  Y L KEY   A++G   G K + GD + P G Y I     
Sbjct: 76  LLCDKSKSELLIYSKDSNNTYKLRKEY--SAFTGKLKGDKRKEGDLKTPIGVYDIIKKIS 133

Query: 113 NPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGECA-------SAGCYAMNNKQMQ--- 161
             +S Y  ++    +PN +D+   +TG  + IHG          + GC A+NNK ++   
Sbjct: 134 KVDSFYGPMAFVTSYPNLYDRYEGKTGQGIWIHGLPTNQERDAFTKGCIAINNKSIECMN 193

Query: 162 ---EIYAIV----RDSLRGN-------MQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNM 207
              +I   V     ++            Q    + A+ +       + Y N     F   
Sbjct: 194 RNIDIKKTVLIIKENANDSTTPSKKTLSQLLSTLYAWRYAWLYNETENYLNFYAPEFKRY 253

Query: 208 LKLGHDYFEKNHQEPFIQIINKQYVFF 234
             +    F+K     F +  +K  +F 
Sbjct: 254 DGMDFKRFKKYKTRIFAKYESKTILFR 280


>gi|218510701|ref|ZP_03508579.1| hypothetical protein RetlB5_26713 [Rhizobium etli Brasil 5]
          Length = 164

 Score =  118 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 65/176 (36%), Gaps = 38/176 (21%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +  +L  A             +   +  P++     +            +IR++K+E
Sbjct: 1   MRTKIIVLAVATSSLFVYTKVMARIGSGSPPPVAPMEQRA-----------DLIRVYKSE 49

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
             + + + +       +  Y+I        GPK   GDE+ PEG Y I W   NP S   
Sbjct: 50  RRMVLLRGD-----APIATYQISLGGAADAGPKQREGDEKTPEGLYEIDWR--NPKSMAH 102

Query: 120 LSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMN 156
           LS++I +PN  ++          G  +MIHG                 + GC A++
Sbjct: 103 LSLHISYPNPKEQRAAEANGFPPGGSIMIHGLPNGWGLLGQAHRLWDWTDGCIAVS 158


>gi|319795776|ref|YP_004157416.1| erfk/ybis/ycfs/ynhg family protein [Variovorax paradoxus EPS]
 gi|315598239|gb|ADU39305.1| ErfK/YbiS/YcfS/YnhG family protein [Variovorax paradoxus EPS]
          Length = 508

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 57/158 (36%), Gaps = 14/158 (8%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
                +A         +  Q    S      I +  + + L +   N D    L+ +Y I
Sbjct: 219 SRRRLQALRERPPVGTVPSQFLSLSTRSRYAIAVDASRSRLYL-LENSDKGLKLVADYYI 277

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP---NSKYFLSINIGFPNEFDKAHNRTGA 139
                    K+  GD + P G YYI          +     ++ I +PN +D    RTG+
Sbjct: 278 SVGKSGT-DKLAEGDARTPLGVYYITSRLDPKSLKDFYGAGALPINYPNPYDVRRGRTGS 336

Query: 140 DLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
            + +HG           AS GC  M N  ++++   V+
Sbjct: 337 GIWLHGTPPQQFARAPLASDGCVVMANPDLKQLLRKVQ 374


>gi|157415163|ref|YP_001482419.1| hypothetical protein C8J_0843 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|157386127|gb|ABV52442.1| hypothetical protein C8J_0843 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307747806|gb|ADN91076.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315932612|gb|EFV11543.1| hypothetical protein CSU_0096 [Campylobacter jejuni subsp. jejuni
           327]
          Length = 325

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 90/274 (32%), Gaps = 42/274 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  R  +L+    + L      +  +++    +   +   + +K                
Sbjct: 1   MLKRLALLITLSSLMLYASDLVKIYLNQGLDAVGVAIEKELTQKDFWLSEIGDKNISLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++           ++ +I   +G  G K   GD + P GFY 
Sbjct: 61  YDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIALF 178

Query: 157 NKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNPN 201
           N  +++   +V+D        +                 +  +    T+ +   Y +  +
Sbjct: 179 NNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFYD 238

Query: 202 Y-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
              F    K+  + F    +  F +  +K+  F 
Sbjct: 239 EQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|78358053|ref|YP_389502.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220458|gb|ABB39807.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 442

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 59/164 (35%), Gaps = 25/164 (15%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +L+F  F  L   H      + A   L                 P  + + K+   L ++
Sbjct: 24  LLIFLTFCILPAAHAHAGGWNAAIGELPH-------------LPPRFVAVDKSRQTLFLY 70

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSIN 123
           + +      +   Y  C      G K   GD + PEG Y++       L+ +    ++  
Sbjct: 71  RHSS--PLEVSATYT-CTTGQATGDKQVEGDLRTPEGVYFVEHRIDKGLDWDLYGGIAYT 127

Query: 124 IGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQMQ 161
           + +PN  D    +TG  + IHG         + GC A+N   ++
Sbjct: 128 LNYPNPVDALRRKTGFGIWIHGRGHEITPRETQGCIALNMADIE 171


>gi|283954467|ref|ZP_06371987.1| hypothetical protein C414_000220089 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794084|gb|EFC32833.1| hypothetical protein C414_000220089 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 325

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 45/275 (16%), Positives = 94/275 (34%), Gaps = 42/275 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  R  +L+    + L+     +  +++  + +   +   + +K                
Sbjct: 1   MLKRLALLITLSSMMLHASDLVKIYLNQGLNAVGAAIEKELTQKDFWLGEIGDKNVSLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++           ++ +I   +G  G K   GD + P GFY 
Sbjct: 61  YDDNVAIVLTNKTDKILRVYFYEDGKIRKDFEQKEI--ITGLMGNKKTEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRIDEFKTRGCIALF 178

Query: 157 NKQMQEIYAIVRDS---LRGNMQSHI------------QIQAFPFRMTSKNMQLYQNNP- 200
           N  +++   IV+D    +    +  +             +  +    T+ ++  Y +   
Sbjct: 179 NNNLEKFAQIVQDKKVFVMTEEEKKVRATKDEIASLLADLFMWKLAWTNSDINTYLSFYD 238

Query: 201 NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              F    K+  + F    +  F +  +K+  F  
Sbjct: 239 ELKFKRFDKMKFEQFASMKKSIFSRKEDKKIKFSS 273


>gi|86153307|ref|ZP_01071511.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|121612822|ref|YP_001000581.1| hypothetical protein CJJ81176_0915 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005512|ref|ZP_02271270.1| hypothetical protein Cjejjejuni_04735 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|85843033|gb|EAQ60244.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|87249350|gb|EAQ72310.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|315058346|gb|ADT72675.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           S3]
          Length = 325

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 91/274 (33%), Gaps = 42/274 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  R  +L+    + L+     +  +++    +   +   + +K                
Sbjct: 1   MLKRLALLITLSSLMLHASDLVKIYLNQGLDAVGVAIEKELTQKDFWLSEIGDKNISLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++           ++ +I   +G  G K   GD + P GFY 
Sbjct: 61  YDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIALF 178

Query: 157 NKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNPN 201
           N  +++   +V+D        +                 +  +    T+ +   Y +  +
Sbjct: 179 NNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFYD 238

Query: 202 Y-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
              F    K+  + F    +  F +  +K+  F 
Sbjct: 239 EQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|224370133|ref|YP_002604297.1| putative ErfK family protein (precursor) [Desulfobacterium
           autotrophicum HRM2]
 gi|223692850|gb|ACN16133.1| putative ErfK family protein (precursor) [Desulfobacterium
           autotrophicum HRM2]
          Length = 347

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 64/165 (38%), Gaps = 23/165 (13%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
              L+F + I   G +       + E        + +     +      + + K+   L 
Sbjct: 20  LFGLMFGVQIVFAGANEPGESDTRPEG-------LILVPMGMN-----AVVVEKSSQQLF 67

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS---KYFLS 121
           ++  +    Y  ++    C+   + G K+++GD++ PEG Y++     +          +
Sbjct: 68  LFSSDSQGVYERMRV--PCSTGASPGRKLKSGDQKTPEGVYFLTDAYEDRYLSAVYGKKA 125

Query: 122 INIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQM 160
               +PN  D+   R G+ + +HG         S GC AMNN+ +
Sbjct: 126 FPTDYPNFIDRRKGRDGSAIWLHGTNKPLKPMDSNGCVAMNNQDI 170


>gi|57237735|ref|YP_178983.1| hypothetical protein CJE0985 [Campylobacter jejuni RM1221]
 gi|57166539|gb|AAW35318.1| conserved hypothetical protein [Campylobacter jejuni RM1221]
          Length = 325

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 91/274 (33%), Gaps = 42/274 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M  R  +L+    + L+     +  +++    +   +   + +K                
Sbjct: 1   MLKRIALLITLSSLMLHASDLVKIYLNQGLDAVGVAIEKELTQKDFWLSEIGDKNISLGY 60

Query: 48  PFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                 I +  K + IL ++           ++ +I   +G  G K   GD + P GFY 
Sbjct: 61  YDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFYE 118

Query: 107 IGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+ 
Sbjct: 119 LGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIALF 178

Query: 157 NKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNPN 201
           N  +++   +V+D        +                 +  +    T+ +   Y +  +
Sbjct: 179 NNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFYD 238

Query: 202 Y-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
              F    K+  + F    +  F +  +K+  F 
Sbjct: 239 EQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|260221390|emb|CBA29904.1| hypothetical protein Csp_A14490 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 367

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/165 (20%), Positives = 55/165 (33%), Gaps = 14/165 (8%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           L        L   A         I  Q    +  +   I +   +  L +++        
Sbjct: 71  LQALRAESQLRIAAIKEPPPADRIPAQFVALAKRNKHAIAVDTAKARLYLFENTEAGP-R 129

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFDK 132
           LL  Y I       G K   GD++ P G Y+I  N       +     ++ + +PN  D 
Sbjct: 130 LLANYYISVGKAGVG-KNVEGDQRTPLGAYFITSNLDPTSLKDLYGSGALPVNYPNVLDL 188

Query: 133 AHNRTGADLMIHGECA---------SAGCYAMNNKQMQEIYAIVR 168
              +TG  + +HG  +         + GC A+ N  +  I   V 
Sbjct: 189 RRGKTGGGIWLHGTPSTQFTRAPQATDGCVAVANPDLLRIINTVE 233


>gi|239817408|ref|YP_002946318.1| ErfK/YbiS/YcfS/YnhG family protein [Variovorax paradoxus S110]
 gi|239803985|gb|ACS21052.1| ErfK/YbiS/YcfS/YnhG family protein [Variovorax paradoxus S110]
          Length = 374

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 58/158 (36%), Gaps = 14/158 (8%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
                +A         +  Q    S      I +  + + L +   N D    L+ +Y +
Sbjct: 83  SRRRLQALRDRPPAGTVPSQFLALSTRSRYAIAVDASRSRLYL-LENSDKGLQLVADYYV 141

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP---NSKYFLSINIGFPNEFDKAHNRTGA 139
                  G K   GD + P G YY+  +       +     ++ I +PN +D    +TG+
Sbjct: 142 SVGKSGIG-KATEGDARTPLGVYYVTSSLDPKSLRDFYGAGALPINYPNPYDVRRGKTGS 200

Query: 140 DLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
            + +HG           AS GC  M N  ++++   V+
Sbjct: 201 GIWLHGTPPQQFSRAPLASDGCVVMANPDLKQLLRKVQ 238


>gi|313681853|ref|YP_004059591.1| erfk/ybis/ycfs/ynhg family protein [Sulfuricurvum kujiense DSM
           16994]
 gi|313154713|gb|ADR33391.1| ErfK/YbiS/YcfS/YnhG family protein [Sulfuricurvum kujiense DSM
           16994]
          Length = 317

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 73/189 (38%), Gaps = 24/189 (12%)

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K + +LE++  +    + L K Y         G K   GD + P G Y +       +  
Sbjct: 67  KEKGVLELYTPDAQKRFYLKKRYSAFTGKN-AGDKSVAGDLKTPIGIYTLVEKKKRVDPF 125

Query: 118 Y-FLSINIGFPNEFDKAHNRTGADLMIHG-------ECASAGCYAMNNKQMQEIYA---- 165
           Y  ++    +PN +D+   + G  + +HG       +  + GC A+NN  + ++      
Sbjct: 126 YGPMAFVTSYPNLYDRVRGKNGTGIWVHGVPLSGTRDPFTKGCIAINNNDLIQLDQTINP 185

Query: 166 -----IVRDSLRGNMQSH------IQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDY 214
                I+  SL+  +Q          +  + +  T  +++ Y +  + SF     +G   
Sbjct: 186 SNTLLIIDSSLKQGIQPTAYSAILAGLYQWKYAWTYNDIETYLSTYDPSFKRSDGMGFSQ 245

Query: 215 FEKNHQEPF 223
           F+   +  F
Sbjct: 246 FKAYKERIF 254


>gi|253999957|ref|YP_003052020.1| ErfK/YbiS/YcfS/YnhG family protein [Methylovorus sp. SIP3-4]
 gi|253986636|gb|ACT51493.1| ErfK/YbiS/YcfS/YnhG family protein [Methylovorus sp. SIP3-4]
          Length = 404

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 67/180 (37%), Gaps = 18/180 (10%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
           +  P    VI +  +++ L ++ +N+  +   + +Y +         K   GD++ P G 
Sbjct: 138 QIDPTQKYVIVVDADKSRLYLY-QNIGGKPTYVADYYVTIGRNGS-EKSSEGDKRTPLGV 195

Query: 105 YYIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGADLMIHGECA---------SAGCY 153
           Y       +    ++   +  + +PNE+D+   + G  + +HG  +         S GC 
Sbjct: 196 YTASSKLTSKLPDFYGSAAYPLSYPNEWDRQQGKKGHGIWLHGTPSNTYSRPPRASDGCV 255

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHD 213
            ++N  ++ +  I++          I +    + +T    +  Q       W       D
Sbjct: 256 VISNPDLETLGPILQQG----GTPFIIVSQLKW-VTQAAPEQPQLQKALDQWRQDWQAQD 310


>gi|313201930|ref|YP_004040588.1| erfk/ybis/ycfs/ynhg family protein [Methylovorus sp. MP688]
 gi|312441246|gb|ADQ85352.1| ErfK/YbiS/YcfS/YnhG family protein [Methylovorus sp. MP688]
          Length = 404

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 67/180 (37%), Gaps = 18/180 (10%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
           +  P    VI +  +++ L ++ +N+  +   + +Y +         K   GD++ P G 
Sbjct: 138 QIDPTQKYVIVVDADKSRLYLY-QNIGGKPTYVADYYVTIGRNGS-EKSSEGDKRTPLGV 195

Query: 105 YYIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGADLMIHGECA---------SAGCY 153
           Y       +    ++   +  + +PNE+D+   + G  + +HG  +         S GC 
Sbjct: 196 YTASSKLTSKLPDFYGRAAYPLSYPNEWDRQQGKKGHGIWLHGTPSNTYSRPPRASDGCV 255

Query: 154 AMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHD 213
            ++N  ++ +  I++          I +    + +T    +  Q       W       D
Sbjct: 256 VISNPDLETLGPILQQG----GTPFIIVSQLKW-VTQAAPEQPQLQKALDQWRQDWQAQD 310


>gi|242309063|ref|ZP_04808218.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239524487|gb|EEQ64353.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 331

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 86/277 (31%), Gaps = 44/277 (15%)

Query: 1   MTNRYNILLFALF-------IFLNGCHHSRSLIDKAEHPLSEN------LIISMQKKRTS 47
           M   + +L+           I +      ++L  K    L         L     +    
Sbjct: 1   MKIIWLLLIAIFSYANEYEWIGIYRSGGVQALEQKINEVLQTKNYWQEVLKNQDTRFGYY 60

Query: 48  PFHPTVIRIFKNENILE-----IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPE 102
                +    K+   LE     ++    +     L    +    G  G K + GD   P 
Sbjct: 61  ENLKYLFVATKDAPTLESPNLKLYALENNQWIEKLNTKSLVGSKG--GHKQKEGDLATPI 118

Query: 103 GFYYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCY 153
           G Y +     N +  Y  L+ +  +PN +DK   RTG  + IHG           + GC 
Sbjct: 119 GVYSLQARLSNLDQYYGPLAFSTSYPNLYDKLQKRTGYGIWIHGMPLNGNREELNTRGCI 178

Query: 154 AMNNKQMQEIYAIV--RDSLRGNMQSHI-------------QIQAFPFRMTSKNMQLYQN 198
           A+ N  +  +  I+  R++L       +              +  +       +++ Y  
Sbjct: 179 AIENNLLTSVDRIIDYRNTLLITFADDVEQTKKEDLATILADLFQWKEAWAKNDIKAYLA 238

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
             +  F        + FE   +  F +   K+  F K
Sbjct: 239 FYDKDFIRYDGQKFEAFEDTKRRIFQKGEEKEIKFTK 275


>gi|261212665|ref|ZP_05926949.1| hypothetical protein VCJ_002941 [Vibrio sp. RC341]
 gi|260837730|gb|EEX64407.1| hypothetical protein VCJ_002941 [Vibrio sp. RC341]
          Length = 119

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 29/127 (22%)

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN 135
           +++EY+I       G K + GD++ PEG YY+ +  +  +S ++ +I+I +P+  D+ H 
Sbjct: 1   MVREYRIALGKSPKGHKQQEGDQRTPEGNYYLDF--ITQDSHFYRAIHISYPSPQDERHA 58

Query: 136 R-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
                  G D+ IHG                 + GC A+ N +M +  ++V        Q
Sbjct: 59  AQLGVSPGGDIKIHGLKNGETADPAFIQSFDWTNGCIALTNSEMDDFLSLV--------Q 110

Query: 177 SHIQIQA 183
               I  
Sbjct: 111 PGTPIHI 117


>gi|261250849|ref|ZP_05943423.1| hypothetical protein VIA_000867 [Vibrio orientalis CIP 102891]
 gi|260937722|gb|EEX93710.1| hypothetical protein VIA_000867 [Vibrio orientalis CIP 102891]
          Length = 127

 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 21/113 (18%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH 134
            ++KE++I       G K+  GD++ PEG YY+ +     +S ++ SI+I +PN  D A+
Sbjct: 8   QVIKEFRIALGKRPKGHKVYEGDQRTPEGRYYLDFVM--DSSDFYRSIHISYPNPNDVAY 65

Query: 135 NR-----TGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIVR 168
                   G ++ IHG                 + GC A+ N++M E+  +V+
Sbjct: 66  ANKLNVSPGGNIKIHGLKNGETRPAKYIQSFDWTDGCIAITNQEMDELLKLVK 118


>gi|171058352|ref|YP_001790701.1| ErfK/YbiS/YcfS/YnhG family protein [Leptothrix cholodnii SP-6]
 gi|170775797|gb|ACB33936.1| ErfK/YbiS/YcfS/YnhG family protein [Leptothrix cholodnii SP-6]
          Length = 642

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 60/150 (40%), Gaps = 14/150 (9%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
            SL  +A   L        Q  + +P    ++ +  + + L + +        L+  + +
Sbjct: 353 ASLRLQALRDLPPAGAWPKQVLQLAPSVRHLVAVDTSRSRLYVLENQPGGP-RLIAHHYV 411

Query: 83  CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP---NSKYFLSINIGFPNEFDKAHNRTGA 139
              S   G K E GD++ P G YYI          +     ++ + +PN+ D+   RTGA
Sbjct: 412 SIGSQGVG-KREEGDQRTPLGTYYITSKLDGKQLGDFYGAGALPLNYPNDHDRHLGRTGA 470

Query: 140 DLMIHGECA---------SAGCYAMNNKQM 160
           ++ +HG  +         + GC  + N  +
Sbjct: 471 NIWLHGTPSAQFARAPRATNGCIVLANDDL 500


>gi|162451714|ref|YP_001614081.1| hypothetical protein sce3442 [Sorangium cellulosum 'So ce 56']
 gi|161162296|emb|CAN93601.1| hypothetical protein sce3442 [Sorangium cellulosum 'So ce 56']
          Length = 178

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 57/144 (39%), Gaps = 33/144 (22%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           IRI K+E+ L++          +++ Y++    G  GPK   GD + P G Y +      
Sbjct: 38  IRIDKSEHTLDLVAGG-----KIVRSYRVALGPGGPGPKRYEGDRRTPVGTYRVAGRI-- 90

Query: 114 PNSKYFLSINIGFPNEFDKAH------------NRT-GADLMIHG------------ECA 148
            N  +   + + +PNE D+A              R  G  + IHG               
Sbjct: 91  -NGLFHRFLIVSYPNEEDRARFAELKRRGEVPPGRGVGHSIGIHGVGSAQLAGVHKESDW 149

Query: 149 SAGCYAMNNKQMQEIYAIVRDSLR 172
           + GC A+++ ++ EI     D  +
Sbjct: 150 TLGCIALDDDEIDEIARRTPDGAK 173


>gi|254469080|ref|ZP_05082486.1| ErfK/YbiS/YcfS/YnhG [beta proteobacterium KB13]
 gi|207087890|gb|EDZ65173.1| ErfK/YbiS/YcfS/YnhG [beta proteobacterium KB13]
          Length = 393

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 66/159 (41%), Gaps = 14/159 (8%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFH-PTVIRIFKNENILEIWKRNVDAEYVLLKEYK 81
                + E  L     I    + T P     +I +  N++ L +++        +  EY 
Sbjct: 100 DEAKKRIESHLHSATDIIKSARVTLPESIKNLIYVDTNKSRLYLFEIKNHTLIKIFDEY- 158

Query: 82  ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGA 139
                   G K   GD++ P G Y +G     P S ++   +  I +PN +DK  N+TG 
Sbjct: 159 ASIGKNGSG-KNFEGDKKTPLGVYTLGKKITQPLSDFYGDGAFPIDYPNVYDKLLNKTGH 217

Query: 140 DLMIHGEC---------ASAGCYAMNNKQMQEIYAIVRD 169
            + IHG           +S GC  ++N+ +  + +I++D
Sbjct: 218 GIWIHGTPKDTYSRAPKSSDGCIVISNENLNILESILKD 256


>gi|315638692|ref|ZP_07893866.1| conserved hypothetical secreted protein [Campylobacter upsaliensis
           JV21]
 gi|315481316|gb|EFU71946.1| conserved hypothetical secreted protein [Campylobacter upsaliensis
           JV21]
          Length = 323

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 94/272 (34%), Gaps = 42/272 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT--------------SP 48
            R+ ++  A    L+     +  ++     +   +   +  K                  
Sbjct: 1   MRFLLVFMAFLSSLSASDLVKIYLNNGLDAVGAAIERELGNKDFWLEELGDKNLSLGYYT 60

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
               +++  KN+ IL+++           ++ ++   +G  G K + GD + P GFY +G
Sbjct: 61  QDVMIVKTNKNDKILKVFSYTNGKIKKEFEQKEV--ITGLMGDKEKEGDLKTPVGFYELG 118

Query: 109 WNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNK 158
                 +  Y   +    +PN  DK  ++TG  + IHG            + GC A+ N 
Sbjct: 119 MKFSPGDQYYGPFAFATSYPNLLDKVQDKTGGGIWIHGYPLDGTRLDEFKTRGCIALFND 178

Query: 159 QMQEIYAIV-----------RDSLRGNMQS----HIQIQAFPFRMTSKNMQLYQNNP-NY 202
           ++++   +V           +DS+R   +        + A+ +  T  ++  Y       
Sbjct: 179 KLEDFAKVVAGKKVYVLTEEKDSVRAKKEEIASLMADLFAWKYAWTVSDVNAYLAFYDEK 238

Query: 203 SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
            F    K     F    +  F +  +K   F 
Sbjct: 239 DFKRFDKSSFSQFASMKKIIFARKEHKIIKFS 270


>gi|326317613|ref|YP_004235285.1| ErfK/YbiS/YcfS/YnhG family protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374449|gb|ADX46718.1| ErfK/YbiS/YcfS/YnhG family protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 437

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 57/161 (35%), Gaps = 19/161 (11%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
             S +L  +          I +  +         I +  + + L +++        L+ +
Sbjct: 149 QRSDALRARPGARAIPAQFIELSAR-----SRHAIAVDASRSRLYLFQNTEQG-MELIAD 202

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSINIGFPNEFDKAHNR 136
           Y           K   GD++ P G Y+I          +     ++ I +PN  D +  +
Sbjct: 203 YYASVGKLGI-EKALEGDQRTPLGVYFITSRLDPATLKDFYGAGALPINYPNPLDVSRGK 261

Query: 137 TGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
           TG+ + +HG           ++ GC A+ N  ++ I   V 
Sbjct: 262 TGSGIWLHGTPPEQFSRAPLSTDGCLALANPDLERILRTVE 302


>gi|117926285|ref|YP_866902.1| ErfK/YbiS/YcfS/YnhG [Magnetococcus sp. MC-1]
 gi|117610041|gb|ABK45496.1| ErfK/YbiS/YcfS/YnhG [Magnetococcus sp. MC-1]
          Length = 415

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 14/130 (10%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            S  H  VI +    + L ++  N +    L+ +Y I +       KI+ GD++ P G Y
Sbjct: 147 LSKRHSHVIAVDLTRSRLFLF-DNREGMPKLIADYYISSGKKGA-EKIKQGDKRTPAGLY 204

Query: 106 YIG---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA---------SAGCY 153
           Y+         P+     ++ I +PNE+D+ H RTG  + +HG  +         S GC 
Sbjct: 205 YVTEYIPGEKLPDLYGAGAMPINYPNEWDRLHKRTGYGIWLHGTVSGTYSRPPRASDGCV 264

Query: 154 AMNNKQMQEI 163
           A+ N   +E+
Sbjct: 265 ALTNLDFEEL 274


>gi|254562322|ref|YP_003069417.1| hypothetical protein METDI3936 [Methylobacterium extorquens DM4]
 gi|254269600|emb|CAX25571.1| conserved hypothethical protein [Methylobacterium extorquens DM4]
          Length = 182

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 63/186 (33%), Gaps = 33/186 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  I      + + G                  L+   ++          + + K  
Sbjct: 1   MGRRGRIAALIGGLAVLGAGAVVLADVFQVGRTEPPLVAEAERAD-------RVLVEKAA 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L + +        +L  Y I       G K   GD + PEG Y + +   NP S   L
Sbjct: 54  RRLTLLREG-----RVLATYPISLGFAPEGHKAREGDGRTPEGVYAVAFR--NPRSVAHL 106

Query: 121 SINIGFPNEFDKAH----NR-TGADLMIHG--------------ECASAGCYAMNNKQMQ 161
           S+ + +P+  D A         G D+MIHG              +  + GC  + N +M+
Sbjct: 107 SLKVSYPSPADAAAAQAGGYSPGGDIMIHGLMNGFSWLGRLHRLKDWTQGCVGVTNAEMR 166

Query: 162 EIYAIV 167
            IYA V
Sbjct: 167 AIYARV 172


>gi|283852469|ref|ZP_06369737.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio sp. FW1012B]
 gi|283572077|gb|EFC20069.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio sp. FW1012B]
          Length = 456

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 54/169 (31%), Gaps = 25/169 (14%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     +L  A F+ +  C  +                               + + K  
Sbjct: 1   MKRTGRVLALACFLLVLPCRWAAGEWTA-------------DIVDMEASPSRFVAVDKKA 47

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSK 117
               +   +  +   LL     CA     G K + GD + PEG Y+I       LN    
Sbjct: 48  QSFALL--SRQSPLRLLAAIP-CATGQELGDKFKEGDLKTPEGVYFITRRKTAGLNYELY 104

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQM 160
             L+  + FPN  D    ++G  + IHG         + GC A++   +
Sbjct: 105 GDLAFPLNFPNPADVVRRKSGHGIWIHGRGHAIIPYETQGCVALSTPDI 153


>gi|120610990|ref|YP_970668.1| ErfK/YbiS/YcfS/YnhG [Acidovorax citrulli AAC00-1]
 gi|120589454|gb|ABM32894.1| ErfK/YbiS/YcfS/YnhG [Acidovorax citrulli AAC00-1]
          Length = 437

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 55/166 (33%), Gaps = 14/166 (8%)

Query: 15  FLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEY 74
            L            A         I  Q    S      I +  + + L +++       
Sbjct: 139 VLAELRAESRQRSDALRVRPGARAIPAQFIELSARSRHAIAVDASRSRLYLFQNTEQG-M 197

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSINIGFPNEFD 131
            L+ +Y           K   GD++ P G Y+I          +     ++ I +PN  D
Sbjct: 198 ELIADYYASVGKLGI-EKALEGDQRTPLGVYFITSRLDPATLKDFYGAGALPINYPNPLD 256

Query: 132 KAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
            +  +TG+ + +HG           ++ GC A+ N  ++ I   V 
Sbjct: 257 VSRGKTGSGIWLHGTPPEQFSRAPLSTDGCLALANPDLERILRTVE 302


>gi|258406579|ref|YP_003199321.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfohalobium retbaense DSM
           5692]
 gi|257798806|gb|ACV69743.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfohalobium retbaense DSM
           5692]
          Length = 304

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 56/163 (34%), Gaps = 26/163 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M +R+ +L  A   F+  C            P+S                   + + K E
Sbjct: 1   MGHRFALLAGAWTTFIL-CFFPSPAPGWEVPPVSPE-----------HGPACFLVVEKAE 48

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN--LNPNSKY 118
             L +W      + V       C+   + G K   GD   PEG Y++      L      
Sbjct: 49  QRL-VWTNATSTQLVW-----QCSTGSSGGDKWREGDLATPEGVYFMTRRQTGLPEKLYG 102

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAM 155
            L+  + +PN  D+   +TG  + +HG         + GC A+
Sbjct: 103 NLAFPLNYPNPVDRLRGKTGYGIWLHGRGKPLVPRDTRGCIAL 145


>gi|312881783|ref|ZP_07741557.1| hypothetical protein VIBC2010_06459 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370534|gb|EFP98012.1| hypothetical protein VIBC2010_06459 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 157

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 63/137 (45%), Gaps = 26/137 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           ++++ K++  L + +        +  E++I       G K E GD++ PEG YY+ +   
Sbjct: 21  LVKVDKSKRRLYLIENE-----RITHEFRIALGKQPKGHKSEQGDQRTPEGRYYLQFIL- 74

Query: 113 NPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCY 153
             +S+++ SI+I +P+  D+          G ++ IHG                 + GC 
Sbjct: 75  -EDSEFYRSIHISYPSLDDRLGAMIFNRDPGGNIKIHGLRNGENRPAQFVQSFDWTNGCI 133

Query: 154 AMNNKQMQEIYAIVRDS 170
           A++N+ M    ++V++ 
Sbjct: 134 ALSNQDMDTFLSLVKEG 150


>gi|240139898|ref|YP_002964375.1| hypothetical protein MexAM1_META1p3361 [Methylobacterium extorquens
           AM1]
 gi|240009872|gb|ACS41098.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 182

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 65/190 (34%), Gaps = 41/190 (21%)

Query: 1   MTNR-YNILLFALFIFLNG---CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRI 56
           M  R     +      L          S + + E PL      + +           + +
Sbjct: 1   MGRRGRIAAVIGGLAVLGAGAVVLADFSQVGRTEPPLVAEAERADR-----------VLV 49

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
            K    L + +        +L  Y I       G K   GD + PEG Y I +   NP S
Sbjct: 50  EKAARRLTLLREG-----RVLATYPISLGFVPEGHKAREGDGRTPEGVYAIAFR--NPRS 102

Query: 117 KYFLSINIGFPNEFDKAH----NR-TGADLMIHG--------------ECASAGCYAMNN 157
              LS+ + +P+  D A         G D+MIHG              +  + GC  + N
Sbjct: 103 VAHLSLKVSYPSPADAAAAQAGGYSPGGDIMIHGLMNGFSWLGRLHRLKDWTQGCVGVTN 162

Query: 158 KQMQEIYAIV 167
            +M+ IYA V
Sbjct: 163 AEMRAIYARV 172


>gi|78486093|ref|YP_392018.1| ErfK/YbiS/YcfS/YnhG [Thiomicrospira crunogena XCL-2]
 gi|78364379|gb|ABB42344.1| Hypothetical protein Tcr_1752 [Thiomicrospira crunogena XCL-2]
          Length = 375

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/144 (23%), Positives = 59/144 (40%), Gaps = 17/144 (11%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
            P ++ +    + L ++++N +  Y  +  Y +       G K   GD + P G Y I  
Sbjct: 144 EPYLVIVDSAAHRLYLYQKNENG-YEEVANYYVSIGQKGTG-KQVRGDLKTPIGIYKIEK 201

Query: 110 NNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNN 157
              +   P      ++ + +PN +DK   RTG+ + +HG           AS GC  +NN
Sbjct: 202 ELSDSKLPELYGVAALTLNYPNSWDKQKGRTGSGIWLHGTPRSTYSRPPLASRGCVVLNN 261

Query: 158 KQMQEI---YAIVRDSLRGNMQSH 178
             MQ +   Y +   +     QS 
Sbjct: 262 PAMQTLIYQYRLAPATPVIIAQSA 285


>gi|224373456|ref|YP_002607828.1| putative periplasmic protein [Nautilia profundicola AmH]
 gi|223588865|gb|ACM92601.1| putative periplasmic protein [Nautilia profundicola AmH]
          Length = 319

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 58/262 (22%), Positives = 104/262 (39%), Gaps = 49/262 (18%)

Query: 3   NRYNILLFALFIFLNGC------HHSRSLIDKAEHPLSENL--IISMQKKRTSPF----- 49
            R+ IL    F++          + S +L +  E  L      +  +Q K  +       
Sbjct: 1   MRFLILFLVTFLYSANLIDIYRFNGSDALSEHIEKILGSKTYWLERLQNKDVTWGYYETQ 60

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
              ++ + K++ IL+I+  N D+ + L+   K+       G K + GD + P G Y +  
Sbjct: 61  KDILVCV-KSKKILKIF-ENNDSTFKLIDTVKVLTGL--DGDKKKEGDLKTPIGVYKLKG 116

Query: 110 NNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHG--------ECASAGCYAMNNKQM 160
              N +S Y   +   G+PN FDK +++ G  + IHG        +  + GC  M+N ++
Sbjct: 117 LIENVDSFYGPFAFVTGYPNLFDKINHKNGHGIWIHGVPLEGKRDDNNTKGCIVMDNNKL 176

Query: 161 QEI---------YAIVRD--SLRGNMQSHIQIQAFPFRMTSKNM----QLYQNNPNYSF- 204
            ++         Y ++ +   L    +    I AF ++     M    + Y+N  + SF 
Sbjct: 177 LQLKNEINYKDTYLLISENVPLTATKEEIASILAFIYKWRKAWMNNDFESYKNFYDESFK 236

Query: 205 ---WNMLKLGHDY----FEKNH 219
                 LK   DY    FE   
Sbjct: 237 KSDGKDLKEFLDYKKRVFENKK 258


>gi|312892133|ref|ZP_07751631.1| ErfK/YbiS/YcfS/YnhG family protein [Mucilaginibacter paludis DSM
           18603]
 gi|311295384|gb|EFQ72555.1| ErfK/YbiS/YcfS/YnhG family protein [Mucilaginibacter paludis DSM
           18603]
          Length = 173

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 26/131 (19%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +   K+   L ++ +       L+K Y I   S   G K    D + P+G Y+I     N
Sbjct: 38  MIAIKSRRQLLVYAQG-----KLIKTYAISLGSCPAGKKQFEHDGKTPDGVYFINAK--N 90

Query: 114 PNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGE--------------CASAGCYA 154
           PNS    ++ I +PN+ D    +     TG D+ IHG                 +AGC A
Sbjct: 91  PNSVCHKNLGISYPNQADVQQAKKFKLPTGGDIKIHGLTNGLGFIGKFHRWYNWTAGCIA 150

Query: 155 MNNKQMQEIYA 165
           + N ++ ++Y+
Sbjct: 151 LTNAEIDDLYS 161


>gi|89094583|ref|ZP_01167521.1| ErfK/YbiS/YcfS/YnhG protein [Oceanospirillum sp. MED92]
 gi|89081182|gb|EAR60416.1| ErfK/YbiS/YcfS/YnhG protein [Oceanospirillum sp. MED92]
          Length = 402

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 16/143 (11%)

Query: 30  EHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTF 89
           E P S  L   M   + SP    VI +    + L ++  N +   VL++++      G  
Sbjct: 116 EKPSSNMLPADM--MKLSPSQKHVIVVDTRLSRLFLF-ENQNGVPVLVEDFYASYGRGGT 172

Query: 90  GPKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE 146
           G K++ GD + P G Y+I     +   P+     ++ I +PN +D+   +TG  + +HG 
Sbjct: 173 G-KVKQGDLKTPLGVYFITNRLEDEKLPSRYGSGALPINYPNVWDQRLGKTGNGIWLHGS 231

Query: 147 CA---------SAGCYAMNNKQM 160
                      S GC ++ N   
Sbjct: 232 PVETYSRPPKASEGCISLTNPDF 254


>gi|332530129|ref|ZP_08406078.1| erfk/ybis/ycfs/ynhg family protein [Hylemonella gracilis ATCC
           19624]
 gi|332040399|gb|EGI76776.1| erfk/ybis/ycfs/ynhg family protein [Hylemonella gracilis ATCC
           19624]
          Length = 432

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/168 (18%), Positives = 59/168 (35%), Gaps = 17/168 (10%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR----NVD 71
           L    H   +   A         +  Q    +P     I +  +   L +++     N  
Sbjct: 123 LAELRHESEVRLAALRERPPAGAVPTQFLALAPNVRHAIAVDASRARLYLFENQAQANEG 182

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN---PNSKYFLSINIGFPN 128
           A   L+ +Y +         K   GD + P G Y+          PN     ++ I +PN
Sbjct: 183 ARMRLIADYYVSVGKYGI-EKTTEGDARTPLGVYFTLHRLDKRSLPNFYGAGALPINYPN 241

Query: 129 EFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIV 167
             D+   +TG+ + +HG           A+ GC  +++  ++ +   V
Sbjct: 242 ILDRRRGKTGSGIWLHGTPPNQFARAPLATNGCVVLSDPDLEHVLRTV 289


>gi|118474716|ref|YP_892715.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
 gi|118413942|gb|ABK82362.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
          Length = 322

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 97/272 (35%), Gaps = 41/272 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------SPF 49
            ++ I +     FL      +  ++     + + +  ++Q K                  
Sbjct: 2   KKFLIFVLCFLSFLYSKDLEKIYLESGIEAVQKAIEANLQSKDYWQKHLSQMDLKYGYYD 61

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
               I +   +          D +     ++K+       G K+  GD + P G Y I  
Sbjct: 62  SDIFIVVVDKKAKNFYLNEYKDGKLDSKADHKVLTGL--MGDKLLEGDLKTPVGVYEITR 119

Query: 110 NNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC----------ASAGCYAMNNK 158
             +  ++ Y  ++ N+ +PN FDK  +RTG  + IHG             + GC  M N 
Sbjct: 120 RFVPEDTYYGPVAFNLSYPNLFDKLRDRTGGGIWIHGFPLNGNIREDVYKTKGCVVMPND 179

Query: 159 QMQEIYAIVRD--SLRGNMQSHI-------------QIQAFPFRMTSKNMQLYQNNPNYS 203
            +  + +I++D   +    +S I             ++  +    T+ ++  Y +  +  
Sbjct: 180 LLLNLESILKDNGGMVLINESGILEAKNEDIALIFAELFKWKEAWTNSDIDRYLSFYDKK 239

Query: 204 FWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           F     +G D F++  +  F +  NK   F K
Sbjct: 240 FKRYDGVGFDKFKEMKKNIFSRKENKFIQFTK 271


>gi|303246802|ref|ZP_07333079.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio fructosovorans
           JJ]
 gi|302491819|gb|EFL51699.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio fructosovorans
           JJ]
          Length = 741

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 56/169 (33%), Gaps = 26/169 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     I+  A  + + G   S                               + + K  
Sbjct: 1   MKRIGPIIAAACLVLVCGSRASGEWTADIV--------------DMDSTPSRFVAVDKKA 46

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSK 117
               +   +  +   +L E   CA     G K + GD + PEG Y+I       LN +  
Sbjct: 47  QSFALL--SRHSPLRVLTEIP-CATGQALGDKFKEGDLKTPEGVYFITRRKSSGLNFDLY 103

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQM 160
             L+  + FPN  D   +++G  + IHG         + GC A++   +
Sbjct: 104 GDLAFPLDFPNPADVLRHKSGHGIWIHGRGHPITPYETQGCVALSMANI 152


>gi|331007095|ref|ZP_08330318.1| ErfK/YbiS/YcfS/YnhG [gamma proteobacterium IMCC1989]
 gi|330419090|gb|EGG93533.1| ErfK/YbiS/YcfS/YnhG [gamma proteobacterium IMCC1989]
          Length = 312

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 65/177 (36%), Gaps = 21/177 (11%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           +T R   L   LF  +         +        ++ +        +  +P VI    + 
Sbjct: 2   ITIRNIFLGLLLFSSMVSAETPDFSLQ------PDHTMQPASLVDIADSYPHVIISELST 55

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN-SKYF 119
             L ++KR  D  ++LL+          +G K   GD + P G Y I  +        ++
Sbjct: 56  GKLYVYKRQADGSFLLLETMHTSIGKKGYG-KNIEGDNKTPVGVYRITSHLTPEQLDAFY 114

Query: 120 L--SINIGFPNEFDKAHNRTGADLMIHGEC-----------ASAGCYAMNNKQMQEI 163
              +  + +PN +DK + RTG  + +H E             S GC  ++N  +  I
Sbjct: 115 GNAAYPVNYPNAWDKINERTGYGIWLHAEPIGLTTKTRPLLDSNGCIVLSNNDIDII 171


>gi|325294451|ref|YP_004280965.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064899|gb|ADY72906.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 353

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 89/239 (37%), Gaps = 37/239 (15%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
            +  +    S+ +    +    + LI ++      P     I + K   IL + K +   
Sbjct: 54  LLLFSYAGESKEVRKLIKKAYPKRLISNVL---ILPPSINAIIVDKTREILYVIKMDKSI 110

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY-IGWNNLNPNSKYFLSINIGFPNEFD 131
              ++K++  C      G K+E GD + PEG Y+ + W    P      +  + +PN  D
Sbjct: 111 P-HVIKKFP-CITGKKLGDKLEEGDLRTPEGIYFPLYWRTNLPKLYGIGAFPLNYPNLID 168

Query: 132 KA-HNRTGADLMIHGEC-------ASAGCYAMNNKQMQEIYAIVRDSL------------ 171
           K    R G  + IHG         ++ GC  + N+ ++E+  ++   L            
Sbjct: 169 KKVLKRNGHGIWIHGTNDPNRPPHSTNGCIVLKNEYLKELKKLIDPKLTPVIVVTTVNYV 228

Query: 172 --RGNMQSHIQIQAFPFRM------TSKNMQLYQNNPNYSF-WNMLKLGHDYFEKNHQE 221
             +  +     I +F  R       T KN++ Y +  +  F W   K  +  + +  + 
Sbjct: 229 ERKKYINEKKSILSFILRWKKAWENTPKNLKSYFSFYSKHFVWK--KGNYKDWIRYKKR 285


>gi|218531404|ref|YP_002422220.1| ErfK/YbiS/YcfS/YnhG family protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523707|gb|ACK84292.1| ErfK/YbiS/YcfS/YnhG family protein [Methylobacterium
           chloromethanicum CM4]
          Length = 182

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 63/186 (33%), Gaps = 33/186 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  I      + + G                  L+   ++          + + K  
Sbjct: 1   MGRRGRIAAVIGGLAVLGAGAVVLADVSQVGRTEPPLVAEAERAD-------RVLVEKAA 53

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L + +        +L  Y I       G K   GD + PEG Y + +   NP S   L
Sbjct: 54  RRLTLLREG-----RVLATYPISLGFAPEGHKARDGDGRTPEGVYAVAFR--NPRSVAHL 106

Query: 121 SINIGFPNEFDKAH----NR-TGADLMIHG--------------ECASAGCYAMNNKQMQ 161
           S+ + +P+  D A         G D+MIHG              +  + GC  + N +M+
Sbjct: 107 SLKVSYPSPADAAAAQAGGYSPGGDIMIHGLMNGFSWLGRLHRLKDWTQGCVGVTNAEMR 166

Query: 162 EIYAIV 167
            IYA V
Sbjct: 167 AIYARV 172


>gi|315637664|ref|ZP_07892870.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315478118|gb|EFU68845.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 323

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 78/208 (37%), Gaps = 25/208 (12%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                   VI   K    + ++ +N D    + K+  I       G K   GD++ PEG 
Sbjct: 61  GFYETKEYVIVAEKENKKMTLFAKNGDDYKQISKDSMIV--GEKAGDKFLEGDKKTPEGA 118

Query: 105 YYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------ASAGCYAMN 156
           + +       +  Y   ++   +PN FDK+ ++ G  + IHG          + GC A++
Sbjct: 119 FELVQKRTGLDQFYGPFALVTEYPNTFDKSLDKKGHGIWIHGMPFNGDREKFTQGCLALD 178

Query: 157 NKQMQEIYAIVR----------DSLRGNMQSHI-----QIQAFPFRMTSKNMQLYQNNPN 201
           N++++ +   +           D  +   ++ I      I  +       N++ Y +  +
Sbjct: 179 NEKLETLAKNIDYKKTVLITSGDEFKKASKNDIALILSSIYKWKDAWKYSNIEEYLSFYS 238

Query: 202 YSFWNMLKLGHDYFEKNHQEPFIQIINK 229
             F    +     FE   ++ F +  +K
Sbjct: 239 KDFKRADQSDFKKFETQKRQIFAKNESK 266


>gi|300311193|ref|YP_003775285.1| hypothetical protein Hsero_1868 [Herbaspirillum seropedicae SmR1]
 gi|300073978|gb|ADJ63377.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 399

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 61/153 (39%), Gaps = 14/153 (9%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG 87
           ++     +  +I     +       V+ +    + + ++  N   E     ++ I     
Sbjct: 112 RSLQEKPDPNLIPKAVLQVGEDQKNVLVVDTTRSRMYVY-ENQGGELKFQTDFYISQGRF 170

Query: 88  TFGPKIETGDEQAPEGFYYIGWNNLNP---NSKYFLSINIGFPNEFDKAHNRTGADLMIH 144
               K ++GD++ P G YY+      P   +     ++ + +PNE+DK + R+G  + +H
Sbjct: 171 GA-NKSKSGDQRTPIGVYYVNNRIPGPKLPDFYGTGALPLSYPNEWDKRNGRSGYGIWLH 229

Query: 145 GEC---------ASAGCYAMNNKQMQEIYAIVR 168
           G           +S GC  + N  +Q +Y+   
Sbjct: 230 GTPSDNFSRPPLSSDGCVVLANPDLQSLYSTAE 262


>gi|221066750|ref|ZP_03542855.1| ErfK/YbiS/YcfS/YnhG family protein [Comamonas testosteroni KF-1]
 gi|220711773|gb|EED67141.1| ErfK/YbiS/YcfS/YnhG family protein [Comamonas testosteroni KF-1]
          Length = 438

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 65/165 (39%), Gaps = 14/165 (8%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           L G H       +    + E   I  +           I I  +++ L ++  N D  + 
Sbjct: 141 LAGLHDEIRRRVQGADSVPETGSIPSEFLMLDASVRQAIAIDASKSRLYLFA-NEDGRFR 199

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW---NNLNPNSKYFLSINIGFPNEFDK 132
           ++  + +       G K E GD++ P+G Y+IG        P      ++ + +PN++D+
Sbjct: 200 VVGNFYVSVGKLGLG-KKEEGDQRTPQGLYFIGRQIPGMKLPEFYGLGALTMNYPNDWDR 258

Query: 133 AHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
              R+G+ + +HG           AS GC  + N  +  +   V 
Sbjct: 259 VVGRSGSGIWLHGTPPDQYARLPEASDGCVVLANPDLDFLMQTVE 303


>gi|109947439|ref|YP_664667.1| hypothetical protein Hac_0886 [Helicobacter acinonychis str.
           Sheeba]
 gi|109714660|emb|CAJ99668.1| conserved hypothetical protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 330

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 72/227 (31%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ N D     +   K    S   G K 
Sbjct: 51  TEELQNKDTDFGYYQNKQFLFVADKSKPNLEFYEIN-DNMLKKINGSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQM---QEIYAIVRDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N+ +    +I      +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENQLLSSYDKILK-GEKAFLITYEDKFFPSTKEELAMILSTLFQWKDAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           T  + + Y +  N +F     +  + F++  +  F +   K   F  
Sbjct: 228 TKGDFERYMSFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|116750933|ref|YP_847620.1| hypothetical protein Sfum_3514 [Syntrophobacter fumaroxidans MPOB]
 gi|116699997|gb|ABK19185.1| hypothetical protein Sfum_3514 [Syntrophobacter fumaroxidans MPOB]
          Length = 157

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 62/154 (40%), Gaps = 39/154 (25%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            S      I ++K++  L +         VL++EY I       G K   GD + PEG +
Sbjct: 1   MSLVSNPKIYVYKSDRRLLLVNNG-----VLVREYPIGLGFSPNGDKFMRGDGRTPEGQF 55

Query: 106 YIGWNNLNPNSKYFLSINIGFP--------------------NEFDKAHNRT-------- 137
           +I     NPNS+++ S+ + +P                    N  + +  +         
Sbjct: 56  FICAK--NPNSRFYKSLGLNYPDPRHAEKALVWGAISLEDFRNIVEASEGKRRPPSNTVL 113

Query: 138 GADLMIHGE----CASAGCYAMNNKQMQEIYAIV 167
           G D+ IHG       + GC A+ N  M E+++IV
Sbjct: 114 GGDIFIHGGGAGRDWTWGCVAVRNSAMDELFSIV 147


>gi|163756857|ref|ZP_02163966.1| hypothetical protein KAOT1_10501 [Kordia algicida OT-1]
 gi|161323246|gb|EDP94586.1| hypothetical protein KAOT1_10501 [Kordia algicida OT-1]
          Length = 189

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/200 (20%), Positives = 74/200 (37%), Gaps = 36/200 (18%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   LLF   I L      +          SE  +  +   +TS      I I K++  
Sbjct: 1   MKAFTLLFVSLITLFCVQSCKRETANKNAKTSETTLKQLLPAKTS----IRILIDKSDYT 56

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L ++  +      L+K+Y +         K + GD++ PEG + +   +  P+  +   I
Sbjct: 57  LSVFTADT-----LVKKYNVVFGGNPVDDKEKEGDKRTPEGVFGV--RDKYPHRSWSKFI 109

Query: 123 NIGFPNE--FDKAHNRT-----------GADLMIHGEC------------ASAGCYAMNN 157
            I +PN+  + K + R            G ++ IHG               + GC +M N
Sbjct: 110 WIDYPNKSSWKKFNQRKANGIIKEGETIGGEVGIHGVPEGMDHMIDTKQNWTLGCISMKN 169

Query: 158 KQMQEIYAIVRDSLRGNMQS 177
             + EIY  +    +  +Q 
Sbjct: 170 SDVNEIYPYITKKTQITIQK 189


>gi|315124402|ref|YP_004066406.1| hypothetical protein ICDCCJ07001_861 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315018124|gb|ADT66217.1| hypothetical protein ICDCCJ07001_861 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 303

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 60  YYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 117

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 118 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 177

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 178 FNNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFY 237

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 238 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|148926588|ref|ZP_01810270.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|145845282|gb|EDK22376.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 325

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 60  YYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 117

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 118 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 177

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 178 FNNNLEKFAKVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNAYLSFY 237

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 238 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|224418109|ref|ZP_03656115.1| hypothetical protein HcanM9_02416 [Helicobacter canadensis MIT
           98-5491]
 gi|313141644|ref|ZP_07803837.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130675|gb|EFR48292.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 331

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 69/201 (34%), Gaps = 26/201 (12%)

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
               L+++          L    +    G  G K + GD   P G Y +    +N +  Y
Sbjct: 77  ESPKLKLYALENGKWVERLNANSLVGSKG--GNKQKEGDLATPIGVYTLEKRLVNLDQYY 134

Query: 119 -FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV-- 167
             L+    +PN +D+   RTG  + IHG           + GC A+ N  +  +  I+  
Sbjct: 135 GPLAFTTSYPNLYDRLQKRTGYGIWIHGMPLNGNREELNTRGCIAIENNLLTTVDQIIDY 194

Query: 168 RDSLRGNMQSHI------QIQA-------FPFRMTSKNMQLYQNNPNYSFWNMLKLGHDY 214
           RDSL     + I       ++        +     +  +  Y +     F       ++ 
Sbjct: 195 RDSLLITFSNEIKEVKKQDLEIILSNLFQWKEAWKNNVIDTYLSFYGEDFIRYDGQKYNA 254

Query: 215 FEKNHQEPFIQIINKQYVFFK 235
           F    ++ F +   K   F K
Sbjct: 255 FAAVKRQIFGKGEEKNIQFNK 275


>gi|205356391|ref|ZP_03223156.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|205345776|gb|EDZ32414.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
          Length = 311

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 46  YYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 103

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 104 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 163

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 164 FNNNLEKFAKVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNAYLSFY 223

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 224 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 258


>gi|154174131|ref|YP_001408672.1| putative periplasmic protein [Campylobacter curvus 525.92]
 gi|112802069|gb|EAT99413.1| putative periplasmic protein [Campylobacter curvus 525.92]
          Length = 321

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 58/180 (32%), Gaps = 27/180 (15%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKK--------------RTSP 48
            +     F L   L+  ++    +      + + +  ++  K                  
Sbjct: 2   KKIIFPFFILAASLSAQNYEDIYLKSGADAVIKAIEKNILSKEYWAKRLDGKDVKYGYYD 61

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
               +  + K +  LE+   +      L + +      G  G K+  GD + P G Y + 
Sbjct: 62  NEVLLAVVDKTDKKLEVLSYDNG---KLERVFDTGVIVGKSGDKLLEGDLKTPVGVYQLT 118

Query: 109 WNNLNPNSK-YFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNK 158
                 +     L+ ++ +PN  DK   R G  + IHG            + GC AM N 
Sbjct: 119 RRFTPSDPYLGPLAFSLSYPNLLDKLAKRNGGGIWIHGYPLDGQRTDELKTKGCVAMEND 178


>gi|153952096|ref|YP_001398022.1| hypothetical protein JJD26997_0906 [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939542|gb|ABS44283.1| conserved hypothetical protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 325

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 60  YYDDNVAIVLTNKTDKILRVYSYEDGKIKKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 117

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 118 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 177

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 178 FNNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFY 237

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 238 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|86150191|ref|ZP_01068418.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88597483|ref|ZP_01100717.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|218562526|ref|YP_002344305.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|85839307|gb|EAQ56569.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88190075|gb|EAQ94050.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|112360232|emb|CAL35027.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284926140|gb|ADC28492.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315929852|gb|EFV09015.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 325

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 60  YYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 117

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 118 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 177

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 178 FNNNLEKFAKVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNAYLSFY 237

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 238 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|283956251|ref|ZP_06373731.1| hypothetical protein C1336_000250022 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791971|gb|EFC30760.1| hypothetical protein C1336_000250022 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 325

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 73/207 (35%), Gaps = 28/207 (13%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           +   K + IL ++           ++ +I   +G  G K   GD + P GFY +G     
Sbjct: 68  VLANKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFYELGRKFNP 125

Query: 114 PNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEI 163
            +  Y   +    +PN  DK   +TG  + IHG            + GC A+ N  +++ 
Sbjct: 126 GDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIALFNNNLEKF 185

Query: 164 YAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNPNY-SFWNM 207
             +V+D        +                 +  +    T+ +   Y +  +   F   
Sbjct: 186 AQVVQDKKVFVMTEEKEKTRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFYDEQEFKRF 245

Query: 208 LKLGHDYFEKNHQEPFIQIINKQYVFF 234
            K+  + F    +  F +  +K+  F 
Sbjct: 246 DKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|149926797|ref|ZP_01915056.1| ErfK/YbiS/YcfS/YnhG [Limnobacter sp. MED105]
 gi|149824349|gb|EDM83567.1| ErfK/YbiS/YcfS/YnhG [Limnobacter sp. MED105]
          Length = 422

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 60/153 (39%), Gaps = 16/153 (10%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG 87
           KA     +  ++  +    +     VI +    + L ++  N   +  L+ ++ +    G
Sbjct: 141 KAVKDRPQRDLLPAELVELNDDQRYVILVDTTRSRLFLY-ENSFPQPRLVTDFYVS--QG 197

Query: 88  TFGP-KIETGDEQAPEGFYYIG---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMI 143
             G  K+  GD++ P G Y I          +    +++ I +PN +DK   +TG  + +
Sbjct: 198 KMGAVKVREGDKRTPIGVYTITELLPKEKLTDFYGPIALPIDYPNAWDKRLGKTGYGIWL 257

Query: 144 HGECA---------SAGCYAMNNKQMQEIYAIV 167
           HG            S GC  + N+ +  +   V
Sbjct: 258 HGMPKHYVSRPPKASDGCVVLANQDLLALKKFV 290


>gi|86152147|ref|ZP_01070359.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|85840932|gb|EAQ58182.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           260.94]
          Length = 325

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 74/215 (34%), Gaps = 29/215 (13%)

Query: 47  SPFHPTVIRIF-KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                  I +  K + IL ++           ++ +I   +G  G K   GD + P GFY
Sbjct: 60  YYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEI--ITGLMGDKKIEGDLKTPVGFY 117

Query: 106 YIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
            +G      +  Y   +    +PN  DK   +TG  + IHG            + GC A+
Sbjct: 118 ELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDGSRLDEFKTRGCIAL 177

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSH-------------IQIQAFPFRMTSKNMQLYQNNP 200
            N  +++   +V+D        +                 +  +    T+ +   Y +  
Sbjct: 178 FNNNLEKFAQVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWKLAWTNSDTNTYLSFY 237

Query: 201 NY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +   F    K+  + F    +  F +  +K+  F 
Sbjct: 238 DEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFS 272


>gi|157163935|ref|YP_001466517.1| 60 kDa chaperonin (protein Cpn60; groEL protein) [Campylobacter
           concisus 13826]
 gi|112800637|gb|EAT97981.1| putative periplasmic protein [Campylobacter concisus 13826]
          Length = 321

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 81/276 (29%), Gaps = 49/276 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRT-------------S 47
           M         AL   L   ++    +      + E +  ++  K                
Sbjct: 1   MKKILLF-FIALAPCLFAQNYEEIYLKNGPSAVIEAIEKNILSKDYWLEKLKDKDVRYGY 59

Query: 48  PFHPTVI-RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
             +  ++  + K +  LE+          L          G  G K+  GD + P G Y 
Sbjct: 60  YDNEILLSVVDKTDKELEVISYKDGVTKKLFSS---SVIVGKNGDKLLEGDLKTPVGVYQ 116

Query: 107 IGWNNLNPNSK-YFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
           +       +     L+ ++ +PN  DK   R G+ + IHG            + GC AM 
Sbjct: 117 LTRRFTPNDRYLGPLAFSLSYPNLLDKLSKRNGSGIWIHGYPLDGQRTDELKTKGCVAMQ 176

Query: 157 NK---QMQE----------IYAIVRDSLRGNMQSHIQIQA-----FPFRMTSKNMQLYQN 198
           N    +  E          IY    D       + I +       +    +  ++  Y  
Sbjct: 177 NDILMKFDEVIDHKKTLAFIY---EDKRPEASANDIAVIISGILNWKKTWSESDIDSYLK 233

Query: 199 NPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
             +  F     +  + F+   +  F +   K   F 
Sbjct: 234 FYDKDFERYDGMSLENFKNMKRAIFSKKEKKHIAFS 269


>gi|147667732|gb|ABQ45832.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 73/235 (31%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K  VF     I
Sbjct: 224 KEAWVRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIVFSSISVI 278


>gi|46581348|ref|YP_012156.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601474|ref|YP_965874.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris DP4]
 gi|46450770|gb|AAS97416.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561703|gb|ABM27447.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris DP4]
 gi|311235007|gb|ADP87861.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris RCH1]
          Length = 429

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 58/164 (35%), Gaps = 22/164 (13%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKR 68
           + AL   L     S +        ++++ +   +       H   + IF           
Sbjct: 11  ILALLFVLFAAATSSASDKGWNTAIADSDLTPRRILAVDKNHQRFL-IF----------- 58

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSINIG 125
              +   L   +  C      G K+  GD + PEG Y+I       L+      ++  + 
Sbjct: 59  ERHSPLALRGTFP-CTTGQADGDKVAEGDLRTPEGIYFIEGKRTSGLDYGLYGGIAYTLN 117

Query: 126 FPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQMQEI 163
           +PN  D+  +++G  + IH +        + GC A+N   +  +
Sbjct: 118 YPNPVDRLRHKSGYGIWIHSKGRDITPRETRGCIALNRGDIDAL 161


>gi|147667746|gb|ABQ45839.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 71/231 (30%), Gaps = 28/231 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +   Y  V     +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           T  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 228 TRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|319762809|ref|YP_004126746.1| erfk/ybis/ycfs/ynhg family protein [Alicycliphilus denitrificans
           BC]
 gi|330824889|ref|YP_004388192.1| ErfK/YbiS/YcfS/YnhG family protein [Alicycliphilus denitrificans
           K601]
 gi|317117370|gb|ADU99858.1| ErfK/YbiS/YcfS/YnhG family protein [Alicycliphilus denitrificans
           BC]
 gi|329310261|gb|AEB84676.1| ErfK/YbiS/YcfS/YnhG family protein [Alicycliphilus denitrificans
           K601]
          Length = 456

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 60/171 (35%), Gaps = 16/171 (9%)

Query: 11  ALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNV 70
           A    L+       L   A         I  Q    S      I +  + + L ++  N 
Sbjct: 154 AAIDTLSDLRAESRLRVDALKARPPQGSIPAQFLELSARTRHAIAMDASRSRLYLF-ENT 212

Query: 71  DAEYVLLKEYKICAWSGTFG-PKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSINIGF 126
           D   VL+ +Y      G  G  K   GD++ P G YYI          +     ++ I +
Sbjct: 213 DKGLVLVADYYASV--GKLGTEKQAEGDQRTPLGVYYITSRLDPATLKDFYGAGALPINY 270

Query: 127 PNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
           PN  D    +TG+ + +HG           A+ GC  + N  ++ +   V 
Sbjct: 271 PNPLDLRRGKTGSGIWLHGTPPSQFSRAPLATDGCLVLANPDLERLLKTVE 321


>gi|328953401|ref|YP_004370735.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobacca acetoxidans DSM
           11109]
 gi|328453725|gb|AEB09554.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobacca acetoxidans DSM
           11109]
          Length = 215

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 72/222 (32%), Gaps = 51/222 (22%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSE---------------------NLII 39
           M   +  L  A  +F+ G   S+  +  A  P                          ++
Sbjct: 1   MRRIWLFLGVAALLFVMGGCSSQKPLVTAVPPEEMEADIEEEENIDPRYRADQRVVKEVL 60

Query: 40  SMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQ 99
                R     PTV+ + K    L +++         LK Y +         K+  GD  
Sbjct: 61  QENHYRKRGKKPTVLLVHKESRKLTVFRGTT-----PLKTYPVVLGRNPRNDKLRQGDMC 115

Query: 100 APEGFYYIGWNNLNPNSKYFLSINIGFPN-------EFDKAHNR------TGADLMIHGE 146
            PEG Y +      P++K+   I + +P           K   +       G ++ IHG 
Sbjct: 116 TPEGIYKVVCKF--PHAKWNKFILLNYPTTKNWLKFAEAKKRGKIPITADIGGEIGIHGT 173

Query: 147 ----------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQSH 178
                       + GC ++ NK + EIY ++ D     +Q  
Sbjct: 174 EDDLKNLTGENWTLGCVSLRNKHLDEIYPLIEDGSLVVIQRK 215


>gi|317009506|gb|ADU80086.1| conserved hypothetical secreted protein [Helicobacter pylori
           India7]
          Length = 330

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                    + Y    N +F     +  + F++  +  F +   K+  F  
Sbjct: 224 KEAWARGEFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKRIAFSS 274


>gi|89900141|ref|YP_522612.1| ErfK/YbiS/YcfS/YnhG [Rhodoferax ferrireducens T118]
 gi|89344878|gb|ABD69081.1| ErfK/YbiS/YcfS/YnhG [Rhodoferax ferrireducens T118]
          Length = 414

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 61/171 (35%), Gaps = 16/171 (9%)

Query: 11  ALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNV 70
           A    L+       +  KA      +  +  Q    S  +   I I  + + L + +   
Sbjct: 113 AAAPVLDQLRDESQMRLKALRERPPSGALPSQFLALSARNKHAIAIDASRSRLYLLENRP 172

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS----KYFLSINIGF 126
                L+ +Y +         K   GD + P G Y+I  +NL+P S        ++ I +
Sbjct: 173 TG-LTLIADYYVSIGKSGLS-KNAEGDLRTPMGVYFIT-SNLDPKSLKDFYGSGALPINY 229

Query: 127 PNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIVR 168
           PN  D    +TG  + +HG           A+ GC  + N  +  +   V 
Sbjct: 230 PNVLDNLRGKTGGGIWLHGTPPGQFSRPPLATDGCVVLANPDLMALIRTVE 280


>gi|147667744|gb|ABQ45838.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 71/231 (30%), Gaps = 28/231 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +   Y  V     +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           T  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 228 TRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|147667730|gb|ABQ45831.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 71/231 (30%), Gaps = 28/231 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQM---QEIYAIVRDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +    +I      +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENPLLSSYDKILK-GEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           T  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 228 TRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|261838238|gb|ACX98004.1| hypothetical protein KHP_0800 [Helicobacter pylori 51]
          Length = 330

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 70/230 (30%), Gaps = 28/230 (12%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++ + +     +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRMT 189
              + GC A+ N  +   Y  V     +     +                 +  +    T
Sbjct: 170 ELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAWT 228

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
             + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 229 GGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|147667736|gb|ABQ45834.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 70/230 (30%), Gaps = 28/230 (12%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++ + +     +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRMT 189
              + GC A+ N  +   Y  V     +     +                 +  +    T
Sbjct: 170 ELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAWT 228

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
             + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 229 RGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|157737873|ref|YP_001490557.1| hypothetical protein Abu_1640 [Arcobacter butzleri RM4018]
 gi|157699727|gb|ABV67887.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 323

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 77/208 (37%), Gaps = 25/208 (12%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                   VI   K    + ++ +N D    + K+  I       G K   GD++ PEG 
Sbjct: 61  GFYETKEYVIIAEKENKKMTLFAKNGDDYKQISKDSMIV--GEKAGDKFLEGDKKTPEGA 118

Query: 105 YYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------ASAGCYAMN 156
           + +       +  Y   ++   +PN FDK+ ++ G  + IHG          + GC A++
Sbjct: 119 FELVQKRTGLDQFYGPFALVTEYPNTFDKSLDKKGHGIWIHGMPFNGDREKFTQGCLALD 178

Query: 157 NKQMQEIYAIVR----------DSLRGNMQSHI-----QIQAFPFRMTSKNMQLYQNNPN 201
           N++++ +   +           D  +   ++ I      I  +       N++ Y +  +
Sbjct: 179 NEKLETLAKNIDYKKTVLITSGDEFKKASKNDIALILSSIYKWKDAWKYSNIEEYLSYYS 238

Query: 202 YSFWNMLKLGHDYFEKNHQEPFIQIINK 229
             F    +     FE   ++ F +   K
Sbjct: 239 KDFKRADQSDFKKFETQKRQIFAKNETK 266


>gi|317010762|gb|ADU84509.1| hypothetical protein HPSA_02490 [Helicobacter pylori SouthAfrica7]
          Length = 330

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 68/226 (30%), Gaps = 28/226 (12%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++ N D     +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVADKSKPNLEFYEIN-DNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRMT 189
              + GC A+ N+ +   Y        +     +                 +  +     
Sbjct: 170 ELNTKGCIAIENQLLSS-YDKALKGEKAFLITYEDKFFPSTKEELSMILSALFQWKDAWA 228

Query: 190 SKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
             + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 229 KGDFERYMGFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|298530698|ref|ZP_07018100.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510072|gb|EFI33976.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 421

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 54/134 (40%), Gaps = 13/134 (9%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             S     +  + K      ++            ++++    G  G K   GD + PEG 
Sbjct: 26  GDSRAPEDLFVVDKKNQTFFVFSNKS--PLRKEYKWEVTTGEG-VGDKEVEGDLKTPEGI 82

Query: 105 YYI----GWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYA 154
           Y+I       +L+ +    + + + +PN  D+A  +TG  + +HG         + GC A
Sbjct: 83  YFIERQIDTRHLDRDLYGEMGLTLNYPNPVDRAKGKTGFGIWLHGRGKEVVPFDTEGCVA 142

Query: 155 MNNKQMQEIYAIVR 168
           M+ K M  +  +V+
Sbjct: 143 MDMKYMHRLEDMVQ 156


>gi|298736229|ref|YP_003728755.1| hypothetical protein HPB8_734 [Helicobacter pylori B8]
 gi|298355419|emb|CBI66291.1| conserved hypothetical secreted protein [Helicobacter pylori B8]
          Length = 330

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +   Y  V     +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKFFPSTKEELSMILSSLFQWKEAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           T  + + Y    + +F     +  + F++  +  F +   K   F  
Sbjct: 228 TRGDFERYMRFYSPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|317013935|gb|ADU81371.1| hypothetical protein HPGAM_02645 [Helicobacter pylori Gambia94/24]
          Length = 330

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 69/227 (30%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQ---------IQAFPFRMTSK- 191
               + GC A+ N  +   Y  V     +     +             + +  F+     
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKFSPSTKEELSMVLSSLFQWKEAW 227

Query: 192 ---NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              + + Y    N  F     +  + F++  +  F +   K   F  
Sbjct: 228 ARGDFERYMRFYNPDFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|317181838|dbj|BAJ59622.1| conserved hypothetical secreted protein [Helicobacter pylori F57]
          Length = 330

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 69/231 (29%), Gaps = 28/231 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +   Y        +     +                 +  +    
Sbjct: 169 NELNTKGCIAIENSLLSS-YDKALKGEKAFLITYEDKFFPSTKEELSMVLSSLFQWKEAW 227

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
           T  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 228 TRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|317154207|ref|YP_004122255.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944458|gb|ADU63509.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 419

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 12/126 (9%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
           +   P ++ + K    L + +R   +    ++ +  C      G K   GD + PEG Y+
Sbjct: 30  AYGPPRLVAVDKTAQTLIMLER--QSPLREIRRFP-CTTGQADGDKRVEGDLRTPEGVYF 86

Query: 107 IG---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNN 157
           +G      L       ++  + +PN  D+   +TG  + IHG         + GC A+  
Sbjct: 87  VGHRIKRKLEWGLYGDIAYALNYPNPVDRIKGKTGGGIWIHGRGKEFVPRDTQGCVALKV 146

Query: 158 KQMQEI 163
             M+++
Sbjct: 147 PDMRDV 152


>gi|296273934|ref|YP_003656565.1| ErfK/YbiS/YcfS/YnhG family protein [Arcobacter nitrofigilis DSM
           7299]
 gi|296098108|gb|ADG94058.1| ErfK/YbiS/YcfS/YnhG family protein [Arcobacter nitrofigilis DSM
           7299]
          Length = 320

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 90/270 (33%), Gaps = 38/270 (14%)

Query: 1   MTNRYNILLFALFIFLNG-------------CHHSRSLIDKAEHPLSENLIISMQKKRTS 47
           M     ++L     +L                        K+E   S+ L     +    
Sbjct: 1   MKKIAFLVLVLFNTYLLADFVTIYRTMGIDEVQKELDKQLKSEKYWSKYLENIDVRYGYY 60

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
                V+   K     E++KR       +L +  I       G K   GD + P G Y +
Sbjct: 61  ESKKYVLVADKLSKKFELFKREDKKFLKILTQTMIS--GEKDGDKFLEGDLKTPIGAYKL 118

Query: 108 GWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------ASAGCYAMNNKQ 159
                  +  Y  L++   +PN FDK+ N+ G  + IHG          + GC A++N+ 
Sbjct: 119 TRKLTKLDQFYGPLALVTNYPNTFDKSLNKEGHGIWIHGMPYEESRSDYTKGCIALDNES 178

Query: 160 M----------QEIYAIVRDSLRGNMQSHI-QIQAFPFRMTSK----NMQLYQNNPNYSF 204
           +          + +  I    +    +  + ++ AF F  T      +   Y +  +  F
Sbjct: 179 LVALDKSINYDESVLLISEKDIEPTTKKEMSEVLAFIFSWTDAWRVSDTNTYLSYYSKDF 238

Query: 205 WNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
                   D F+K+ +  F +  +K   F 
Sbjct: 239 KRANGQNFDAFKKHKEYIFSRKEDKTIKFS 268


>gi|217033182|ref|ZP_03438635.1| hypothetical protein HPB128_184g5 [Helicobacter pylori B128]
 gi|216945091|gb|EEC23798.1| hypothetical protein HPB128_184g5 [Helicobacter pylori B128]
          Length = 321

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 42  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 99

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 100 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 159

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHI-------------QIQAFPFRM 188
               + GC A+ N  +   Y  V     +     +                 +  +    
Sbjct: 160 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKFFPSTKEELSMILSSLFQWKEAW 218

Query: 189 TSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
           T  + + Y    + +F     +  + F++  +  F +   K   F  
Sbjct: 219 TRGDFERYMRFYSPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 265


>gi|332673691|gb|AEE70508.1| conserved hypothetical secreted protein [Helicobacter pylori 83]
          Length = 330

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|302879533|ref|YP_003848097.1| ErfK/YbiS/YcfS/YnhG family protein [Gallionella capsiferriformans
           ES-2]
 gi|302582322|gb|ADL56333.1| ErfK/YbiS/YcfS/YnhG family protein [Gallionella capsiferriformans
           ES-2]
          Length = 387

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 65/148 (43%), Gaps = 16/148 (10%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG-PK 92
            + L       + +      + +  + + L ++  NV  E   + ++ +    G  G  K
Sbjct: 109 PQTLHAPQYLWQLNAQQKFALVVDTSRSTLYVY-ENVKGEPRYVTDFYVTI--GKLGTEK 165

Query: 93  IETGDEQAPEGFYYIG---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA- 148
           + TGD++ P G Y+I      N   +     +  + +PNE+DK +NRTG+ + +HG  + 
Sbjct: 166 VSTGDQRTPLGVYFIQANLPKNQLADMYGSGAFPLSYPNEWDKRNNRTGSGIWLHGTSSD 225

Query: 149 --------SAGCYAMNNKQMQEIYAIVR 168
                   S GC  +NN  + ++   ++
Sbjct: 226 TYSRPPRASNGCVVLNNDDLNKLAPYLQ 253


>gi|308184325|ref|YP_003928458.1| conserved hypothetical secreted protein [Helicobacter pylori
           SJM180]
 gi|308060245|gb|ADO02141.1| conserved hypothetical secreted protein [Helicobacter pylori
           SJM180]
          Length = 330

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|208434440|ref|YP_002266106.1| conserved hypothetical secreted protein [Helicobacter pylori G27]
 gi|208432369|gb|ACI27240.1| conserved hypothetical secreted protein [Helicobacter pylori G27]
          Length = 330

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|296134919|ref|YP_003642161.1| ErfK/YbiS/YcfS/YnhG family protein [Thiomonas intermedia K12]
 gi|295795041|gb|ADG29831.1| ErfK/YbiS/YcfS/YnhG family protein [Thiomonas intermedia K12]
          Length = 447

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 53/149 (35%), Gaps = 14/149 (9%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
                I+      +P     I +    + L ++++  +    L   Y         G K 
Sbjct: 186 PPTGAIAANLVALAPDVQRAIVVDTARSRLYLFEQ-RNGVPQLEASYYFSQGKFGAG-KT 243

Query: 94  ETGDEQAPEGFYYIGWNNLNPNS---KYFLSINIGFPNEFDKAHNRTGADLMIHGEC--- 147
           + GD + P G Y+I       +        ++ + +PNE+DK    TG  + +HG     
Sbjct: 244 QIGDMKTPLGIYFITRKIGAKDLKPLYGAGALTLNYPNEWDKQQGHTGFGVWLHGTPPGS 303

Query: 148 ------ASAGCYAMNNKQMQEIYAIVRDS 170
                 AS GC  ++N  +  + A     
Sbjct: 304 YARVPLASDGCVVLSNPDVLSLMANTPAG 332


>gi|147667752|gb|ABQ45842.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|57242223|ref|ZP_00370162.1| conserved hypothetical secreted protein [Campylobacter upsaliensis
           RM3195]
 gi|57016903|gb|EAL53685.1| conserved hypothetical secreted protein [Campylobacter upsaliensis
           RM3195]
          Length = 316

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 80/219 (36%), Gaps = 30/219 (13%)

Query: 43  KKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPE 102
                     +++  KN+ IL+++           ++ ++   +G  G K + GD + P 
Sbjct: 48  SLGYYTQDVMIVKTNKNDKILKVFSYTNGKIKKEFEQKEV--ITGLMGDKEKEGDLKTPV 105

Query: 103 GFYYIGWNNLNPNSKYFL--SINIGFPNEFDKAHNRTGADLMIHGEC---------ASAG 151
           GFY +G    NP  +Y+   +    +PN  DK  ++TG  + IHG            + G
Sbjct: 106 GFYELGMK-FNPGDQYYGPFAFATSYPNLLDKVQDKTGGGIWIHGYPLDGTRLDEFKTRG 164

Query: 152 CYAMNNKQMQE---------IYAIVRDSLRGNMQSH------IQIQAFPFRMTSKNMQLY 196
           C A+ N ++++         +Y +  +      +          + A+ +  T  ++  Y
Sbjct: 165 CIALFNDKLEDFAKIVAGKKVYVLTEEKDNVRAKKEEIASLMADLFAWKYAWTVSDVNAY 224

Query: 197 QNNP-NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
                   F    K     F    +  F +  +K   F 
Sbjct: 225 LAFYDEKDFKRFDKSSFSQFASMKKIIFARKEHKIIKFS 263


>gi|147667738|gb|ABQ45835.1| conserved hypothetical secreted protein [Helicobacter pylori]
 gi|317177644|dbj|BAJ55433.1| conserved hypothetical secreted protein [Helicobacter pylori F16]
          Length = 330

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNITFSSVSVI 278


>gi|147667748|gb|ABQ45840.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNVFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|253827436|ref|ZP_04870321.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253510842|gb|EES89501.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 331

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 68/201 (33%), Gaps = 26/201 (12%)

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
               L+++          L    +    G  G K + GD   P G Y +    +N +  Y
Sbjct: 77  ESPKLKLYALENGKWVERLNANSLVGSKG--GNKQKEGDLATPIGVYTLEKRLVNLDQYY 134

Query: 119 -FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV-- 167
             L+    +PN +D+   RTG  + IHG           + GC A+ N  +  +  I+  
Sbjct: 135 GPLAFTTSYPNLYDRLQKRTGYGIWIHGMPLNGNREELNTRGCIAIENNLLTTVDQIIDY 194

Query: 168 RDSLRGNMQSHI------QIQA-------FPFRMTSKNMQLYQNNPNYSFWNMLKLGHDY 214
           RDSL     + I       ++        +     +  +    +     F       ++ 
Sbjct: 195 RDSLLITFSNEIKEVKKQDLEIILSNLFQWKEAWKNNVIDTCLSFYGEDFIRYDGQKYNA 254

Query: 215 FEKNHQEPFIQIINKQYVFFK 235
           F    ++ F +   K   F K
Sbjct: 255 FAAVKRQIFGKGEEKNIQFNK 275


>gi|317179115|dbj|BAJ56903.1| conserved hypothetical secreted protein [Helicobacter pylori F30]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQM---QEIYAIVRDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +    +I      +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSSYDKILK-GEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|315586801|gb|ADU41182.1| conserved hypothetical secreted protein [Helicobacter pylori 35A]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWVRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|307637196|gb|ADN79646.1| putative periplasmic protein [Helicobacter pylori 908]
 gi|325995785|gb|ADZ51190.1| putative periplasmic protein [Helicobacter pylori 2018]
 gi|325997381|gb|ADZ49589.1| putative periplasmic protein [Helicobacter pylori 2017]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 69/227 (30%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQ---------IQAFPFRMTSK- 191
               + GC A+ N  +   Y  V     +     +             I +  F+     
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKFSPSTKEELSMILSSLFQWKEAW 227

Query: 192 ---NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              + + Y    N  F     +  + F++  +  F +   K   F  
Sbjct: 228 ARGDFERYMRFYNPDFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|255322067|ref|ZP_05363215.1| 60 kDa chaperonin [Campylobacter showae RM3277]
 gi|255300880|gb|EET80149.1| 60 kDa chaperonin [Campylobacter showae RM3277]
          Length = 311

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 69/172 (40%), Gaps = 16/172 (9%)

Query: 1   MTNRYNILLFALFI--FLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           M     +L+F  F    L     + + +  A++ L + L  +  +         +I + K
Sbjct: 1   MKKLLGLLIFYAFFSQILLAEALADANLTGAKYWL-KKLGAADVRYGYYEAKTKIIVVNK 59

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            +  L+ ++        L + +     +G  G K + GD + P G Y +       +  Y
Sbjct: 60  AQKTLQSFEYAGG---ALKEIFSQSVITGKSGDKFKEGDLKTPVGVYDVTDKFTPSDPFY 116

Query: 119 -FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQM 160
             L++++ +PN  DKA  +TG  + IHG            + GC A NN  +
Sbjct: 117 GPLAMSLSYPNAHDKAAQKTGGGIWIHGLPMKGKRDDEVKTRGCVAFNNDAL 168


>gi|147667740|gb|ABQ45836.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  TEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|210134719|ref|YP_002301158.1| hypothetical protein HPP12_0524 [Helicobacter pylori P12]
 gi|210132687|gb|ACJ07678.1| hypothetical protein HPP12_0524 [Helicobacter pylori P12]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|301166595|emb|CBW26171.1| putative periplasmic protein [Bacteriovorax marinus SJ]
          Length = 346

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 63/182 (34%), Gaps = 33/182 (18%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
           N L F LF               AE  L   L++  +      F   V+   K+ + L +
Sbjct: 4   NYLSFILFFLSVNASF-------AETYLPAQLLMLDEN-----FSHHVVLAEKSTHTLYL 51

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS--------- 116
           +K N +    L+ +Y +       G K+  GD + PEG Y       + +          
Sbjct: 52  FK-NENGNPQLVNKYPMATGK-KAGDKLFQGDHRTPEGIYSFTDFLTHQDLLNRHGKQGQ 109

Query: 117 -KYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAI 166
                +  + +PN  DK + +TG  + +H             S GC    N  + E+   
Sbjct: 110 IYGVGAFVMNYPNPIDKRNGKTGGGIWLHSTNDETRIDKGLDSRGCVVATNSNLIELSKF 169

Query: 167 VR 168
           + 
Sbjct: 170 IE 171


>gi|147667734|gb|ABQ45833.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ N +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEIN-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWIRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|147667726|gb|ABQ45829.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|217034386|ref|ZP_03439801.1| hypothetical protein HP9810_889g31 [Helicobacter pylori 98-10]
 gi|216943181|gb|EEC22651.1| hypothetical protein HP9810_889g31 [Helicobacter pylori 98-10]
          Length = 321

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 42  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 99

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 100 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 159

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 160 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 214

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 215 KEAWVRGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 265


>gi|294338856|emb|CAZ87190.1| conserved hypothetical protein; putative exported protein
           [Thiomonas sp. 3As]
          Length = 434

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/144 (20%), Positives = 53/144 (36%), Gaps = 14/144 (9%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
                I+      +P     I +    + L ++++  +    L   Y         G K 
Sbjct: 173 PPTGAIAANLVALAPDVQRAIVVDTARSRLYLFEQ-RNGVPQLEASYYFSQGKFGAG-KT 230

Query: 94  ETGDEQAPEGFYYIGWNNLNPNS---KYFLSINIGFPNEFDKAHNRTGADLMIHGEC--- 147
           + GD + P G Y+I       +        ++ + +PNE+DK    TG  + +HG     
Sbjct: 231 QIGDMKTPLGIYFITRKIGAKDLKPLYGAGALTLNYPNEWDKQQGHTGFGVWLHGTPPGS 290

Query: 148 ------ASAGCYAMNNKQMQEIYA 165
                 AS GC  ++N  +  + A
Sbjct: 291 YARVPLASDGCVVLSNPDVLSLMA 314


>gi|308272917|emb|CBX29521.1| hypothetical protein N47_J05020 [uncultured Desulfobacterium sp.]
          Length = 233

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 53/132 (40%), Gaps = 23/132 (17%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I + K+E  L ++K       V +  Y +         K  +GD   PEG Y I     
Sbjct: 85  AIIVNKSERTLVLYKNG-----VPVWTYNVGLGRNGSLDKQRSGDNSTPEGKYRIT--QK 137

Query: 113 NPNSKYFLSINIGFPNEFDK-------------AHNRTGADLMIHGECA---SAGCYAMN 156
              S+Y  ++ + +PNE D+             A    G  + IHG      + GC AM+
Sbjct: 138 KSESRYHKALLLNYPNEEDRKNFILAKKNGLIPAKAGIGGLIEIHGGGRNSMTYGCIAMD 197

Query: 157 NKQMQEIYAIVR 168
           N ++  I+ IV 
Sbjct: 198 NSKIDHIFKIVP 209


>gi|297379710|gb|ADI34597.1| Hypothetical protein HPV225_0513 [Helicobacter pylori v225d]
          Length = 330

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 72/234 (30%), Gaps = 36/234 (15%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++ + +     +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L++   +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLALVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRMT 189
              + GC A+ N  +   Y  V     +     +       FP             F+  
Sbjct: 170 ELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQWK 224

Query: 190 SK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                 + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 225 EAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|15611534|ref|NP_223185.1| hypothetical protein jhp0467 [Helicobacter pylori J99]
 gi|4154995|gb|AAD06036.1| putative [Helicobacter pylori J99]
          Length = 330

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 70/227 (30%), Gaps = 28/227 (12%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQ---------IQAFPFRMTSK- 191
               + GC A+ N  +   Y  V     +     +             I +  F+     
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKFSPSTKEELSMILSSLFQWKEAW 227

Query: 192 ---NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 228 ARGDFERYMRFYNPNFTRYDGMSFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|308061845|gb|ADO03733.1| conserved hypothetical secreted protein [Helicobacter pylori Cuz20]
          Length = 330

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 71/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y        +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKALKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|147667742|gb|ABQ45837.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 72/235 (30%), Gaps = 36/235 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLDRLDQYYGVLAFVTNYPNLYDTLKKRTGYGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                  + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|254779460|ref|YP_003057565.1| hypothetical protein HELPY_0829 [Helicobacter pylori B38]
 gi|254001371|emb|CAX29356.1| Conserved hypothetical protein; putative signal peptide
           [Helicobacter pylori B38]
          Length = 330

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|317180294|dbj|BAJ58080.1| conserved hypothetical secreted protein [Helicobacter pylori F32]
          Length = 330

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 69/231 (29%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQM---QEIYAIVRDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +    +I      +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSSYDKILK-GEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N  F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPDFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|317012334|gb|ADU82942.1| hypothetical protein HPLT_02565 [Helicobacter pylori Lithuania75]
          Length = 330

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 70/230 (30%), Gaps = 36/230 (15%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++ + +     +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRMT 189
              + GC A+ N  +   Y  V     +     +       FP             F+  
Sbjct: 170 ELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQWK 224

Query: 190 SK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                 + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 225 EAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKHIAFSS 274


>gi|108562917|ref|YP_627233.1| hypothetical protein HPAG1_0492 [Helicobacter pylori HPAG1]
 gi|107836690|gb|ABF84559.1| conserved hypothetical secreted protein [Helicobacter pylori HPAG1]
          Length = 330

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEGKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|223038983|ref|ZP_03609275.1| 60 kDa chaperonin [Campylobacter rectus RM3267]
 gi|222879956|gb|EEF15045.1| 60 kDa chaperonin [Campylobacter rectus RM3267]
          Length = 313

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 66/174 (37%), Gaps = 18/174 (10%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPF----HPTVIRI 56
           M  +    LF +F  L+    +   +  A    ++     +     +         +I +
Sbjct: 1   MVLKKIFDLF-IFSVLSSQILAAQNLTDANLTSAKYWRSKLTDANVTYGYYEKKTKIIVV 59

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
            K +  L  ++        L + +     +G  G K + GD + P G Y I      P+ 
Sbjct: 60  NKAQKTLHGFEYAGG---ALEQTFSQNVITGKSGDKFKEGDLKTPVGVYDIIDKFTPPDP 116

Query: 117 KY-FLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQM 160
            Y  L++++ +PN  DKA  +TG  + IHG            + GC A +N  +
Sbjct: 117 FYGPLAMSLSYPNAHDKAAKKTGGGIWIHGLPMNGKREDEVRTRGCVAFDNDAL 170


>gi|188527645|ref|YP_001910332.1| conserved hypothetical secreted protein [Helicobacter pylori
           Shi470]
 gi|188143885|gb|ACD48302.1| conserved hypothetical secreted protein [Helicobacter pylori
           Shi470]
 gi|308063686|gb|ADO05573.1| conserved hypothetical secreted protein [Helicobacter pylori
           Sat464]
          Length = 330

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 69/234 (29%), Gaps = 36/234 (15%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
           E L               +    K++  LE ++         +   K    S   G K  
Sbjct: 52  EELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEI-ESNMLKKINSSKALVGS-KKGDKTL 109

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
            GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG        
Sbjct: 110 EGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDRN 169

Query: 148 --ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRMT 189
              + GC A+ N  +   Y  V     +     +       FP             F+  
Sbjct: 170 ELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQWK 224

Query: 190 SK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKGQTI 239
                 + + Y    N +F     +  + F++  +  F +   K   F     I
Sbjct: 225 EAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSSISVI 278


>gi|323700390|ref|ZP_08112302.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio sp. ND132]
 gi|323460322|gb|EGB16187.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio desulfuricans
           ND132]
          Length = 419

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/162 (17%), Positives = 63/162 (38%), Gaps = 21/162 (12%)

Query: 11  ALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNV 70
             F  L     + + +     PL  +          S     +I + K    L + ++  
Sbjct: 3   VAFFVLTLVLSATTAVAGGWAPLLSS---------HSYGPKRIIAVDKEAQELIVLEQ-- 51

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYFLSINIGFP 127
            +    ++ +  C    + G K   GD + P G Y++G      L+ +    ++ ++ +P
Sbjct: 52  QSPLHEVRRFP-CTTGQSMGDKAVEGDMRTPVGVYFVGHRINRTLDWDLYGNIAYSLNYP 110

Query: 128 NEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQMQEI 163
           N  D+   +TG+ + +HG         + GC A+    M+++
Sbjct: 111 NPIDRIKGKTGSGIWLHGRGKTFLPRDTLGCVALKVPDMKDV 152


>gi|319790530|ref|YP_004152163.1| ErfK/YbiS/YcfS/YnhG family protein [Thermovibrio ammonificans HB-1]
 gi|317115032|gb|ADU97522.1| ErfK/YbiS/YcfS/YnhG family protein [Thermovibrio ammonificans HB-1]
          Length = 355

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 56/124 (45%), Gaps = 11/124 (8%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I + K   +L + +      + +++++  C      G K+E GD++ PEG Y+  +   
Sbjct: 93  AIVVDKTNEVLYVIRMENGVPF-IVRKFP-CITGKRPGDKLEEGDQRTPEGIYFPMYWET 150

Query: 113 NPNSKYF-LSINIGFPNEFDK-AHNRTGADLMIHGEC-------ASAGCYAMNNKQMQEI 163
           N    Y   +  + +PN  D+    R G  + IHG         ++ GC  + N+ ++E+
Sbjct: 151 NLPPIYGIGAFPLNYPNLLDRKILKRNGHGIWIHGTNNPNRPPHSTNGCIVLKNEYLREL 210

Query: 164 YAIV 167
             ++
Sbjct: 211 KKLI 214


>gi|308182672|ref|YP_003926799.1| hypothetical protein HPPC_02545 [Helicobacter pylori PeCan4]
 gi|308064857|gb|ADO06749.1| hypothetical protein HPPC_02545 [Helicobacter pylori PeCan4]
          Length = 330

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 69/231 (29%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
            E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  VEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENP-ILSSYDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|147667728|gb|ABQ45830.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|319957804|ref|YP_004169067.1| erfk/ybis/ycfs/ynhg family protein [Nitratifractor salsuginis DSM
           16511]
 gi|319420208|gb|ADV47318.1| ErfK/YbiS/YcfS/YnhG family protein [Nitratifractor salsuginis DSM
           16511]
          Length = 188

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 35/191 (18%), Positives = 66/191 (34%), Gaps = 35/191 (18%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M+     L  AL ++L GC                  I     +         + I + E
Sbjct: 1   MSKIVIGLTAALALWLGGCGAPTGKPGGRYSAKDCKPIPFRPDRAADK-----VVIKQRE 55

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTF--GPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
           + + ++         ++K ++      T   GPK++ GD   P G Y I     +     
Sbjct: 56  HKVYVYHNG-----KVIKVFRSSLGKNTMSRGPKVQQGDFCTPVGHYRIVDKRCHALK-- 108

Query: 119 FLSINIGFPNEFDKAHNR-----TGADLMIHGEC----------------ASAGCYAMNN 157
           + ++ I +PN  D A  +      G  +  HG+                  + GC A+ N
Sbjct: 109 YRAMTISYPNTEDLARAKKLGVKPGDYITFHGQPYWNRDGHGDEYTLKHDWTNGCIALTN 168

Query: 158 KQMQEIYAIVR 168
           K +  +++ V+
Sbjct: 169 KDLDWLWSAVK 179


>gi|15645145|ref|NP_207315.1| hypothetical protein HP0518 [Helicobacter pylori 26695]
 gi|2313633|gb|AAD07586.1| conserved hypothetical secreted protein [Helicobacter pylori 26695]
          Length = 330

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 70/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++   +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEI-ENNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|261839650|gb|ACX99415.1| hypothetical protein HPKB_0823 [Helicobacter pylori 52]
          Length = 330

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVANKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQM---QEIYAIVRDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +    +I      +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSSYDKILK-GEKAFLITYEDKF----FPSTKEELSMILSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFERYMRFYNPNFTRYDGMQFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|308270997|emb|CBX27607.1| hypothetical protein N47_H24290 [uncultured Desulfobacterium sp.]
          Length = 166

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 22/111 (19%)

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR-- 136
            Y         G K + GD + PEG Y I     + +S+++ S+++ +PN  D   ++  
Sbjct: 52  SYNAALGR-KSGRKAQKGDNRTPEGLYIIV--QHDADSRFYKSLHLSYPNRSDIIRSQKS 108

Query: 137 ---TGADLMIHGEC--------------ASAGCYAMNNKQMQEIYAIVRDS 170
               G  L IHG                 + GC A++N++M EI+ +V + 
Sbjct: 109 GYPPGNALAIHGLPEGFEDLGTFQSKRNWTKGCIAVSNEEMDEIWELVENG 159


>gi|147667750|gb|ABQ45841.1| conserved hypothetical secreted protein [Helicobacter pylori]
          Length = 330

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 36/231 (15%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKI 93
           +E L               +    K++  LE ++ + +     +   K    S   G K 
Sbjct: 51  AEELQNKDTDFGYYQNKQFLFVADKSKPSLEFYEID-NNMLKKINSSKALVGS-KKGDKT 108

Query: 94  ETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC----- 147
             GD   P G Y I       +  Y  L+    +PN +D    RTG  + +HG       
Sbjct: 109 LEGDLATPIGVYRITQKLERLDQYYGVLAFVTNYPNLYDTLKKRTGHGIWVHGMPLNGDR 168

Query: 148 ---ASAGCYAMNNKQMQEIYAIV---RDSLRGNMQSHIQIQAFP-------------FRM 188
               + GC A+ N  +   Y  V     +     +       FP             F+ 
Sbjct: 169 NELNTKGCIAIENPLLSS-YDKVLKGEKAFLITYEDKF----FPSTKEELSMVLSSLFQW 223

Query: 189 TSK----NMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
                  + + Y    N +F     +  + F++  +  F +   K   F  
Sbjct: 224 KEAWARGDFEGYMRFYNPNFTRYDGMKFNAFKEYKKRVFAKNEKKNIAFSS 274


>gi|85859285|ref|YP_461487.1| TPR repeat-containing protein [Syntrophus aciditrophicus SB]
 gi|85722376|gb|ABC77319.1| tetratricopeptide repeat family protein [Syntrophus aciditrophicus
           SB]
          Length = 498

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 46/124 (37%), Gaps = 11/124 (8%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            S      + I K    L ++         + +    C+     G K+ +GD + PEG +
Sbjct: 59  VSLTSGFAVIIDKKAQKLYVYGTRNGQFRKVFET--RCSTGKNQGDKLTSGDARTPEGIF 116

Query: 106 YIGWNNLNPNS---KYFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMN 156
           +      +         L+  + +PN  DK   + G ++ IHG         S GC  ++
Sbjct: 117 FPTRKFTDDELTPIYGTLAFTLDYPNYLDKRTGKNGHNIWIHGTDKTLKSFQSNGCIVLD 176

Query: 157 NKQM 160
           N  +
Sbjct: 177 NSDI 180


>gi|218886565|ref|YP_002435886.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757519|gb|ACL08418.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 432

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 12/118 (10%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN- 111
           ++ + K +  L I++R   +   L   Y +C      G K   GD + PEG Y++     
Sbjct: 47  LVAVDKEDQKLHIYER--HSPLKLAASY-VCTTGQATGDKQTAGDLKTPEGIYFVVNKLS 103

Query: 112 --LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQMQ 161
             L+      ++  + +PN  DK   +TG+ + IH +        + GC A+N   + 
Sbjct: 104 AGLDMEMYGGIAYTLNYPNPVDKLRRKTGSGIWIHSKGHDIVPRETKGCIALNRADID 161


>gi|301166890|emb|CBW26468.1| conserved hypothetical protein [Bacteriovorax marinus SJ]
          Length = 190

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 66/197 (33%), Gaps = 63/197 (31%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI---CAWSGTF---G 90
            ++ +     +    T I + K++  +++W  N      + K Y I    A++       
Sbjct: 9   TLLILSFSGFAKDKITQIVVLKDKREMQLWSGN-----EIYKVYNIKLSIAYNNPLFRAH 63

Query: 91  PKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR--------TGADLM 142
            K   GD Q P GFY I       N  +  S+ I +PN  DK + +         G  ++
Sbjct: 64  EKRREGDNQTPVGFYKISKKRQRTN--FPKSLLINYPNWKDKHNAKIRGIPEDEIGGMIL 121

Query: 143 IHGEC----------------------------------ASAGCYAMNNKQMQEIYAIVR 168
           IHG                                     + GC A+ +++M EI+ +V 
Sbjct: 122 IHGNPYRVNKTVRDYAAKLGIEADTVERWARDYFYPFFDWTNGCVAVTDEEMDEIFELVD 181

Query: 169 DSLRGNMQSHIQIQAFP 185
                       I  +P
Sbjct: 182 --------KDTPINIYP 190


>gi|291613141|ref|YP_003523298.1| ErfK/YbiS/YcfS/YnhG family protein [Sideroxydans lithotrophicus
           ES-1]
 gi|291583253|gb|ADE10911.1| ErfK/YbiS/YcfS/YnhG family protein [Sideroxydans lithotrophicus
           ES-1]
          Length = 388

 Score =  103 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 53/128 (41%), Gaps = 14/128 (10%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
           + SP     + +  +++ L ++  NV+ E   + ++ I         K+  GD++ P G 
Sbjct: 121 QLSPQQRYAVVVDTSKSTLYLF-ENVNGEPRYVSDFYISVGKKGA-DKVSEGDQKTPLGV 178

Query: 105 YYIGW---NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGC 152
           Y++      +   +     +  + +PNE+DK     G  + +HG           AS GC
Sbjct: 179 YFVNGHLGKDKITDFYGPSAYPLSYPNEWDKREGHDGHGIWLHGTPPDTFSRPPRASNGC 238

Query: 153 YAMNNKQM 160
             + N  +
Sbjct: 239 VVLANNDL 246


>gi|313673241|ref|YP_004051352.1| erfk/ybis/ycfs/ynhg family protein [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939997|gb|ADR19189.1| ErfK/YbiS/YcfS/YnhG family protein [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 471

 Score =  103 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 56/166 (33%), Gaps = 24/166 (14%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENIL 63
           R    L  + +  N  + S+ +         +   + +  K         IR        
Sbjct: 6   RIFFSLLIILLCHNAVYASKKIFADVMAKGVDKEKVFLVDKGMKKSFLVEIR-------- 57

Query: 64  EIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS---KYFL 120
                  D   VL+KE+         G K+  GD++ P G YY+                
Sbjct: 58  -------DDLPVLIKEFDDVIVGEGNGDKLREGDKKTPTGVYYVIGFIPQSKLDKIYGTG 110

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQM 160
           +  + +PN  DK + +TG  + IHG         S GC  + N+ +
Sbjct: 111 AFPLNYPNFVDKLYGKTGHGIWIHGRDPLEKKQVSKGCVVLKNEDI 156


>gi|220903383|ref|YP_002478695.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867682|gb|ACL48017.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 822

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 50/120 (41%), Gaps = 12/120 (10%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN- 111
           ++ + KN      +++       L   Y  C      G K    D + PEG Y++ +   
Sbjct: 54  LVAVDKNRQTFMFFEKKS--PLKLRYTYP-CTTGQLTGDKKVLNDLRTPEGVYFVEYKIA 110

Query: 112 --LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAMNNKQMQEI 163
             L+      ++  + +PN  DK   +TG  + IH +       ++ GC A+  K++ E+
Sbjct: 111 SGLDFKEYGGIAYTLNYPNPVDKLRGKTGHGIWIHSKGLGIEPLSTRGCVAIGLKEIDEV 170


>gi|239909259|ref|YP_002956001.1| hypothetical protein DMR_46240 [Desulfovibrio magneticus RS-1]
 gi|239799126|dbj|BAH78115.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 759

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 46/120 (38%), Gaps = 12/120 (10%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
            T  F    + + K      +  R      V + E+  CA     G K + GD + PEG 
Sbjct: 31  DTEWFPKLSVAVDKKSQAFFLLSRQS---PVRVAEFLPCATGQLLGDKFKEGDLRTPEGV 87

Query: 105 YYIGWNN---LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASA------GCYAM 155
           Y+I       LN      L+  + FPN  D    +TG  + IHG   S       GC A+
Sbjct: 88  YFIVRRKASGLNYELYGDLAFPLNFPNPADVVRKKTGHGIWIHGRGNSIVPYVTQGCVAL 147


>gi|114776723|ref|ZP_01451766.1| ErfK/YbiS/YcfS/YnhG [Mariprofundus ferrooxydans PV-1]
 gi|114552809|gb|EAU55240.1| ErfK/YbiS/YcfS/YnhG [Mariprofundus ferrooxydans PV-1]
          Length = 426

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 56/160 (35%), Gaps = 24/160 (15%)

Query: 22  SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVI-----------RIFKNENILEIWKRNV 70
           + + +++        L   M +       P  I              K  + + +++   
Sbjct: 116 ASADLNRGLGEADARLKAFMDRLDPISGEPVDILQPGPDVASIFMFDKARSRMFVYQPGE 175

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS---KYFLSINIGFP 127
           D     + +  +   S   G K   GD + P G Y                 ++  I +P
Sbjct: 176 DGRLKKITDEYVVTGSVK-GDKEHRGDGRTPNGIYRFIKKLQGKQLQAIYGPIAFPIDYP 234

Query: 128 NEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNK 158
           NE D+ H++ G+ + +HG            + GC++++NK
Sbjct: 235 NELDRLHHKDGSGIWLHGYPMDVSRRPPQDTRGCFSLSNK 274


>gi|160897527|ref|YP_001563109.1| ErfK/YbiS/YcfS/YnhG [Delftia acidovorans SPH-1]
 gi|160363111|gb|ABX34724.1| ErfK/YbiS/YcfS/YnhG [Delftia acidovorans SPH-1]
          Length = 499

 Score =  101 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 57/140 (40%), Gaps = 16/140 (11%)

Query: 34  SENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFG-PK 92
                +  +           I I  +++ L ++         L+ ++ +    G  G  K
Sbjct: 223 PPAGSVPGEFLMLGASVRHAIAIDASKSRLYLFAHEAGG-LRLVGDFYVSV--GKLGTDK 279

Query: 93  IETGDEQAPEGFYYIGWNNLNPNS---KYFLSINIGFPNEFDKAHNRTGADLMIHGEC-- 147
            + GD++ P G Y++G +   P         ++ + FPN++DKA  R+G+ + +HG    
Sbjct: 280 WQEGDQRTPLGIYFVGRHIPGPRLPEFYGKGALTVNFPNDWDKAVGRSGSGIWLHGSPPD 339

Query: 148 -------ASAGCYAMNNKQM 160
                  AS GC  + N  +
Sbjct: 340 QFSRAPEASDGCLVLANPDL 359


>gi|34557654|ref|NP_907469.1| hypothetical protein WS1291 [Wolinella succinogenes DSM 1740]
 gi|34483371|emb|CAE10369.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 322

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 73/216 (33%), Gaps = 26/216 (12%)

Query: 42  QKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP 101
            +         +    K  + L +++        L             G K   GD + P
Sbjct: 56  ARFGYYESVKYLFIADKALSELSLYQLGGKKPERLAHTK--ALMGSKKGDKRIEGDLKTP 113

Query: 102 EGFYYIGWNNLNPN-SKYFLSINIGFPNEFDKAHNRTGADLMIHGEC-------ASAGCY 153
            G Y +       +     L+    +PN +D    ++G+ + IHG          + GC 
Sbjct: 114 IGVYDLTAKLTRLDQLYGPLAFVTSYPNLYDSLQKKSGSGIWIHGLPLNGDREINTKGCI 173

Query: 154 AMNNKQMQEIYAIV--RDSLRGNM---------QSHIQIQAFPFRMTSK----NMQLYQN 198
           A++N+ ++ I   +  ++SL             +  + + +  FR  +     +++ Y  
Sbjct: 174 AIDNQLLKTIDGSINHKESLLITGDGNLFEVKNEELVILLSDLFRWRNAWKFNDLESYLG 233

Query: 199 NPNY-SFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
             +   F     +  + F    +  F +  NK  VF
Sbjct: 234 YYDKEDFLRFDGMKFEAFRDYKRRVFNKGENKTIVF 269


>gi|268316179|ref|YP_003289898.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodothermus marinus DSM 4252]
 gi|262333713|gb|ACY47510.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodothermus marinus DSM 4252]
          Length = 388

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 58/148 (39%), Gaps = 23/148 (15%)

Query: 39  ISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDE 98
           ++  +      +  +I + K      +++ +       L  + I       G K   GD 
Sbjct: 220 VAEARAEARRQNQWLIVVDKMARQCLVYRGDRQ-----LAVFPIELGPNWMGSKHYAGDR 274

Query: 99  QAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAH-------------NRTGADLMIHG 145
             PEG Y +        ++Y+ ++ + +PN  D+A               + G  + IHG
Sbjct: 275 ATPEGRYRVVRKLGPGETRYYRALLLDYPNAEDRARFARARREGLLPPGAKIGGLIEIHG 334

Query: 146 E-----CASAGCYAMNNKQMQEIYAIVR 168
           E       + GC A++N+ M+ +Y ++ 
Sbjct: 335 EGGRGADWTEGCVALHNQDMRRLYEMIP 362


>gi|152990313|ref|YP_001356035.1| hypothetical protein NIS_0564 [Nitratiruptor sp. SB155-2]
 gi|151422174|dbj|BAF69678.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 353

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 60/162 (37%), Gaps = 16/162 (9%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           G   S + +              ++     P   +VI + KNE  L++           +
Sbjct: 54  GDKTSAAFLLSLLQTDPHTDDKQLENLLVHPNSFSVIVVSKNEQKLKLIYGKNG----FI 109

Query: 78  KEYKI-CAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS---KYFLSINIGFPNEFD-K 132
           +  +I C      G K+E GD++ P G Y+  W              +  + +PN  D K
Sbjct: 110 QTIEIPCITGKRQGDKLEAGDKKTPNGVYFPKWFIPQEKLSKIYGVGAFPLNYPNIIDKK 169

Query: 133 AHNRTGADLMIHGEC-------ASAGCYAMNNKQMQEIYAIV 167
            +++TG  + +H          +S GC  + N+   +I   V
Sbjct: 170 IYHKTGDGIWLHATNDDKRKPFSSNGCVVVTNENFTKIKPFV 211


>gi|302343292|ref|YP_003807821.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfarculus baarsii DSM 2075]
 gi|301639905|gb|ADK85227.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfarculus baarsii DSM 2075]
          Length = 495

 Score =  100 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 64/156 (41%), Gaps = 11/156 (7%)

Query: 22  SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK 81
           S     + +   +E     +   +     P +I + K+     ++K     +  L  E+ 
Sbjct: 32  SSPCAAQTQPAAAEQPTSFIYCYQGRVDDPAIIVVDKSLQRAMVFKYL--GDMALQWEFP 89

Query: 82  ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN--SKYFLSINIGFPNEFDKAHNRTGA 139
            C      G K ++GD++ PEG Y+I     +         ++++ +PN  D    R G 
Sbjct: 90  -CGTGEKEGDKAQSGDQKTPEGVYFITHRYEDRKVTVFGDRALHLDYPNAIDCVDGRQGD 148

Query: 140 DLMIHGEC------ASAGCYAMNNKQMQEIYAIVRD 169
            + +HG        +S GC  ++N+ +  +  ++RD
Sbjct: 149 GIYLHGTNRDLRPRSSNGCITLDNRDLARLSQMIRD 184


>gi|158522215|ref|YP_001530085.1| hypothetical protein Dole_2204 [Desulfococcus oleovorans Hxd3]
 gi|158511041|gb|ABW68008.1| conserved hypothetical protein [Desulfococcus oleovorans Hxd3]
          Length = 466

 Score =  100 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 63/175 (36%), Gaps = 19/175 (10%)

Query: 4   RYNIL-LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
           R+  + + A  + L     S +       P        +           VI + K    
Sbjct: 18  RFFCVNMPAAAMALAVLGISGTGAQAFSIP-------DLVVYSEEDRPQYVILVEKATQQ 70

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS---KYF 119
           L ++    ++     K++K C+     GPK+  GD++ PEG Y+      +         
Sbjct: 71  LFLFSFYKNS-IRKEKQWK-CSTGENHGPKLVMGDKKTPEGIYFFTRKYTDSELAPIYGT 128

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQMQEIYAIVR 168
           L+  + +PN  D    + G+ + +HG         S GC A+ N  +  +   + 
Sbjct: 129 LAFPLDYPNVLDHEAEKNGSAIWLHGTNKVLKDNDSNGCVALENGSIDALAPYIE 183


>gi|317484503|ref|ZP_07943412.1| ykud domain-containing protein [Bilophila wadsworthia 3_1_6]
 gi|316924221|gb|EFV45398.1| ykud domain-containing protein [Bilophila wadsworthia 3_1_6]
          Length = 308

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 69/203 (33%), Gaps = 25/203 (12%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
                V+ + K+     + ++    +Y       +C      G K   GD + PEG Y++
Sbjct: 67  LPDQAVVAVDKSRQRFFLMEKGKARDY-------LCTTGQAQGDKQVRGDLKTPEGVYFV 119

Query: 108 GWNN---LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNK 158
                  L+       +  + +PN  D+   +TG+ + +H          S GC  +N K
Sbjct: 120 VRKRTERLDFEEYGGEAYILDYPNPVDRLRGKTGSGIWVHSRGRAITPFESRGCVVLNLK 179

Query: 159 QMQEIYA-IVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYF-- 215
            + E+   + R +     +    ++  P R  +      +     + W       D F  
Sbjct: 180 DIAEVGPELKRGTPVLIGER---VEIAP-RKDAVREVEERTRGWRAAWRR-GEAGDGFIA 234

Query: 216 -EKNHQEPFIQIINKQYVFFKGQ 237
            E+      ++   K+     G 
Sbjct: 235 PERAASIRKVERQEKRVRVTFGP 257


>gi|268315962|ref|YP_003289681.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodothermus marinus DSM 4252]
 gi|262333496|gb|ACY47293.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodothermus marinus DSM 4252]
          Length = 241

 Score = 99.6 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 55/158 (34%), Gaps = 47/158 (29%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG------DEQAPEG 103
               +R+ K +  L +++        L++ + +   +  F  K   G      D + PEG
Sbjct: 81  SNVWLRVSKRQRRLFVYRGT-----RLVRSFPVDLGTNPFSDKTRRGSVASPDDWRTPEG 135

Query: 104 FYYIGWNNLNPNSKYFLSINIGFPNEFDKAHN---------------------------- 135
            +Y+     N  S+Y+ ++ + +P   D                                
Sbjct: 136 VFYVAAK--NARSQYYRALVLNYPTADDALRGLREGLISEAEYRAIVEAEANFRMPPMNT 193

Query: 136 RTGADLMIHGEC------ASAGCYAMNNKQMQEIYAIV 167
             G  + IHG+        + GC A+ N+ +  I+ +V
Sbjct: 194 ALGGWIEIHGDGTGQQVTWTQGCVALRNEDLDAIWPLV 231


>gi|303326005|ref|ZP_07356448.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863921|gb|EFL86852.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio sp. 3_1_syn3]
          Length = 385

 Score = 99.6 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/166 (17%), Positives = 59/166 (35%), Gaps = 21/166 (12%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
               +   AL + L     + +  D            ++  +        ++ + KN   
Sbjct: 1   MSRLLAGLALSLVLAVVTVAPARADNW--------QANLYNEGLPSH---LVAVDKNRRA 49

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN---LNPNSKYF 119
              +++       L   +  C      G K E  D + PEG Y++ +     L+      
Sbjct: 50  FLFFEKKS--PLKLKYSFP-CVTGQLAGDKQELNDLRTPEGIYFVEYKIASGLDFKEYGG 106

Query: 120 LSINIGFPNEFDKAHNRTGADLMIH----GECASAGCYAMNNKQMQ 161
           ++  + +PN  D+   +TG  + IH    G   + GC A+  K++ 
Sbjct: 107 IAYTLNYPNPVDRLRGKTGHGIWIHSKGFGLVPTRGCVAIGLKEID 152


>gi|78777576|ref|YP_393891.1| hypothetical protein Suden_1379 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498116|gb|ABB44656.1| conserved hypothetical protein [Sulfurimonas denitrificans DSM
           1251]
          Length = 321

 Score = 99.2 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 68/195 (34%), Gaps = 33/195 (16%)

Query: 69  NVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS----KYFLSINI 124
           + +  +   K+Y         G KI+ GD + P G Y I                 +   
Sbjct: 80  DENQNFKFKKKYSAFTGKMK-GDKIKEGDLRTPTGIYQITQKLSKETKLDPFYGPFAFVT 138

Query: 125 GFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQMQ------EIYA------- 165
            +PN +D    + G+ + IHG  A      + GC A+NN  ++      +I         
Sbjct: 139 SYPNVYDTYKGKNGSGIWIHGLPAEDRDEFTRGCIAINNSSIECLNKNIDISKTLLIIND 198

Query: 166 ------IVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNH 219
                 + ++SL   +    Q+ A+       +++ Y +  + +F     +  + F    
Sbjct: 199 SEVKQNVAKESLVSILA---QLYAWRHAWLYDDIKNYLSFYSPNFVRFDGMDIEKFRSYK 255

Query: 220 QEPFIQIINKQYVFF 234
              F +   K  +F 
Sbjct: 256 TRVFQKNEKKTIIFN 270


>gi|317050283|ref|YP_004111399.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfurispirillum indicum S5]
 gi|316945367|gb|ADU64843.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfurispirillum indicum S5]
          Length = 474

 Score = 99.2 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 45/124 (36%), Gaps = 14/124 (11%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I   KN+ +  I  +     + +L+ Y         G K   GDE+ P G Y+  
Sbjct: 207 DGQIFIWTSKNQQVTYI-IQRQGEGFTVLEAYHSSTGRIP-GEKQRRGDEKTPTGIYFPV 264

Query: 109 WNNLN---PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMN 156
                   P      +  + +PN  DK   RTG+ + +HG            S GC   +
Sbjct: 265 SKMTTNQMPQRYGAYAFPVNYPNHLDKHLGRTGSGIWLHGINENDNGQIPYNSEGCVVFS 324

Query: 157 NKQM 160
           N+ +
Sbjct: 325 NEGI 328


>gi|291279367|ref|YP_003496202.1| hypothetical protein DEFDS_0974 [Deferribacter desulfuricans SSM1]
 gi|290754069|dbj|BAI80446.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 413

 Score = 98.1 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 61/169 (36%), Gaps = 27/169 (15%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     +L+    +F  G   S  + +     +S++ +                 + K++
Sbjct: 1   MRKVIFLLII--LVFYAGLSFSAIIENIFSKGISDDTV---------------FVVDKSQ 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG---WNNLNPNSK 117
             L + +   D   ++ +   I       G K   GD++ PEG Y +      N      
Sbjct: 44  KKLFVVQVKNDMPEIIWQYNNILLGEME-GDKQVEGDKKTPEGIYRVVSFIPKNQLSEIY 102

Query: 118 YFLSINIGFPNEFDKAHNRTGADLMIHGECA------SAGCYAMNNKQM 160
              +  + +PN  DK   +TG  + IHG         + GC A++N  +
Sbjct: 103 GEGAYPLNYPNPVDKIFGKTGYGIWIHGLKEDSGKKYTQGCVALHNGDL 151


>gi|15605752|ref|NP_213129.1| hypothetical protein aq_183 [Aquifex aeolicus VF5]
 gi|2982913|gb|AAC06531.1| putative protein [Aquifex aeolicus VF5]
          Length = 397

 Score = 97.7 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/197 (19%), Positives = 69/197 (35%), Gaps = 38/197 (19%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P +  V  + K    L ++K        L   Y +       G K   GD + PEG YY 
Sbjct: 134 PENHYVFLVEKMSQYLFVFKGK-----KLEGMYPVTTGMN-IGDKEREGDGKTPEGVYYF 187

Query: 108 GWNNLNPNS---KYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYA- 154
                          +++ + +PN +DK   +TG+ + +HG           ++ GC   
Sbjct: 188 TRFIPPEQLSEIYGGIAVALNYPNPYDKLLGKTGSGIWLHGSNEKDRDKLPFSTRGCVVA 247

Query: 155 --------------MNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNP 200
                         ++N  +  IY ++  SL         I ++      K++  + +  
Sbjct: 248 QTDVLKTEIVPKINLSNTLIG-IYKVIPQSLEVENVKEF-ILSWKNAWEKKDLNRFISFY 305

Query: 201 NYSF-WN--MLKLGHDY 214
           +  F W    LK   DY
Sbjct: 306 SKHFRWKGGGLKEWKDY 322


>gi|149194098|ref|ZP_01871196.1| hypothetical protein CMTB2_03398 [Caminibacter mediatlanticus TB-2]
 gi|149136051|gb|EDM24529.1| hypothetical protein CMTB2_03398 [Caminibacter mediatlanticus TB-2]
          Length = 319

 Score = 97.7 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 66/187 (35%), Gaps = 26/187 (13%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLI--DKAEHPLSENLIISMQ---------KKRTSPFHP 51
            R  I+             +       K    + +NL               K     +P
Sbjct: 1   MRIFIIFLFSTFLFADVIDTYRYYGIQKTIKEIEKNLQSEKYWLKKLKNIDVKYGYFENP 60

Query: 52  TVIRI-FKNENILE--IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
           T I    K    L+  ++K+    +   L  +      G  G K + GD + P G Y + 
Sbjct: 61  TFILFCNKITRTLQVNLYKK---GKLKNLTTFN-NVIVGKLGDKQKEGDLKTPIGNYTLI 116

Query: 109 WNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------ASAGCYAMNNKQM 160
                 N+ Y  L+    +PN FDK + + G  + IHG+         S GC  +NN ++
Sbjct: 117 NKIKPSNTFYGPLAFVTSYPNLFDKLNKKNGYGIWIHGKPLDGERGDLSKGCIVLNNDEI 176

Query: 161 QEIYAIV 167
           + +  ++
Sbjct: 177 KHLDTLI 183


>gi|213418318|ref|ZP_03351384.1| hypothetical protein Salmonentericaenterica_10609 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 76

 Score = 97.7 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 181 IQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFFKG 236
           +  +PFRMT  NMQ ++ +    FW  LK G+DYFE+ H+ P + I++ +YV  K 
Sbjct: 1   MSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKP 56


>gi|255527509|ref|ZP_05394378.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium carboxidivorans P7]
 gi|255508814|gb|EET85185.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium carboxidivorans P7]
          Length = 220

 Score = 97.3 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 69/211 (32%), Gaps = 52/211 (24%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV----------- 53
              L+F +F+ +     S     K +   S   +   +   ++  +  +           
Sbjct: 10  LVFLIFGIFLIVLVSGISIKKYIKTKEADSAKQVSVQKSTDSTKENEKLFFNKKDAVAEK 69

Query: 54  --IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I+++K   +LE++  +      L+  +KI       G K + GD + PEG YYI +  
Sbjct: 70  ASIKVYKKRRVLELYSSD-----KLVGRFKIGLGRSPEGYKEKEGDNKTPEGSYYICYR- 123

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADL------------------------------ 141
            N N+KY   I I +PN  D         +                              
Sbjct: 124 -NGNTKYTYFIGISYPNIEDAKRGLQQGLINEAVYKRIERAINNKKQPPWNTPLGGEIGL 182

Query: 142 --MIHGECASAGCYAMNNKQMQEIYAIVRDS 170
               +    S GC A+ ++ +  +     + 
Sbjct: 183 HGGGNKYDWSYGCIALTDEDINILKQYAPNG 213


>gi|291288878|ref|YP_003505694.1| ErfK/YbiS/YcfS/YnhG family protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290886038|gb|ADD69738.1| ErfK/YbiS/YcfS/YnhG family protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 418

 Score = 96.5 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 46/122 (37%), Gaps = 18/122 (14%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            + + KN   L + K   +    +L  +++       G K   GDE+ PEG Y++     
Sbjct: 36  AVLVEKNGKWLHVLKV-AEGRVEVLDSFQVLTGRVD-GDKRVQGDEKTPEGVYFVTGFLS 93

Query: 113 NPNS----------KYFLSINIGFPNEFDKAHNRTGADLMIHG------ECASAGCYAMN 156
                             +  + +PN  D+   +TG  + +HG         + GC A +
Sbjct: 94  PEKLRAMYGEVGKQYGTGAYPLSYPNLKDRLQGKTGGGIWLHGIDPSRNVPVTKGCVAFD 153

Query: 157 NK 158
           N+
Sbjct: 154 NE 155


>gi|291276929|ref|YP_003516701.1| hypothetical protein HMU07090 [Helicobacter mustelae 12198]
 gi|290964123|emb|CBG39967.1| putative periplasmic protein [Helicobacter mustelae 12198]
          Length = 331

 Score = 96.5 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 47/127 (37%), Gaps = 11/127 (8%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                   +    K+   L ++K        L +   I    G  G K + GD+  P G 
Sbjct: 63  GYYEGANFLFLFNKDNASLILYKIENGHLTQLQQTNAIMGIGG--GAKQKKGDKVTPIGV 120

Query: 105 YYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAM 155
           Y         +  Y  ++    +PN +D   NRTG+ + +HG           + GC A+
Sbjct: 121 YNFVELLEKLDPYYGPMAFATNYPNTYDNLLNRTGSGIWLHGLPLNGDRKDQNTKGCIAV 180

Query: 156 NNKQMQE 162
            N  +QE
Sbjct: 181 ENNLIQE 187


>gi|225850906|ref|YP_002731140.1| hypothetical protein PERMA_1371 [Persephonella marina EX-H1]
 gi|225645444|gb|ACO03630.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 361

 Score = 96.1 bits (238), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 63/164 (38%), Gaps = 11/164 (6%)

Query: 14  IFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
           I L      ++   K    +SE     ++     P     I + K+   L++ K   D  
Sbjct: 59  IILLLQEGRKAEAQKLFSKISEKNKGVLENVIYIPEGSYAIVVSKSRQRLKVIKFVNDLP 118

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDK 132
             +L+   I       G K++ GD++ P G Y+           Y   +  + +PN  D+
Sbjct: 119 VEVLELRSI--TGKRPGDKLKEGDQRTPNGVYFPVKYLTKLAPMYGVGAFPLNYPNILDR 176

Query: 133 A-HNRTGADLMIHGEC-------ASAGCYAMNNKQMQEIYAIVR 168
              N+TG  + IH          +S GC  +NN+   ++   ++
Sbjct: 177 KFLNKTGNGIWIHASDKPDRPYFSSNGCVVLNNEDFNKLKRFIK 220


>gi|292492146|ref|YP_003527585.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosococcus halophilus Nc4]
 gi|291580741|gb|ADE15198.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosococcus halophilus Nc4]
          Length = 212

 Score = 95.7 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 59/174 (33%), Gaps = 50/174 (28%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           L+ +L             P  I + K++ +L + K        ++K+Y +    G  G K
Sbjct: 11  LALSLASPFVLATPPTEFPYEIIVIKSKRLLVVKKGT-----RVIKKYHVALGQGGIGGK 65

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADL----MIH---- 144
              GD++ PEG Y I  +   P+ K++  I++ +P   D         +    +IH    
Sbjct: 66  RVEGDKRTPEGEYEIVGSW--PSRKFYYFIHLNYPGRQDAMAGYKKGLISWEELIHIYRA 123

Query: 145 -----GEC------------------------------ASAGCYAMNNKQMQEI 163
                G                                 + GC A+ N ++ E+
Sbjct: 124 HQEQNGTPPQQTRLGGFIGIHGIGEETNQKLAIHQDFDWTRGCIALTNTEIDEL 177


>gi|332703549|ref|ZP_08423637.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553698|gb|EGJ50742.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 457

 Score = 95.4 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 43/117 (36%), Gaps = 13/117 (11%)

Query: 49  FHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
             P   + I K      + +R       +      CA     G K   GD + PEG Y+I
Sbjct: 69  NSPVRFLAIDKASQTFFLMERRSPLRKAVEL---PCATGQVAGDKYREGDLRTPEGVYFI 125

Query: 108 GWNN---LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC------ASAGCYAM 155
                  L+      ++  + FPN  D+   +TG  + IHG         + GC A+
Sbjct: 126 QRKLTTGLDYQLYGDIAYTLNFPNPVDRIEGKTGYGIWIHGRGGKIVPMETRGCVAL 182


>gi|315453295|ref|YP_004073565.1| hypothetical protein HFELIS_08910 [Helicobacter felis ATCC 49179]
 gi|315132347|emb|CBY82975.1| putative periplasmic protein [Helicobacter felis ATCC 49179]
          Length = 335

 Score = 95.4 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 46/278 (16%), Positives = 85/278 (30%), Gaps = 47/278 (16%)

Query: 1   MTNRYNILLFALFIFLNGC---HHSRSLIDKAEHPLSENLIISMQKK------------- 44
           +  R  ++ F   + L         ++   K    +   L   + +K             
Sbjct: 6   LWARVLLVAFLCVVGLRADTLMGFVKAYHKKGIASIERLLQSYLTQKEFWEDVLEKHDIS 65

Query: 45  -RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEG 103
                    +  I K +  L ++    +    + +           G KI  GD+  P G
Sbjct: 66  YGYYEDLDYLFVINKADPKLILYALQGEKIVKVNES--TALVGSKAGEKITEGDKATPIG 123

Query: 104 FYYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYA 154
            Y I       ++ Y   ++   +PN FD A  R G  + IHG           + GC A
Sbjct: 124 VYQILKKLTGLDAYYGPFALETNYPNPFDVARKRNGHGIWIHGLPLDGKRDELNTKGCIA 183

Query: 155 MNNKQMQE----------IYAIVRDSLRGNMQSHI-----QIQAFPFRMTSKNMQLYQNN 199
           + N  +++          +  +     +   Q  +      +  +       ++  Y N 
Sbjct: 184 IQNPILKDYGTRLKDKKTLLIVYEGEFKYATQDELAALLSSLYTWRSAWAKNDLVSYMNF 243

Query: 200 PNYSFWNMLKLGHDY--FEKNHQEPFIQIINKQYVFFK 235
               F      G DY  +EK     F +  +K   F K
Sbjct: 244 YAPDF--KHANGMDYKTYEKFKTHVFGKNEDKTIRFSK 279


>gi|322378789|ref|ZP_08053218.1| conserved hypothetical secreted protein [Helicobacter suis HS1]
 gi|322380638|ref|ZP_08054790.1| conserved hypothetical secreted protein [Helicobacter suis HS5]
 gi|321146960|gb|EFX41708.1| conserved hypothetical secreted protein [Helicobacter suis HS5]
 gi|321148819|gb|EFX43290.1| conserved hypothetical secreted protein [Helicobacter suis HS1]
          Length = 309

 Score = 94.6 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 65/184 (35%), Gaps = 26/184 (14%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                   +  I K +  L ++K + +    + +           G K+  GD+  P G 
Sbjct: 41  GYYESLDYLFIINKADPKLILYKMDGEKISKVNESK--ALVGSKIGMKVSEGDKATPIGV 98

Query: 105 YYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAM 155
           Y I     N ++ Y  L++   +PN  D     TG  + IHG           + GC A+
Sbjct: 99  YQIIKKITNLSAYYGPLALVTNYPNPLDVVLKHTGHGIWIHGMPLKGDRDNSYTKGCIAI 158

Query: 156 NNKQMQEIYAIVRD--SLRGNMQSHIQ-------------IQAFPFRMTSKNMQLYQNNP 200
           +NK +Q    +VR+  +L    +                 + A+       N+  Y    
Sbjct: 159 DNKILQNYDKLVRNKKALLVVYEGDFPHASKQELALLLSNLYAWRMAWAKNNLISYLEFY 218

Query: 201 NYSF 204
           + +F
Sbjct: 219 SPNF 222


>gi|163782557|ref|ZP_02177554.1| hypothetical protein HG1285_16775 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882130|gb|EDP75637.1| hypothetical protein HG1285_16775 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 395

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 73/199 (36%), Gaps = 33/199 (16%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P    V  + K    L I++       VL   Y +         K   GD++ PEG YY 
Sbjct: 131 PDDKYVFLVEKMSQYLLIYRGK-----VLENLYPVTTGQDWE-DKWVEGDKRTPEGIYYF 184

Query: 108 G---WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAM 155
                    P     +++ + +PN  D+   + G+ + +HG           ++ GC   
Sbjct: 185 TEFIPPRRLPKMYGGIAVVLNYPNPVDRLLGKGGSGIWLHGSDEENRNNIPFSTRGCVVA 244

Query: 156 NNKQMQEIY-AIVRDSLRGNMQSHIQIQA-----------FPFRMTSKNMQLYQNNPNYS 203
           +N  ++ I   I +++    +   I  +            +      K+++ Y +  + +
Sbjct: 245 DNNDLRSIVKKIAKNNTLIAIYKEIPTEIEVDDVRDFLRRWEDSWEGKDLEGYLSFYSKN 304

Query: 204 F-WNMLKLGHDYFEKNHQE 221
           F W   + G++ + +  + 
Sbjct: 305 FRWK--RGGYNSWARYKRR 321


>gi|297171153|gb|ADI22163.1| uncharacterized protein conserved in bacteria [uncultured gamma
           proteobacterium HF0200_24F15]
          Length = 372

 Score = 93.1 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 49/123 (39%), Gaps = 14/123 (11%)

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG---WNNLNPNS 116
              L +++ +   +   L  +        F  K   GD++ P G Y I            
Sbjct: 139 SARLIVYENDR-GKIKELGNFYASIGISGF-EKRREGDQKTPIGVYRITGFIPGRKLHER 196

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGEC---------ASAGCYAMNNKQMQEIYAIV 167
               ++ I +PN+ D+ + RTG+ + +HG           AS GC ++ N+    +  ++
Sbjct: 197 YGPGALPIDYPNDLDQIYERTGSGIWLHGTEPGSVNRAPRASDGCLSLANRDFLSLLRLI 256

Query: 168 RDS 170
            DS
Sbjct: 257 GDS 259


>gi|258517068|ref|YP_003193290.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257780773|gb|ACV64667.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 270

 Score = 90.7 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 63/180 (35%), Gaps = 44/180 (24%)

Query: 27  DKAEHPLSENLIISMQKKRT-SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAW 85
                  +++L   + ++    P+    I I K  + L I  +N       LK Y +   
Sbjct: 86  SSTGQSKAKSLKAILAERGITDPWSTLKIVINKTNHSLSIVYKNTW-----LKTYPVDIG 140

Query: 86  SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLS---INIGFPNEFDKAHN------- 135
           SG    K   GD + PEG +YI   ++   + Y+L    + + +PN  D           
Sbjct: 141 SGGLADKQVQGDLKTPEGTFYIAEKSVLSPADYYLGTRWMRLSYPNAEDAGRGVRQGLIN 200

Query: 136 -RTGADL-------MIH--------------------GECASAGCYAMNNKQMQEIYAIV 167
            +TG  +        I                     G+  + GC  ++N  +++ Y  V
Sbjct: 201 SQTGDSIVNAINAGKIPPQRTALGGGVGIHGGDIPSFGKDWTWGCIGLSNGDVEDFYDYV 260


>gi|153953429|ref|YP_001394194.1| hypothetical protein CKL_0793 [Clostridium kluyveri DSM 555]
 gi|219854053|ref|YP_002471175.1| hypothetical protein CKR_0710 [Clostridium kluyveri NBRC 12016]
 gi|146346310|gb|EDK32846.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219567777|dbj|BAH05761.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 220

 Score = 90.4 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 61/179 (34%), Gaps = 41/179 (22%)

Query: 30  EHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTF 89
           E  +  +      KK       T I+I+K + I+E++      +  L+  +K+       
Sbjct: 48  EKVIENDEEELFFKKPEKFPDTTFIKIYKEKRIMELY-----GDNKLIGRFKMALGRVPQ 102

Query: 90  GPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADL-------- 141
           G K   GD + PEG YYI +  +N  +KY   + I +PN  D         +        
Sbjct: 103 GKKQREGDNKTPEGNYYICY--INSKTKYKYFLGISYPNIQDAKWALDEGVIDNNTFQKI 160

Query: 142 ------------------------MIHGECASAGCYAMNNKQMQEI--YAIVRDSLRGN 174
                                          + GC A+++  M  +  Y  VR S+   
Sbjct: 161 EKAIENKKQPPWNTPLGGAIGIHGGGTDYDWTYGCIAISDNDMDILKQYVFVRTSVEIY 219


>gi|300856075|ref|YP_003781059.1| hypothetical protein CLJU_c29090 [Clostridium ljungdahlii DSM
           13528]
 gi|300436190|gb|ADK15957.1| conserved hypothetical protein [Clostridium ljungdahlii DSM 13528]
          Length = 220

 Score = 90.0 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 69/211 (32%), Gaps = 57/211 (27%)

Query: 1   MTNRYN-----ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV-- 53
           M  ++       L+F + I       S     +     + +   ++ +K        +  
Sbjct: 1   MKKKHVIFPLVFLIFGIAIIATISGLSIKRYIRENEFKNISAKNNVTEKDVQAEKGKLFF 60

Query: 54  -----------IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPE 102
                      I+I+K +  +E++      +  L+  +K+       G K + GD + PE
Sbjct: 61  EAPKQKPEKTSIKIYKGKRAMELY-----GDNELIGRFKVGLGRVPSGKKEKEGDLKTPE 115

Query: 103 GFYYIGWNNLNPNSKYFLSINIGFPNEFD-------KAHNRTGAD--------------- 140
           G YYI +  +NP SKY     I +PN  D       K   +   D               
Sbjct: 116 GTYYICY--INPKSKYDYFFGISYPNIDDAKEALDKKVIGKINYDRIEWAINNKEQPPWH 173

Query: 141 ----------LMIHGECASAGCYAMNNKQMQ 161
                             + GC A++NK M 
Sbjct: 174 TSLGGEIGIHGGGSKYDWTYGCIALSNKDMD 204


>gi|213028217|ref|ZP_03342664.1| hypothetical protein Salmonelentericaenterica_40310 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 99

 Score = 90.0 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 5/103 (4%)

Query: 12  LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVD 71
           L + L  C     L+  +         +S + K+     P  I+IFK E  L+++ + + 
Sbjct: 2   LAMLLMPCVSFAGLLSSSSP----VTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK-MG 56

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +Y LL  YKIC +SG  GPK   GD ++PEGFY +  N L P
Sbjct: 57  EQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKP 99


>gi|160938553|ref|ZP_02085907.1| hypothetical protein CLOBOL_03450 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438540|gb|EDP16298.1| hypothetical protein CLOBOL_03450 [Clostridium bolteae ATCC
           BAA-613]
          Length = 192

 Score = 90.0 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 59/197 (29%), Gaps = 47/197 (23%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R       L + L       +L  +   P                 +   I + K  
Sbjct: 1   MKFRKCAAAGVLALCLAAAGPLSALAGQNAGP---------GAAYQPSVNGVNIYVSKMG 51

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWS-GTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119
           N L + +         +  + +        G K++ GDE  P G +Y+     N  S  +
Sbjct: 52  NTLTLKQYAQT-----IGTWPVKLGRRSETGDKVQEGDEITPSGSFYVCTR--NDQSICY 104

Query: 120 LSINIGFPNEFDKAHNRT----------------------------GADLMIHGE--CAS 149
           L++ + +PN  D                                  G  + IHG+    +
Sbjct: 105 LALGLSYPNAEDAERGLRDGLINEEQYNAIVEANKAGIQPPWNTPLGGAIEIHGDQGGGT 164

Query: 150 AGCYAMNNKQMQEIYAI 166
           +GC A+ N  M  ++  
Sbjct: 165 SGCIAVTNDVMDILWEY 181


>gi|331003021|ref|ZP_08326533.1| hypothetical protein HMPREF0491_01395 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413065|gb|EGG92440.1| hypothetical protein HMPREF0491_01395 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 206

 Score = 89.6 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 70/227 (30%), Gaps = 63/227 (27%)

Query: 1   MTNR---YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV---- 53
           M  R      L+F++ I L     S S+       +S   +         P  P V    
Sbjct: 1   MKARKSIVAFLVFSMLIGLM----SFSVYAATVTKVSTGSVNFES--GFGPGQPKVVEPS 54

Query: 54  --IRIFKNENILEIWKRNVDAEYVLLKEYKICAW-SGTFGPKIETGDEQAPEGFYYIGWN 110
             I + K    L +   N      ++ ++          G K   GD   P G YYI   
Sbjct: 55  TRIYVSKMAKELTLIADN-----KVVGKWPCSLGEFSANGTKQRQGDRTTPNGDYYICVR 109

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRT----------------------------GADLM 142
             N  S Y LS+ + +P++                                    G  +M
Sbjct: 110 --NDKSAYHLSLGLSYPDKAAADRGFEQGIITQEEKDSIYTAIDSKLCPPWNTALGGAIM 167

Query: 143 IHGECA----SAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           IHG       +AGC A+NN  M  ++           Q  I++   P
Sbjct: 168 IHGNYQKGVPTAGCVAVNNDVMDILWPY--------GQLGIKVSVGP 206


>gi|315650366|ref|ZP_07903438.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315487477|gb|EFU77787.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 201

 Score = 87.3 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 75/224 (33%), Gaps = 62/224 (27%)

Query: 1   MTNRYNIL---LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF 57
           M  R + +   + ++ I L   +   + + K     S    +S+Q+   S    T I + 
Sbjct: 1   MKIRKSFVAAPVLSMLIGLMSFNAYAATVRKVTT--SSYTPVSLQQ---SVEPSTRIYVS 55

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAW-SGTFGPKIETGDEQAPEGFYYIGWNNLNPNS 116
           K    L +   N      ++ ++          G K + GD   P G YYI     N  S
Sbjct: 56  KMSKELTLIADN-----KVVGKWPCSLGEFSANGTKKKQGDRTTPNGDYYICVR--NDKS 108

Query: 117 KYFLSINIGFP-------------------------------NEFDKAHNRTGADLMIHG 145
            Y LS+ + +P                                 +D A    G  +MIHG
Sbjct: 109 AYHLSLGLSYPDKAAADRGFESGIISKEEKDTIYSAIDRKVCPPWDTAL---GGAIMIHG 165

Query: 146 ECA----SAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
                  +AGC A+++  M  ++           Q  I++   P
Sbjct: 166 NYQKGIPTAGCVAVSDDVMDILWPY--------GQLGIKVSVGP 201


>gi|239627720|ref|ZP_04670751.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239517866|gb|EEQ57732.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 199

 Score = 87.3 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 52/146 (35%), Gaps = 38/146 (26%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTF-GPKIETGDEQAPEGFYYIGWN 110
             I + K  + + + + N       +  +       +  G K++ GD   P G +Y+   
Sbjct: 50  ISIYVSKKGSTVTLSRYNST-----IGSWPAQIGRESATGDKVQQGDGITPSGKFYVCTK 104

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRT----------------------------GADLM 142
             N  S+Y+LS+ + +PN  D                                  G  +M
Sbjct: 105 --NDQSQYYLSLGLSYPNIDDAERGLADGLINEEQYKAIVDANKAGEQPPWDTPLGGAIM 162

Query: 143 IHGE--CASAGCYAMNNKQMQEIYAI 166
           IHGE    +AGC A+ N  M  ++  
Sbjct: 163 IHGEQGGGTAGCIAVTNDVMDILWEY 188


>gi|86159334|ref|YP_466119.1| hypothetical protein Adeh_2912 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775845|gb|ABC82682.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 175

 Score = 86.5 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 56/171 (32%), Gaps = 34/171 (19%)

Query: 16  LNGCHHS--RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAE 73
           L  C  +   +L   AE  L  +           P     + +  +    E+W  +    
Sbjct: 14  LAACALAMLPALAPGAEGALDPSPC---------PRSRDAVVVVTDRR--ELWLCSGG-- 60

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKA 133
                ++ +       G K   GD + P G Y +   +  P+ +Y   I I +P     A
Sbjct: 61  -APAAQFTVALGRSGVG-KRRRGDGRTPLGTYPL--GDPRPSPQYGTFIPIAYPTPAQAA 116

Query: 134 HNRTGADLMIHGEC--------------ASAGCYAM-NNKQMQEIYAIVRD 169
              TGA + IHG                 + GC A   +  +  I A VR 
Sbjct: 117 RGFTGAAVGIHGPPRGTEGAGYPVTEVDWTQGCIATGTDGDVDAIAAFVRA 167


>gi|116747988|ref|YP_844675.1| hypothetical protein Sfum_0541 [Syntrophobacter fumaroxidans MPOB]
 gi|116697052|gb|ABK16240.1| hypothetical protein Sfum_0541 [Syntrophobacter fumaroxidans MPOB]
          Length = 191

 Score = 85.7 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 52/146 (35%), Gaps = 39/146 (26%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I ++K +  L + + N     VL+++Y I       G K   GD + PEG ++I     +
Sbjct: 43  IFVYKEKRRLYVIQSN-----VLVRDYPIGLGPHPSGDKDRDGDGRTPEGDFFIIVKGSS 97

Query: 114 PNSKYFLSINIGFPNE-----------------FDKAHN---RT--------GADLMIHG 145
              K   S+ I +P                    D       R+        G  + IH 
Sbjct: 98  ERLK--KSLAISYPGRGHAEKAYFSGVITPLEFRDILRAADNRSAPPSGTVLGGKIFIHA 155

Query: 146 E----CASAGCYAMNNKQMQEIYAIV 167
                  + G  A+ +  M+E++ + 
Sbjct: 156 GGAHKDWTDGSIALYDSDMEELFTVA 181


>gi|218516367|ref|ZP_03513207.1| hypothetical protein Retl8_23254 [Rhizobium etli 8C-3]
          Length = 122

 Score = 85.7 bits (211), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNN 111
           +IR++K+E  + + K +       +  Y+I   SG   GPK   GDE+ PEG Y I W  
Sbjct: 35  LIRVYKSERRMVLLKGD-----APIAAYEISLGSGANAGPKQREGDEKTPEGRYEIDWR- 88

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGA 139
            N  S   LS++I +P   ++       
Sbjct: 89  -NAKSTAHLSLHISYPKPEEQRAAEVNG 115


>gi|86360290|ref|YP_472178.1| hypothetical protein RHE_PE00012 [Rhizobium etli CFN 42]
 gi|86284392|gb|ABC93451.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 196

 Score = 85.3 bits (210), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 52/141 (36%), Gaps = 24/141 (17%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +L  A             +   +  P +     +            +IR++K+E  +   
Sbjct: 1   MLAIAAVSLFAYTKVMARIGSGSPPPAAPMEQRA-----------DLIRVYKSERRMVFL 49

Query: 67  KRNVDAEYVLLKEYKICAWSG-TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
           K +       +  Y+I   S    GPK   GDE+ PEG Y I W   NP S   LS++I 
Sbjct: 50  KGD-----APIAAYEISLGSAADAGPKQREGDEKTPEGPYEIDWR--NPKSTAHLSLHIS 102

Query: 126 FPNEFDKAHNR-----TGADL 141
           +P   ++          G ++
Sbjct: 103 YPKPEEQRAAEVNGFPPGGNI 123


>gi|194332931|ref|YP_002014791.1| hypothetical protein Paes_0084 [Prosthecochloris aestuarii DSM 271]
 gi|194310749|gb|ACF45144.1| hypothetical protein Paes_0084 [Prosthecochloris aestuarii DSM 271]
          Length = 122

 Score = 85.3 bits (210), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 11/125 (8%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R    +  +   L  C   R+   KA      +   S+Q         +++ + K++
Sbjct: 1   MWMRVFYTIAVVATLL--CLAQRAHRSKAVAA-ENSKSSSLQTLSLPVEADSLV-VSKDD 56

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            +L ++         ++K Y I       G K   GD + PEG Y I     NP S+Y L
Sbjct: 57  RLLHLYSDG-----AVVKSYTIALGFSPRGAKRYLGDGRTPEGRYTIIGR--NPQSRYHL 109

Query: 121 SINIG 125
           S++I 
Sbjct: 110 SLSIS 114


>gi|256419960|ref|YP_003120613.1| ErfK/YbiS/YcfS/YnhG family protein [Chitinophaga pinensis DSM 2588]
 gi|256034868|gb|ACU58412.1| ErfK/YbiS/YcfS/YnhG family protein [Chitinophaga pinensis DSM 2588]
          Length = 190

 Score = 84.6 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 56/147 (38%), Gaps = 35/147 (23%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
               + + K++  + ++      +  L K YK+   +     K + GD   PEG ++I  
Sbjct: 42  DKIFLLVDKSDYRMYLY-----EDVTLRKIYKVVFGNKDQSDKRQEGDRLTPEGTFHILS 96

Query: 110 NNLNPNSKYFLSINIGFPNE--FDKAH-----------NRTGADLMIHGE---------- 146
             +  +  +   + + +PNE  +++ H              G  + IHG           
Sbjct: 97  KRM--DKLWNRFMLLDYPNEASWNRFHELQSAGVLPAGATPGGGIGIHGVEWNSGIRDNY 154

Query: 147 -----CASAGCYAMNNKQMQEIYAIVR 168
                  + GC +M N  + E+Y I++
Sbjct: 155 VEGRINWTLGCVSMKNSDVSELYDIIK 181


>gi|303239380|ref|ZP_07325908.1| ErfK/YbiS/YcfS/YnhG family protein [Acetivibrio cellulolyticus CD2]
 gi|302593166|gb|EFL62886.1| ErfK/YbiS/YcfS/YnhG family protein [Acetivibrio cellulolyticus CD2]
          Length = 266

 Score = 84.6 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 56/162 (34%), Gaps = 43/162 (26%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-GWNNL 112
           I + K++++L +          LLK Y +       G K  +GD + PEG +YI   + L
Sbjct: 110 IYVDKSDHVLSLISNG-----KLLKSYHVELGDSDLGDKEISGDHKTPEGTFYISEKSIL 164

Query: 113 NPNSKYFLS--INIGFPNEFDKAHNRTGADLMIH-------------------------- 144
           +P  +Y  S  + + +PN  D         +                             
Sbjct: 165 DPADEYLGSRWMRLSYPNIEDAERGLEDGIISSSIYEEIVTAFKNFQTTPQNTSLGGGVG 224

Query: 145 ---------GECASAGCYAMNNKQMQEIYAIVRDSLRGNMQS 177
                    G   + GC  ++N  +++ Y  V+   +  +Q 
Sbjct: 225 IHGGSTAELGSDWTWGCVGLSNSSVEDFYDYVKVGTKVVIQK 266


>gi|86159927|ref|YP_466712.1| hypothetical protein Adeh_3509 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776438|gb|ABC83275.1| conserved hypothetical protein [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 171

 Score = 83.8 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 62/177 (35%), Gaps = 42/177 (23%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIW 66
           +LL     FL  C         A  P               P    +I +   E+ L + 
Sbjct: 13  LLLVPPLAFLLAC---------AHRPAPPGC----------PPVDALILVDTAEHRLALC 53

Query: 67  KRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGF 126
           +    A       + +   S     K   GD + P G Y +G     P++ +   I IG+
Sbjct: 54  EAGAAAA-----VFPVALGSAGT-EKRAEGDRRTPLGAYALGT--PRPSAGFGTFIPIGY 105

Query: 127 PNEFDKAHNRTGADLMIHG--------------ECASAGCYAM-NNKQMQEIYAIVR 168
           P    +   RTG+++ IHG                 +AGC A+ ++ ++  + A V 
Sbjct: 106 PTAEQRRAGRTGSNVGIHGPARAMRWAGRLNTWADWTAGCVALGSDPEVAAVAAFVE 162


>gi|220918755|ref|YP_002494059.1| ErfK/YbiS/YcfS/YnhG family protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219956609|gb|ACL66993.1| ErfK/YbiS/YcfS/YnhG family protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 171

 Score = 83.8 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 23/131 (17%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +I +   E+ L + +    A       + +   S     K   GD + P G Y +G    
Sbjct: 40  LILVDTAEHRLALCEAGAAAA-----VFPVALGSAGT-EKRAEGDRRTPLGAYALGT--P 91

Query: 113 NPNSKYFLSINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAM-NN 157
            P++ +   I IG+P    +   RTG+++ IHG                 +AGC A+ ++
Sbjct: 92  RPSAGFGTFIPIGYPTAEQRRAGRTGSNVGIHGPARAMRWAGRLNTWADWTAGCVALGSD 151

Query: 158 KQMQEIYAIVR 168
           +++  + A V 
Sbjct: 152 REVAAVAAFVE 162


>gi|302385209|ref|YP_003821031.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium saccharolyticum
           WM1]
 gi|302195837|gb|ADL03408.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium saccharolyticum
           WM1]
          Length = 203

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 60/177 (33%), Gaps = 41/177 (23%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
            S +     P+S     ++    ++  +   I + K    L + +       VL+ EY +
Sbjct: 24  SSNVTGYAEPIS-GPGAAIAAGNSASVNNVTIYVSKRTKTLSLKQNG-----VLIAEYPV 77

Query: 83  CAW-SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT---- 137
               S + G K   GD + P G +Y+     N  S  +L++ + +P   D          
Sbjct: 78  SLGASSSEGNKKVEGDMRTPSGEFYVCTR--NDKSVAYLALGLSYPAIKDAERGYADGII 135

Query: 138 ------------------------GADLMIHG----ECASAGCYAMNNKQMQEIYAI 166
                                   G  + IHG    E  + GC A++N  M  ++  
Sbjct: 136 TQAQKDEIVKANLEGKQPPWDTPLGGAIEIHGCRVPEGTTHGCVAVDNSAMDVLWNY 192


>gi|197123398|ref|YP_002135349.1| hypothetical protein AnaeK_2998 [Anaeromyxobacter sp. K]
 gi|196173247|gb|ACG74220.1| conserved hypothetical protein [Anaeromyxobacter sp. K]
          Length = 175

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 48/137 (35%), Gaps = 23/137 (16%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P     + +  +   L + +           ++ +       G K   GD + P G Y +
Sbjct: 39  PRSRDAVVVVTDRRELWLCRGGT-----PAAQFAVALGRSGVG-KRRHGDGRTPLGTYPL 92

Query: 108 GWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------------ASAGCY 153
              +  P+++Y   I I +P     A   TGA + IHG                 + GC 
Sbjct: 93  --GDPRPSTQYGTFIPIAYPTPAQAARGFTGAAVGIHGPPRGTEGAGYPVTEVDWTQGCI 150

Query: 154 AM-NNKQMQEIYAIVRD 169
           A   ++ +  I A VR 
Sbjct: 151 ATGTDEDVDAIAAFVRA 167


>gi|294506432|ref|YP_003570490.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8]
 gi|294342760|emb|CBH23538.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8]
          Length = 304

 Score = 83.0 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 50/154 (32%), Gaps = 37/154 (24%)

Query: 50  HPTVIRIFKNENILEIWKRNV-DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
               IR+ K +  + +++       +     Y   A     G K      + PEG +Y+ 
Sbjct: 145 SNVWIRVSKRKRRVYVYRGAELAHAFEADMAYNAFADKKRNGGKTRPDHWRTPEGTFYVV 204

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHN----------------------------RTGAD 140
               NP S+++ ++ + +P   D                                  G  
Sbjct: 205 HK--NPQSEFYKALVLNYPKVEDARRGLDAGLISRAQYEAIRQAQQEHRMPPMSTDLGGW 262

Query: 141 LMIHGEC------ASAGCYAMNNKQMQEIYAIVR 168
           + IHG+        + GC A+ N  M  I+  VR
Sbjct: 263 IEIHGDGTGDATAWTQGCVAIRNGAMDVIWEQVR 296


>gi|83816729|ref|YP_444677.1| hypothetical protein SRU_0534 [Salinibacter ruber DSM 13855]
 gi|83758123|gb|ABC46236.1| hypothetical protein SRU_0534 [Salinibacter ruber DSM 13855]
          Length = 304

 Score = 83.0 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 50/154 (32%), Gaps = 37/154 (24%)

Query: 50  HPTVIRIFKNENILEIWKRNV-DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
               IR+ K +  + +++       +     Y   A     G K      + PEG +Y+ 
Sbjct: 145 SNVWIRVSKRKRRVYVYRGAELAHAFEADMAYNAFADKKRNGGKTRPDHWRTPEGTFYVV 204

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHN----------------------------RTGAD 140
               NP S+++ ++ + +P   D                                  G  
Sbjct: 205 HK--NPQSEFYKALVLNYPKVEDARRGLDAGLISRAQYEAIRQAQQEHRMPPMGTDLGGW 262

Query: 141 LMIHGEC------ASAGCYAMNNKQMQEIYAIVR 168
           + IHG+        + GC A+ N  M  I+  VR
Sbjct: 263 IEIHGDGTGDATAWTQGCVAIRNGAMDVIWEQVR 296


>gi|262199265|ref|YP_003270474.1| ErfK/YbiS/YcfS/YnhG family protein [Haliangium ochraceum DSM 14365]
 gi|262082612|gb|ACY18581.1| ErfK/YbiS/YcfS/YnhG family protein [Haliangium ochraceum DSM 14365]
          Length = 217

 Score = 82.7 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 59/170 (34%), Gaps = 41/170 (24%)

Query: 27  DKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAW- 85
             AE      +              +++ + K    L +++        +    +I    
Sbjct: 40  RSAERDCPAQVGDLATSADPRLRAASLLVVEKGARRLGLYR---GGRLAMCT--RIALGV 94

Query: 86  SGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN-----------EFDKAH 134
            G  G K   GD + P+G+Y    ++  P SK+  +I + +PN             D+A 
Sbjct: 95  GGPEGDKEREGDRRTPQGWY---RSSDKPWSKFEGAIAVHYPNADDARAAQRAGRIDEAT 151

Query: 135 NRT-----------------GADLMIHGE----CASAGCYAMNNKQMQEI 163
            +                  G +++IHG       +AGC A+++  +  +
Sbjct: 152 AKRIVRALRRGQKPPQNTALGGEILIHGGGSRWDWTAGCIALSDTDLAAL 201


>gi|220918201|ref|YP_002493505.1| ErfK/YbiS/YcfS/YnhG family protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219956055|gb|ACL66439.1| ErfK/YbiS/YcfS/YnhG family protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 175

 Score = 82.7 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 49/135 (36%), Gaps = 21/135 (15%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P     + +  +   L + +  +        ++ +       G K   GD + P G Y +
Sbjct: 41  PRARDAVVVVTDRRELWLCRGGI-----PAAQFAVALGRSGVG-KRRHGDGRTPLGTYPL 94

Query: 108 GWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC------------ASAGCYAM 155
              +  P+++Y   I I +P     A   TGA + IHG               + GC A 
Sbjct: 95  --GDPRPSTQYGTFIPIAYPTPAQAARGFTGAAVGIHGPPRGTEGYPVTEVDWTQGCIAT 152

Query: 156 -NNKQMQEIYAIVRD 169
             ++ +  I A VR 
Sbjct: 153 GTDEDVDAIAAFVRA 167


>gi|229496449|ref|ZP_04390165.1| ErfK/YbiS/YcfS/YnhG family protein [Porphyromonas endodontalis ATCC
           35406]
 gi|229316677|gb|EEN82594.1| ErfK/YbiS/YcfS/YnhG family protein [Porphyromonas endodontalis ATCC
           35406]
          Length = 319

 Score = 81.9 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 58/154 (37%), Gaps = 27/154 (17%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            +      I + K    + ++ R    E    KEY  CA +  +G K + GD + PEGF+
Sbjct: 94  MNNRFDYFIVVDKASMRVLLYNRYGVKE----KEYT-CACARNYGHKAKKGDCRTPEGFF 148

Query: 106 YI-----GWNNLNPNSKYFLSINIG-FPNEFDKAHNRTGADLMIHGECA--------SAG 151
           Y        + L  +   + S   G +   F +        + IHG CA        S G
Sbjct: 149 YAGETFDSTDWLYTDDNGYTSPVRGQYGPRFIRIKGDKNLPVGIHGTCAPWALGRRCSHG 208

Query: 152 CYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFP 185
           C  ++N  + E+   V        Q ++ I   P
Sbjct: 209 CVRIHNDNILELVKYV--------QPNMPIIINP 234


>gi|255022097|ref|ZP_05294101.1| hypothetical protein ACA_2578 [Acidithiobacillus caldus ATCC 51756]
 gi|254968455|gb|EET26013.1| hypothetical protein ACA_2578 [Acidithiobacillus caldus ATCC 51756]
          Length = 276

 Score = 81.5 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 67/218 (30%), Gaps = 61/218 (27%)

Query: 4   RYNILLFALFIFLNGC---------HHSRSLIDKAEHPLSENLIISMQKKRTSPF-HPTV 53
           R   L  A  + L GC         H           P+   +    Q  + +P      
Sbjct: 9   RALWL-CAFPMLLVGCTTQAPAPQVHSVAWYAAHIPPPVIPTVSAPTQSVQPAPAPQELH 67

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +  ++  L ++K +      LL+ + +        P+   GD+  P G Y IG+    
Sbjct: 68  IVVDTSDRQLRVYKGD-----ALLETFPVAIGFNGAAPRRTRGDDITPVGKYRIGYVRFG 122

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT----------------------------GADLMIHG 145
              +Y   + + +PN  D                                  G  + IHG
Sbjct: 123 T--RYGPFMLLTYPNRDDARWGLREGIITQRQYDAIISALDRGEAPPQNTPLGGYIGIHG 180

Query: 146 EC---------------ASAGCYAMNNKQMQEIYAIVR 168
                             +AGC A++N   +++  +VR
Sbjct: 181 MGPQFADDPDSKVFPGRWTAGCVALSNWDARQLATLVR 218


>gi|302035740|ref|YP_003796062.1| hypothetical protein NIDE0357 [Candidatus Nitrospira defluvii]
 gi|300603804|emb|CBK40136.1| exported protein of unknown function, contains TonB box [Candidatus
           Nitrospira defluvii]
          Length = 382

 Score = 81.5 bits (200), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 48/134 (35%), Gaps = 25/134 (18%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I I K + +L ++K         +  Y I   S     K   GD   PEG Y I     
Sbjct: 223 AIVISKADRVLSLYKNG-----KKVLTYPIRLGSRGIRAKQHYGDGATPEGEYRIHRKRG 277

Query: 113 NPNSKYFLSINIGFPNEFDKAH--------------NRTGADLMIHGECASA-----GCY 153
           +  + YF ++ + +PN  D+                +  G  + +HG          G  
Sbjct: 278 SGQTPYFRALILDYPNADDRRRFEEAQQSGLIPKSQHMPGL-IQLHGIAQGITDQPYGSI 336

Query: 154 AMNNKQMQEIYAIV 167
            ++N Q+  ++  V
Sbjct: 337 LLDNPQIAALFDQV 350


>gi|307544800|ref|YP_003897279.1| hypothetical protein HELO_2210 [Halomonas elongata DSM 2581]
 gi|307216824|emb|CBV42094.1| hypothetical protein HELO_2210 [Halomonas elongata DSM 2581]
          Length = 214

 Score = 81.5 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 65/209 (31%), Gaps = 49/209 (23%)

Query: 1   MTNRYNILLFA--LFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           ++ R    LFA      L        L++  +        +     +    +   I I  
Sbjct: 4   LSRRRFGSLFAGLCLALLMPSLSHAGLMEAIQTRDESMDELLTHAGQPRYSNEVWILIDN 63

Query: 59  NENILEIWKRNVDAEYVLLKEY-KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
               L +++ N      LLK +  I    G   P+ + G    P G + +     N +SK
Sbjct: 64  EAASLSLYRGNT-----LLKYFSPISLGRGGAEPQRQRGGRVTPLGEFRVTR--FNFDSK 116

Query: 118 YFLSINIGFPNE----------------FD------KAHNRT------GADLMIHGE--- 146
           +   + + +P                  +D      + H         G  + IHG    
Sbjct: 117 FHTFVGLNYPTPTHARMALQSGIYSQRDYDDYFAYYRRHGNPPQDTVLGGYIGIHGVGVA 176

Query: 147 --------CASAGCYAMNNKQMQEIYAIV 167
                     + GC A+ + Q+  + +++
Sbjct: 177 DPEIHRRFHWTDGCVAVTDGQIDTLSSMI 205


>gi|224437280|ref|ZP_03658252.1| hypothetical protein HcinC1_04867 [Helicobacter cinaedi CCUG 18818]
          Length = 335

 Score = 80.3 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 9/71 (12%)

Query: 97  DEQAPEGFYYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------- 147
           D   P G Y +       +  Y  L+ +  +PN +D++  +TG  + IHG          
Sbjct: 116 DLTTPIGSYDLNARLTGLDQYYGPLAFSTSYPNVYDQSLKKTGGGIWIHGLPLNGNREEL 175

Query: 148 ASAGCYAMNNK 158
            + GC A++N+
Sbjct: 176 NTRGCIAIDNE 186


>gi|53805071|ref|YP_113122.1| hypothetical protein MCA0606 [Methylococcus capsulatus str. Bath]
 gi|53758832|gb|AAU93123.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 177

 Score = 80.3 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 39/129 (30%), Gaps = 41/129 (31%)

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR---- 136
           KI       G      D + P G Y IGW  +N NSK+     + +PN            
Sbjct: 45  KIAIGQHGAGVDKRRNDNKTPLGEYRIGW--INENSKFHRFFGLTYPNPEIAKRGFIRGL 102

Query: 137 ------------------------TGADLMIHGE-----------CASAGCYAMNNKQMQ 161
                                    G  + IHG              + GC A+ N+Q+ 
Sbjct: 103 IDEQLVRHILRAHLVEATPPQDTPLGGQIGIHGVGAGNRQVHEMFDWTHGCVALTNEQID 162

Query: 162 EIYAIVRDS 170
           ++   VR  
Sbjct: 163 QLTPWVRKG 171


>gi|32265806|ref|NP_859838.1| hypothetical protein HH0307 [Helicobacter hepaticus ATCC 51449]
 gi|32261854|gb|AAP76904.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 313

 Score = 80.0 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/163 (16%), Positives = 61/163 (37%), Gaps = 25/163 (15%)

Query: 97  DEQAPEGFYYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------- 147
           D   P G Y +       +  Y  L+ +  +PN +D++  +TG  + IHG          
Sbjct: 94  DLTTPIGSYDLNARLTGLDQYYGPLAFSTNYPNVYDQSLKKTGGGIWIHGLPLNGNREDI 153

Query: 148 ASAGCYAMNNKQMQEIYAIV--RDSLRGNMQSHI-------------QIQAFPFRMTSKN 192
            + GC A++N+ +++   I+  + ++    +                Q+  +       +
Sbjct: 154 NTRGCIAIDNELLKKYDKIIDWKKTMLITYEGIFKPTSVDELSIVLSQLYQWKNAWQKND 213

Query: 193 MQLYQNNP-NYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVFF 234
           +Q Y N     +F+    +    F ++ +  F +  +K     
Sbjct: 214 LQTYLNFYDEKNFFRPDGMSFKSFREHKKNIFAKNESKNIRIS 256


>gi|313143735|ref|ZP_07805928.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313128766|gb|EFR46383.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 321

 Score = 80.0 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 9/71 (12%)

Query: 97  DEQAPEGFYYIGWNNLNPNSKY-FLSINIGFPNEFDKAHNRTGADLMIHGEC-------- 147
           D   P G Y +       +  Y  L+ +  +PN +D++  +TG  + IHG          
Sbjct: 102 DLTTPIGSYDLNARLTGLDQYYGPLAFSTSYPNVYDQSLKKTGGGIWIHGLPLNGNREEL 161

Query: 148 ASAGCYAMNNK 158
            + GC A++N+
Sbjct: 162 NTRGCIAIDNE 172


>gi|270159738|ref|ZP_06188394.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289165491|ref|YP_003455629.1| hypothetical protein LLO_2163 [Legionella longbeachae NSW150]
 gi|269988077|gb|EEZ94332.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288858664|emb|CBJ12559.1| putative conserved hypothetical proteins [Legionella longbeachae
           NSW150]
          Length = 162

 Score = 79.6 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 23/131 (17%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +   + IL I K        ++K +K+   +   G K + GD + P G Y +   +  
Sbjct: 31  INVHTTKRILNICKNGT-----VIKTFKVALGNKGIG-KKKAGDNKTPIGLYGL--AHPR 82

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------------ASAGCYAMN-NK 158
            ++++ + I I +P    +A   TG D+ IHG                ++ GC A+  N 
Sbjct: 83  KSNQFKVFIPILYPTTKQRAAGYTGRDVGIHGPTQSSNSFGWLNNLPYSTRGCIAVGKNN 142

Query: 159 QMQEIYAIVRD 169
            +  +   V+ 
Sbjct: 143 YIDYVANWVKA 153


>gi|197123988|ref|YP_002135939.1| hypothetical protein AnaeK_3597 [Anaeromyxobacter sp. K]
 gi|196173837|gb|ACG74810.1| conserved hypothetical protein [Anaeromyxobacter sp. K]
          Length = 171

 Score = 79.6 bits (195), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 59/183 (32%), Gaps = 36/183 (19%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           MT        A  + +       +   ++  P               P  P  + +    
Sbjct: 1   MTPIALRTAVAALLLVPPLAFLLACAQRSGPPACP------------PADPV-VLVETVH 47

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L + +    A       + +   S   G K   GD + P G Y +G     P++ +  
Sbjct: 48  RRLALCEAGAAAA-----VFPVALGSAGTG-KRVEGDRRTPLGAYALGA--PRPSAGFGT 99

Query: 121 SINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAM-NNKQMQEIYA 165
            I I +P    +    TG+++ IHG                 +AGC A+ ++  ++ + A
Sbjct: 100 FIPIAYPTAEQRRAGFTGSNVGIHGPSRATRWAGRLNTWTDWTAGCVALGSDPDVRAVAA 159

Query: 166 IVR 168
              
Sbjct: 160 FAE 162


>gi|237804047|ref|ZP_04591632.1| hypothetical protein POR16_30526 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|237805685|ref|ZP_04592389.1| hypothetical protein POR16_34412 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331026028|gb|EGI06084.1| hypothetical protein POR16_30526 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331026793|gb|EGI06848.1| hypothetical protein POR16_34412 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 88

 Score = 79.2 bits (194), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 19/79 (24%)

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNR-----TGADLMIHGEC--------------ASAG 151
              P++ Y LS++I +PN  D A  R      G+ +MIHG                 + G
Sbjct: 3   WRKPSNNYNLSMHISYPNITDSARARNEGVKPGSMIMIHGTPVDEEYPEWYFHTLDWTNG 62

Query: 152 CYAMNNKQMQEIYAIVRDS 170
           C AM N  M+E++ +V+D 
Sbjct: 63  CIAMKNNDMREVWDLVKDG 81


>gi|54294978|ref|YP_127393.1| hypothetical protein lpl2057 [Legionella pneumophila str. Lens]
 gi|53754810|emb|CAH16297.1| hypothetical protein lpl2057 [Legionella pneumophila str. Lens]
          Length = 162

 Score = 77.6 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 65/184 (35%), Gaps = 46/184 (25%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R    + A+F  +            A  PLS                   I +   +
Sbjct: 1   MKIRAIFFMIAIFFPVT------LFASDATCPLSNG-----------------INVLTKK 37

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            IL I K        ++K +K+       G K + GD + P G Y +   +   ++++ +
Sbjct: 38  RILNICKNGT-----VVKTFKVALGYKGVG-KKKAGDNKTPIGLYGL--AHPRKSNQFKV 89

Query: 121 SINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAMN-NKQMQEIYA 165
            I I +P +   A   TG D+ IHG                ++ GC A+  N  ++ +  
Sbjct: 90  FIPILYPTKQQLAAGYTGRDVGIHGPTQSPGVFGWLNNLPGSTRGCVAVGKNNYIEYVAN 149

Query: 166 IVRD 169
            V+ 
Sbjct: 150 WVKA 153


>gi|77165191|ref|YP_343716.1| ErfK/YbiS/YcfS/YnhG [Nitrosococcus oceani ATCC 19707]
 gi|254434430|ref|ZP_05047938.1| hypothetical protein NOC27_1361 [Nitrosococcus oceani AFC27]
 gi|76883505|gb|ABA58186.1| ErfK/YbiS/YcfS/YnhG [Nitrosococcus oceani ATCC 19707]
 gi|207090763|gb|EDZ68034.1| hypothetical protein NOC27_1361 [Nitrosococcus oceani AFC27]
          Length = 213

 Score = 77.3 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 53/158 (33%), Gaps = 50/158 (31%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + I K++ +L + K        ++K+Y      G  G K   GD+  PEG Y I      
Sbjct: 33  LIIIKSKRLLIVKKGG-----QIIKKYHAALGQGGGGGKRIEGDKHTPEGEYEIVG--FW 85

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADL-------------------------------- 141
           P+ K+   I++ +P+  D         +                                
Sbjct: 86  PSHKFHYFIHLDYPSRGDALAGYKEGLISWDELVHIYRAQQEKNGIPPQQTRLGGFIGIH 145

Query: 142 ----------MIHGE-CASAGCYAMNNKQMQEIYAIVR 168
                     MIH     + GC A+ N+++ E+   ++
Sbjct: 146 GIGEETRKKLMIHRNFNWTRGCVALTNREIDELRQFIQ 183


>gi|307610960|emb|CBX00579.1| hypothetical protein LPW_22971 [Legionella pneumophila 130b]
          Length = 154

 Score = 76.9 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 23/131 (17%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +   + IL I K        ++K +K+       G K + GD + P G Y +   +  
Sbjct: 23  INVLTKKRILNICKNGT-----VVKTFKVALGYKGVG-KKKAGDNKTPIGLYGL--AHPR 74

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAMN-NK 158
            ++++ + I I +P +   A   TG D+ IHG                ++ GC A+  N 
Sbjct: 75  KSNQFKVFIPILYPTKQQLAAGYTGRDVGIHGPTQSPGVFGWLNNLPGSTRGCVAVGKNN 134

Query: 159 QMQEIYAIVRD 169
            ++ +   V+ 
Sbjct: 135 YIEYVANWVKA 145


>gi|54298010|ref|YP_124379.1| hypothetical protein lpp2067 [Legionella pneumophila str. Paris]
 gi|148359657|ref|YP_001250864.1| hypothetical protein LPC_1575 [Legionella pneumophila str. Corby]
 gi|296107703|ref|YP_003619404.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
 gi|53751795|emb|CAH13219.1| hypothetical protein lpp2067 [Legionella pneumophila str. Paris]
 gi|148281430|gb|ABQ55518.1| conserved hypothetical protein [Legionella pneumophila str. Corby]
 gi|295649605|gb|ADG25452.1| putative protein conserved in bacteria [Legionella pneumophila
           2300/99 Alcoy]
          Length = 162

 Score = 76.9 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 23/131 (17%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +   + IL I K        ++K +K+       G K + GD + P G Y +   +  
Sbjct: 31  INVLTKKRILNICKNGT-----VVKTFKVALGYKGVG-KKKAGDNKTPIGLYGL--AHPR 82

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAMN-NK 158
            ++++ + I I +P +   A   TG D+ IHG                ++ GC A+  N 
Sbjct: 83  KSNQFKVFIPILYPTKKQLAAGYTGRDVGIHGPTQSPGVFSWLNNLPGSTRGCVAVGKNN 142

Query: 159 QMQEIYAIVRD 169
            ++ +   V+ 
Sbjct: 143 YIEYVANWVKA 153


>gi|254496265|ref|ZP_05109158.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354522|gb|EET13164.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 162

 Score = 76.5 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/176 (20%), Positives = 62/176 (35%), Gaps = 46/176 (26%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +   LL ++F  +            A  PLS                   I +   +
Sbjct: 1   MKIKAISLLISIFFPVA------LFASTATCPLSNG-----------------INVHTTK 37

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            IL I K        ++K +K+   +   G K   GD + P G Y +   +   ++++ +
Sbjct: 38  QILNICKHGT-----VIKTFKVALGNKGVG-KKRAGDNKTPIGLYGL--AHPRKSNQFKV 89

Query: 121 SINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAMN-NKQMQ 161
            I I +P     A   TG D+ IHG                ++ GC A+  N  ++
Sbjct: 90  FIPILYPTTKQLAAGYTGRDVGIHGPTQSSNWFSWLNNLPNSTRGCIAVGKNNHIE 145


>gi|52842341|ref|YP_096140.1| hypothetical protein lpg2127 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629452|gb|AAU28193.1| hypothetical protein lpg2127 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 162

 Score = 76.5 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 65/186 (34%), Gaps = 50/186 (26%)

Query: 1   MTNRYNILLFALFIF--LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           M  R    + A+F    L   + +  L +                          I +  
Sbjct: 1   MKIRAIFFMIAIFFPVTLFASNTTCPLSNG-------------------------INVLT 35

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
            + IL I K        ++K +K+       G K + GD + P G Y +   +   ++++
Sbjct: 36  KKRILNICKNGT-----VVKTFKVALGYKGVG-KKKAGDNKTPIGLYGL--AHPRKSNQF 87

Query: 119 FLSINIGFPNEFDKAHNRTGADLMIHG--------------ECASAGCYAMN-NKQMQEI 163
            + I I +P +   A   +G D+ IHG                ++ GC A+  N  ++ +
Sbjct: 88  KVFIPILYPTKKQLAAGYSGRDVGIHGPAQTSNLFGWLNNLPGSTRGCVAVGKNNYIEYV 147

Query: 164 YAIVRD 169
              V+ 
Sbjct: 148 ANWVKA 153


>gi|165924287|ref|ZP_02220119.1| putative lipoprotein [Coxiella burnetii RSA 334]
 gi|165916267|gb|EDR34871.1| putative lipoprotein [Coxiella burnetii RSA 334]
          Length = 107

 Score = 73.4 bits (179), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 114 PNSKYFLSINIGFPNEFDKAHNRT------GADLMIHGECASAGCYAMNNKQMQEIYAIV 167
           P S++ LS+ + +PN  D+ + R       G D+ IHG  AS GC  + NK +++++ + 
Sbjct: 1   PASRFDLSLMLNYPNSADRYYARLDHRHDLGDDIFIHGSDASIGCIPIGNKAIEQLFVLA 60

Query: 168 RDSLRGNMQSHIQIQAFPFRMT 189
                   + HI++   P  + 
Sbjct: 61  ----YLVGERHIKVIIAPDDLR 78


>gi|295111271|emb|CBL28021.1| Uncharacterized protein conserved in bacteria [Synergistetes
           bacterium SGP1]
          Length = 263

 Score = 72.6 bits (177), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 59/173 (34%), Gaps = 31/173 (17%)

Query: 17  NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHP------TVIRIFKNENILEIWKRNV 70
                  +++ + E P  E   ++      S   P        I I K +  L +++   
Sbjct: 90  AASSEPGAVLPEVEEPEDETPQMTEPTPTPSALRPPRDAGKYWILINKGQYRLSLYRGRD 149

Query: 71  DAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----GWNNLNPNSKYFLSINIG 125
                L+K Y +       G K   GD + PEG + +          +        I   
Sbjct: 150 -----LVKTYNVAIGKNP-GNKRRVGDNRTPEGQFRVLSIENASGWKHDFGDGKGEIAGA 203

Query: 126 FPNEFDKAHNRTGA--DLMIHGEC--------ASAGCYAMNNKQMQEI--YAI 166
           +   F +    TG    + IHG          AS GC  MNN +++++  YA 
Sbjct: 204 YGPWFIRL--DTGGWKGIGIHGTHAPDSLGTMASEGCIRMNNDEIRDLKNYAY 254


>gi|295798113|emb|CAX68938.1| ErfK/YbiS/YcfS/YnhG family protein [uncultured bacterium]
          Length = 267

 Score = 72.3 bits (176), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 31/129 (24%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I++ K+EN L +++ +      L+K Y++C      G K        P G + I     +
Sbjct: 147 IKVDKSENKLRLYQDD-----ALIKTYRVCT-----GEK-----NSTPVGTFTIETKLED 191

Query: 114 PNSKYFLSINIGFP--NEFDKAHNR-TGADLM---IHGEC--------ASAGCYAMNNKQ 159
           P   ++ S  +  P     +    R  G  L    IHG          AS+GC  M NK 
Sbjct: 192 P--TWYKSPGVAIPPKTPENILGTRWMGFSLASYGIHGTTLPETIGTQASSGCIRMLNKD 249

Query: 160 MQEIYAIVR 168
           ++E+Y+IV 
Sbjct: 250 VEELYSIVP 258


>gi|92113689|ref|YP_573617.1| ErfK/YbiS/YcfS/YnhG [Chromohalobacter salexigens DSM 3043]
 gi|91796779|gb|ABE58918.1| ErfK/YbiS/YcfS/YnhG [Chromohalobacter salexigens DSM 3043]
          Length = 212

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 51/170 (30%), Gaps = 45/170 (26%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           L+        +      + I   E  L+I++     +  + +   +    G      + G
Sbjct: 17  LLAWNMPSAMAADDEIWVLIDDREATLDIYR----GDTRIERFEPVSLGRGGTARVRKQG 72

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT------------------- 137
               P G ++I    +N  SK+ + + + +P                             
Sbjct: 73  SNMTPTGEFHINR--INRESKFNIFLGLDYPKLETAREAMRAGLMSPAEYADFQDAYYRN 130

Query: 138 ---------GADLMIHGE-----------CASAGCYAMNNKQMQEIYAIV 167
                    G  + IHG              + GC A+ N Q++E+  +V
Sbjct: 131 GAPPQDTVLGGYIGIHGLGASDPDIHRRFHWTEGCVAVTNPQIEELTRLV 180


>gi|255593471|ref|XP_002535877.1| conserved hypothetical protein [Ricinus communis]
 gi|223521663|gb|EEF26508.1| conserved hypothetical protein [Ricinus communis]
          Length = 197

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 48/123 (39%), Gaps = 29/123 (23%)

Query: 117 KYFLSINIGFPNEFDKAHNRTGADLMIHGECA---------SAGCYAMNNKQMQEIYAIV 167
               +  + +PNE+DK   + G  + +HG  +         S GC  + N  +  +  ++
Sbjct: 2   YGTAAYPLSYPNEWDKHRGKNGHGIWLHGTPSNTYSRPPRASDGCVVLTNPDISALAPVL 61

Query: 168 R----------------DSLRGNMQSHIQ-IQAFPFRMTSKNMQLYQNNPNYSFW---NM 207
           +                ++L+   +S +Q ++ +     ++N + Y +  +  F+     
Sbjct: 62  QEGRTPVVIVGSNLGNPEALQAERESLMQAMEQWRRDWEAQNTEDYLSKYSRDFFSEGKN 121

Query: 208 LKL 210
           LK 
Sbjct: 122 LKT 124


>gi|227825038|ref|ZP_03989870.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226905537|gb|EEH91455.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 224

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/165 (16%), Positives = 52/165 (31%), Gaps = 23/165 (13%)

Query: 22  SRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK 81
            +   + A  P         +           I + K  + L +   +      +++ Y 
Sbjct: 56  PQKAPEPAISPEKAKEADRKESISLDASKSYHIIVEKKAHRLSLLLGDT-----VVRSYG 110

Query: 82  ICAWSGTFGPKIETGDEQAPEGFYYIG-----WNNLNPNSKYFLSINIGFPNEFDKA--H 134
                G  G K   GD   P G + +       +  +        I   +   F      
Sbjct: 111 CAIGKGGLGQKQRRGDNMTPVGTFTVDEIDDASSWPHDFGDGRGEIAGAYGPWFISLDTE 170

Query: 135 NRTGA---DLMIH--------GECASAGCYAMNNKQMQEIYAIVR 168
             +G     + IH        G  AS GC  ++N+ +QE+ ++V+
Sbjct: 171 ALSGGAWDGIGIHGTHDPQSIGTDASEGCIRLHNEDLQELRSVVK 215


>gi|300114070|ref|YP_003760645.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosococcus watsonii C-113]
 gi|299540007|gb|ADJ28324.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosococcus watsonii C-113]
          Length = 213

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 56/175 (32%), Gaps = 50/175 (28%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           L   + +   S   P  + I K++ +L + K        ++K Y      G  G K   G
Sbjct: 16  LANPLVEAAPSTEFPYELIIIKSKRLLIVKKGR-----QIIKRYHAAFGRGGVGGKRVEG 70

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADL--------------- 141
           D+  PEG Y +      P+ K+   I++ +P+  D         +               
Sbjct: 71  DKHTPEGNYEVVG--FWPSHKFHYFIHLDYPSRGDALVGYKKGLISRQELLHIYRAQQEK 128

Query: 142 ---------------------------MIHGE-CASAGCYAMNNKQMQEIYAIVR 168
                                      MIH     + GC A+ N ++ E+   ++
Sbjct: 129 NGIPPQQTRLGGFIGIHGIGVETRKKLMIHRNFDWTRGCVALTNTEIDELRQFIQ 183


>gi|198282860|ref|YP_002219181.1| ErfK/YbiS/YcfS/YnhG family protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667021|ref|YP_002425061.1| ErfK/YbiS/YcfS/YnhG family [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247381|gb|ACH82974.1| ErfK/YbiS/YcfS/YnhG family protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519234|gb|ACK79820.1| ErfK/YbiS/YcfS/YnhG family [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 281

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 55/160 (34%), Gaps = 50/160 (31%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I I    + L+I+K        +L  Y +        PK   GD+  P G Y IGW  
Sbjct: 66  VHIVISTITHSLKIFKGGT-----VLATYPVAIGFHGAAPKRMRGDDVTPVGRYRIGW-- 118

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRT----------------------------GADLMI 143
           ++  ++Y   + + +PN  +                                  G ++ I
Sbjct: 119 VSRGTRYGPFMGLTYPNRENAEWGLREGIINRAQYRAIVDAIDAGQTPPQNTPLGGEIGI 178

Query: 144 HGEC---------------ASAGCYAMNNKQMQEIYAIVR 168
           HG                  +AGC A++N   Q+I A+VR
Sbjct: 179 HGMGPQFSDDPQSKVFPGRWTAGCVALSNWDAQQIAALVR 218


>gi|312880800|ref|ZP_07740600.1| ErfK/YbiS/YcfS/YnhG family protein [Aminomonas paucivorans DSM
           12260]
 gi|310784091|gb|EFQ24489.1| ErfK/YbiS/YcfS/YnhG family protein [Aminomonas paucivorans DSM
           12260]
          Length = 156

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 50/140 (35%), Gaps = 22/140 (15%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
            P     ++I K ++ L +++        +   + +   S   G K   GD + PEG + 
Sbjct: 20  EPAGEVWLKIEKGQHRLVVFRGQ-----AVWDAFPVALGSNP-GQKQRRGDRRTPEGEFS 73

Query: 107 I-----GWNNLNPNSKYFLSINIGFPNEFDKAHNRTG-ADLMIHGE--------CASAGC 152
           +          +        I   +   F +   +TG   + IHG           + GC
Sbjct: 74  VVRIQDSRAWTHDFRDGKGEIPGAYGPWFIRL--KTGWDGIGIHGTHDPSSVGKDVTEGC 131

Query: 153 YAMNNKQMQEIYAIVRDSLR 172
             + N  +Q++  +VR   R
Sbjct: 132 IRLRNADLQKLRPLVRRGTR 151


>gi|261884737|ref|ZP_06008776.1| putative periplasmic protein [Campylobacter fetus subsp. venerealis
           str. Azul-94]
          Length = 200

 Score = 69.2 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 60/149 (40%), Gaps = 27/149 (18%)

Query: 114 PNSKYFL--SINIGFPNEFDKAHNRTGADLMIHGEC----------ASAGCYAMNNKQMQ 161
           P   Y+   S N+ +PN FDK  +RTG  + IHG             + GC  M N  + 
Sbjct: 1   PEDTYYGPVSFNLSYPNLFDKLRDRTGGGIWIHGFPLSGNIREDVYKTKGCVVMPNDLLL 60

Query: 162 EIYAIVRD--SLRGNMQSHI-------------QIQAFPFRMTSKNMQLYQNNPNYSFWN 206
            + +I++D   +    +S I             ++  +    T+ ++  Y +  +  F  
Sbjct: 61  NLESILKDNGGMVLINESGILEAKNEDIALIFAELFKWKEAWTNSDIDRYLSFYDKKFKR 120

Query: 207 MLKLGHDYFEKNHQEPFIQIINKQYVFFK 235
              +G D F++  +  F +  NK   F K
Sbjct: 121 YDGVGFDKFKEMKKNIFSRKENKFIQFTK 149


>gi|307824797|ref|ZP_07655020.1| ErfK/YbiS/YcfS/YnhG family protein [Methylobacter tundripaludum
           SV96]
 gi|307734155|gb|EFO05009.1| ErfK/YbiS/YcfS/YnhG family protein [Methylobacter tundripaludum
           SV96]
          Length = 180

 Score = 68.8 bits (167), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 35/122 (28%), Gaps = 41/122 (33%)

Query: 81  KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT--- 137
            I    G  G K   GD   P G Y IGW  +  +S +     + +P+  D         
Sbjct: 48  DIAIGRGGAGFKSHQGDNVTPFGSYRIGW--VGESSSFRKFFGLTYPSAEDAQKALEEGV 105

Query: 138 -------------------------GADLMIHG-----------ECASAGCYAMNNKQMQ 161
                                    G  + IHG              + GC A+ N Q+ 
Sbjct: 106 INQVAYNSIITAHRFHQVPPQNTPLGGRIGIHGLGRADEKIHKSMNWTHGCIALTNGQID 165

Query: 162 EI 163
            +
Sbjct: 166 HL 167


>gi|294101487|ref|YP_003553345.1| ErfK/YbiS/YcfS/YnhG family protein [Aminobacterium colombiense DSM
           12261]
 gi|293616467|gb|ADE56621.1| ErfK/YbiS/YcfS/YnhG family protein [Aminobacterium colombiense DSM
           12261]
          Length = 167

 Score = 68.4 bits (166), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 59/185 (31%), Gaps = 38/185 (20%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +  ILL     F    ++     +K                      P  I + K +
Sbjct: 1   MKIKNLILLTFFLCFFAAANNPALSGEKTYA----------------HEPPDRIVVEKRK 44

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW-----NNLNPN 115
            +L +++   +     +  + +       G K   GD + P G + +       + ++  
Sbjct: 45  FVLTLYREGKE-----VLSFPVAVGRNK-GNKQRVGDLRTPVGTFMVERIHDSSHWVHDF 98

Query: 116 SKYFLSINIGFPNEFDKAHNRTG-ADLMIHGEC--------ASAGCYAMNNKQMQEIYAI 166
                 I   +   F +   +TG + + IHG          A+ GC  + N  ++ +   
Sbjct: 99  KDGKGPIKGAYGPWFIRL--KTGWSGIGIHGTHDPGSIGQRATEGCVRLRNDHLELLVKH 156

Query: 167 VRDSL 171
           V   L
Sbjct: 157 VEPGL 161


>gi|284049125|ref|YP_003399464.1| ErfK/YbiS/YcfS/YnhG family protein [Acidaminococcus fermentans DSM
           20731]
 gi|283953346|gb|ADB48149.1| ErfK/YbiS/YcfS/YnhG family protein [Acidaminococcus fermentans DSM
           20731]
          Length = 241

 Score = 68.4 bits (166), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 58/184 (31%), Gaps = 35/184 (19%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSP----------FHPTVIRIFKNENILEIWKRNVDA 72
            +L +K E P+        + K+ +P               + + K+++ L +   +   
Sbjct: 64  PALPEKKETPVESLQKKQKEPKQVAPQPAAEQPLVPGKKYAVLVDKSDHKLYLKDGDT-- 121

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG-----WNNLNPNSKYFLSINIGFP 127
              +++ +      G  G K   GD   P G + I          +        I   + 
Sbjct: 122 ---VVRTWGCAIGKGGLGQKERRGDNMTPVGTFRIDEIDDASGWTHDFGDGNGEIQGAYG 178

Query: 128 N------EFDKAHNRTGADLMIH--------GECASAGCYAMNNKQMQEIYAIVRDSLRG 173
                    D +       + IH        G  AS GC  ++N  ++E+  +    +  
Sbjct: 179 PWFLSLDTEDLSQG-NWDGIGIHGTHDPASIGTDASEGCVRLDNANLRELEKVAYVGMPV 237

Query: 174 NMQS 177
            +Q 
Sbjct: 238 TIQD 241


>gi|290476305|ref|YP_003469209.1| hypothetical protein XBJ1_3327 [Xenorhabdus bovienii SS-2004]
 gi|289175642|emb|CBJ82445.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 67

 Score = 67.2 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 31/46 (67%)

Query: 188 MTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233
           MT +NMQ Y+NN NYSFW  L+  ++YF KN +   + +I+ QY+ 
Sbjct: 1   MTQQNMQRYRNNDNYSFWIQLQPAYEYFAKNSKPTTVNVIDGQYIV 46


>gi|254489736|ref|ZP_05102931.1| hypothetical protein MDMS009_67 [Methylophaga thiooxidans DMS010]
 gi|224464821|gb|EEF81075.1| hypothetical protein MDMS009_67 [Methylophaga thiooxydans DMS010]
          Length = 187

 Score = 66.9 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 66/210 (31%), Gaps = 73/210 (34%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
           NR  I++ A    L      ++  +                          + I ++E  
Sbjct: 2   NRSLIVMLACLSLLVWQQPVKATGN------------------------YELVIKRSEKR 37

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           L I K        +L+ + +   SG    K+++GD   P G Y+I    +  + ++ + I
Sbjct: 38  LLIQKDG-----EVLRSFHVALGSGGRKAKMKSGDRLTPLGKYHIT--QVRDSDRFHMFI 90

Query: 123 NIGFPNEFD-----------KAHNRT-------GA-----------------------DL 141
            + +P+  D           KA  R        G                         +
Sbjct: 91  QLDYPSVRDAITALKEDRISKAQYRKILDAHIFGNLPPQNTPLGGAIGIHGIGVETKDKI 150

Query: 142 MIHG-ECASAGCYAMNNKQMQEIYAIVRDS 170
            IH     + GC A+ N +++++   +   
Sbjct: 151 EIHEIADWTKGCIALRNDEIEQLTKYISKG 180


>gi|312879709|ref|ZP_07739509.1| ErfK/YbiS/YcfS/YnhG family protein [Aminomonas paucivorans DSM
           12260]
 gi|310783000|gb|EFQ23398.1| ErfK/YbiS/YcfS/YnhG family protein [Aminomonas paucivorans DSM
           12260]
          Length = 198

 Score = 65.7 bits (159), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 51/156 (32%), Gaps = 37/156 (23%)

Query: 41  MQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQA 100
                        I++ K+   L ++      +  L+K Y +    G    K +  D   
Sbjct: 23  QAAPFVPGPEEYWIKVDKSRLRLYLF----QGKDTLVKSYPVAVGRGVGDVKKDRLDLIT 78

Query: 101 PEGFYYI-----GWNNLNPNSKY-----------FLSINIGFPNEFDKAHNRTGADLMIH 144
           PEG + +       + L  +  +           + S  I F N +          + IH
Sbjct: 79  PEGVFKVRRVLQDASQLVYDPAWFDEPGEPQKGVYGSKLISFYNPW---------QIAIH 129

Query: 145 GECA--------SAGCYAMNNKQMQEIYAIVRDSLR 172
           G  +        + GC  M N+ +  + A V+  ++
Sbjct: 130 GTNSPRSVGRRATHGCIRMKNRDINTLVAYVKPGMK 165


>gi|313145199|ref|ZP_07807392.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313133966|gb|EFR51326.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 162

 Score = 65.3 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 47/129 (36%), Gaps = 20/129 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----G 108
           + I K+E  L +        +       I      +G K + GD + PEG + I      
Sbjct: 22  LLISKDEMKLRLIDYKGQELF----TADIACGKN-YGNKEKQGDLKTPEGTFKIIDIQDA 76

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQ 159
               +        I   + N F +     G   + IHG          A+ GC  + N +
Sbjct: 77  SKWKHDFGDGKGEIEGAYGNHFIRLET-PGHKGIGIHGTHDPLSIGTRATEGCIRIKNSE 135

Query: 160 MQEIYAIVR 168
           ++++ +++R
Sbjct: 136 LEQLVSLIR 144


>gi|253563984|ref|ZP_04841441.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251947760|gb|EES88042.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|301161709|emb|CBW21249.1| putative ErfK/YbiS/YcfS/YnhG family protein [Bacteroides fragilis
           638R]
          Length = 183

 Score = 65.3 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 47/129 (36%), Gaps = 20/129 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----G 108
           + I K+E  L +        +       I      +G K + GD + PEG + I      
Sbjct: 44  LLISKDEMKLRLIDYKGQELF----TADIACGKN-YGNKEKQGDLKTPEGTFKIIDIQDA 98

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQ 159
               +        I   + N F +     G   + IHG          A+ GC  + N +
Sbjct: 99  SKWKHDFGDGKGEIEGAYGNHFIRLET-PGHKGIGIHGTHDPLSIGTRATEGCIRIKNSE 157

Query: 160 MQEIYAIVR 168
           ++++ +++R
Sbjct: 158 LEQLVSLIR 166


>gi|53711980|ref|YP_097972.1| hypothetical protein BF0691 [Bacteroides fragilis YCH46]
 gi|60680184|ref|YP_210328.1| putative ErfK/YbiS/YcfS/YnhG family protein [Bacteroides fragilis
           NCTC 9343]
 gi|52214845|dbj|BAD47438.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|60491618|emb|CAH06370.1| putative ErfK/YbiS/YcfS/YnhG family protein [Bacteroides fragilis
           NCTC 9343]
          Length = 183

 Score = 65.3 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 47/129 (36%), Gaps = 20/129 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----G 108
           + I K+E  L +        +       I      +G K + GD + PEG + I      
Sbjct: 44  LLISKDEMKLRLIDYKGQELF----TADIACGKN-YGNKEKQGDLKTPEGTFKIIDIQDA 98

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQ 159
               +        I   + N F +     G   + IHG          A+ GC  + N +
Sbjct: 99  SKWKHDFGDGKGEIEGAYGNHFIRLET-PGHKGIGIHGTHDPLSIGTRATEGCIRIKNSE 157

Query: 160 MQEIYAIVR 168
           ++++ +++R
Sbjct: 158 LEQLVSLIR 166


>gi|255007504|ref|ZP_05279630.1| putative ErfK/YbiS/YcfS/YnhG family protein [Bacteroides fragilis
           3_1_12]
          Length = 184

 Score = 64.9 bits (157), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 47/129 (36%), Gaps = 20/129 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----G 108
           + I K+E  L +        +       I      +G K + GD + PEG + I      
Sbjct: 44  LLISKDEMKLRLIDYKGQELF----TADIACGKN-YGNKEKQGDLKTPEGTFKIIDIQDA 98

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQ 159
               +        I   + N F +     G   + IHG          A+ GC  + N +
Sbjct: 99  SKWKHDFGDGKGEIEGAYGNHFIRLET-PGHKGIGIHGTHDPLSIGTRATEGCIRIKNSE 157

Query: 160 MQEIYAIVR 168
           ++++ +++R
Sbjct: 158 LEQLVSLIR 166


>gi|78044166|ref|YP_359174.1| putative peptidoglycan-binding protein [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996281|gb|ABB15180.1| putative peptidoglycan-binding protein [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 214

 Score = 64.9 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/197 (18%), Positives = 61/197 (30%), Gaps = 69/197 (35%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +   L+F +                   PL+                  +I I    
Sbjct: 1   MVKKLFFLVFLMIFL---------------TPLTG-----------LANEKNIIVIETRT 34

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP--EGFYYIGWNNLNPNSKY 118
            +L +++ N      L+K+Y +             GD + P   G + I +   N  S +
Sbjct: 35  RLLYLFREN-----KLVKKYPVAL-----------GDLKTPTPIGCFKITFMRKNWGSGF 78

Query: 119 F-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVRD 169
               + +  P          G    IHG           S GC  M N+ ++E+Y  V  
Sbjct: 79  GSRFLGLNVP------WGMYG----IHGTNKPGSIGSYASHGCIRMLNRHVEELYEKV-- 126

Query: 170 SLRGNMQSHIQIQAFPF 186
               ++Q  + I   PF
Sbjct: 127 ----HLQDQVIILGNPF 139


>gi|308068492|ref|YP_003870097.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus polymyxa E681]
 gi|305857771|gb|ADM69559.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus polymyxa E681]
          Length = 474

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 60/164 (36%), Gaps = 26/164 (15%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTS-PFHPTVIRIFKNENILEIWKRNVD 71
            +   G    +++   A+     + +++           P  I + K+++ L +   N  
Sbjct: 291 LLASPGQGTGKAVDLDADSTAESSPLLASSLHGRPFLGQPLRIVVDKSKHRLALVSGN-- 348

Query: 72  AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK-----YFLSINIGF 126
              VL++ Y I               E+ PEG + I    +NPN K         + +  
Sbjct: 349 ---VLIRNYPIGLGG-----------ERTPEGKFVITDKVVNPNGKSNGEFGSRGMQLSA 394

Query: 127 PNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDS 170
            N      N+    +   G+  S GC  M  + ++E++A+V   
Sbjct: 395 TNYAIHGTNKP-DSI---GKNESLGCVRMGKEDVEELFALVPSG 434


>gi|194332934|ref|YP_002014794.1| hypothetical protein Paes_0087 [Prosthecochloris aestuarii DSM 271]
 gi|194310752|gb|ACF45147.1| hypothetical protein Paes_0087 [Prosthecochloris aestuarii DSM 271]
          Length = 93

 Score = 63.8 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 27/80 (33%)

Query: 125 GFPNEFDKAHNR-----TGADLMIHGEC--------------ASAGCYAMNNKQMQEIYA 165
            +P+  D+   R      G D+ IHG                 + GC A+ N +M E++ 
Sbjct: 22  DYPDPTDRMRARKAGLHPGGDICIHGWPDSVGQRGAVPLTGDWTLGCIAVTNDEMDELWH 81

Query: 166 IVRDSLRGNMQSHIQIQAFP 185
            V             +  +P
Sbjct: 82  AVPVGT--------PVIIYP 93


>gi|114330567|ref|YP_746789.1| hypothetical protein Neut_0550 [Nitrosomonas eutropha C91]
 gi|114307581|gb|ABI58824.1| conserved hypothetical protein [Nitrosomonas eutropha C91]
          Length = 181

 Score = 63.4 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 49/159 (30%), Gaps = 47/159 (29%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIG 108
               I I  +E+ L + +++      +L  +  +             GD Q P G + I 
Sbjct: 22  QDVWILIDTSEHRLSVMRKD-----KVLLTFDNVAIGRYGASRSRMRGDNQTPLGSFQIS 76

Query: 109 WNNLNPNSKYFLSINIGFPNEF--DKAH--NRTGADLM---------------------- 142
           W  +  + +++    I +PN    D A    R    +                       
Sbjct: 77  W--VKQHDRFYRFYGINYPNREVADLALSEGRISRQVWENIMNAIESTGLSPQDTSLGGY 134

Query: 143 ------------IHGE-CASAGCYAMNNKQMQEIYAIVR 168
                       +H     + GC A+ N Q+ ++   V+
Sbjct: 135 IGIHGIGKGDQAVHSRFNWTNGCVALTNVQIDQLNPWVK 173


>gi|310641373|ref|YP_003946131.1| erfk/ybis/ycfs/ynhg family protein [Paenibacillus polymyxa SC2]
 gi|309246323|gb|ADO55890.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus polymyxa SC2]
          Length = 476

 Score = 61.5 bits (148), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 62/176 (35%), Gaps = 44/176 (25%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
              P  I + K+++ L +   N+     L++ Y I               E+ PEG + I
Sbjct: 329 LEQPLRIVVDKSKHRLALVSGNI-----LIRNYPIGLGG-----------ERTPEGKFVI 372

Query: 108 GWNNLNPNSKYFLSINIGFPNEFDKAHNR----TGADLMIHGECA--------SAGCYAM 155
               +NPN K               +       T   +  HG           S GC  M
Sbjct: 373 TDKVVNPNGKSNGEFG---------SRGMQLSATNYAI--HGTNEPESIGKNESLGCVRM 421

Query: 156 NNKQMQEIYAIVRDSLR---GNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF-WNM 207
             + ++E++A+V        GN     Q+     R TS+  Q  Q NP+ ++ W  
Sbjct: 422 GKEDVEELFALVPSGTEVVIGNGGLPDQVLVPSSRFTSE-PQHDQTNPHKTYHWLN 476


>gi|289522182|ref|ZP_06439036.1| ErfK/YbiS/YcfS/YnhG family protein [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289504018|gb|EFD25182.1| ErfK/YbiS/YcfS/YnhG family protein [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 225

 Score = 61.1 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 49/127 (38%), Gaps = 27/127 (21%)

Query: 58  KNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSK 117
           K E++L           V+   + +       G K++ GD + PEG +Y+       +S 
Sbjct: 94  KKEHVLLALSETDK---VIYGGWMVATGRNP-GQKLKVGDMRTPEGVFYV---KSIEDSS 146

Query: 118 YFLSI-------NIGFPNEFDKAHNRTG-ADLMIH----------GECASAGCYAMNNKQ 159
           ++ S         IG+   F +    TG   + IH          G  AS GC  M N  
Sbjct: 147 FWGSYVDKATKERIGYGPYFIRLE--TGWKGIGIHGTDDEHLHEIGTDASHGCIRMANDD 204

Query: 160 MQEIYAI 166
           + E+ ++
Sbjct: 205 LLEVVSM 211


>gi|224536863|ref|ZP_03677402.1| hypothetical protein BACCELL_01739 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521529|gb|EEF90634.1| hypothetical protein BACCELL_01739 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 181

 Score = 61.1 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 46/128 (35%), Gaps = 20/128 (15%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG----- 108
           I I K E  L +        +       +       G K + GD + PEG + +      
Sbjct: 40  ILISKQEMKLRLIDYKGQEIFCA----PVATGKN-VGDKRKQGDMRTPEGVFQVSDIQRA 94

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQ 159
            +  +        I+  + + F +     G   + IHG          AS GC  M N+ 
Sbjct: 95  TDWKHDFGDGKGEIDGAYGDFFIRLL-VPGHKGIGIHGTHLPESIGTRASEGCIRMYNED 153

Query: 160 MQEIYAIV 167
           ++++ +++
Sbjct: 154 LKKLVSLI 161


>gi|260593416|ref|ZP_05858874.1| ErfK/YbiS/YcfS/YnhG family protein [Prevotella veroralis F0319]
 gi|260534692|gb|EEX17309.1| ErfK/YbiS/YcfS/YnhG family protein [Prevotella veroralis F0319]
          Length = 330

 Score = 60.7 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 61/169 (36%), Gaps = 24/169 (14%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPE-------GF 104
             I + K +  L ++      +  L+  Y  CA+S   G K + GD + P          
Sbjct: 98  LFIVMSKKDYYLYVY-EPQGKDTTLIARYD-CAFSLKKGQKEKEGDMRTPHCTIDNPFHV 155

Query: 105 YYIGWNNLNPNSKYFLSINI-GFPNEFDKAHNRTGADLMIHGECA---------SAGCYA 154
             I   +   +        I  + + F +      + + IHG            S GC  
Sbjct: 156 QQIVSASNWEHDFGDGRGKIKSYGDYFLRLKTPGHSGIGIHGSTNNRESVPGRASEGCIR 215

Query: 155 MNNKQMQEIY-AIVRDSLRGNMQSHIQIQAFPF---RMTSKNMQLYQNN 199
           + ++ ++++      + ++  +++   +  +PF    M  + ++  ++ 
Sbjct: 216 LKDEDIKDLSENYATEGMKVVIKAE-NVDDYPFEIHAMKRQKIERKRHF 263


>gi|317473568|ref|ZP_07932858.1| ykud domain-containing protein [Anaerostipes sp. 3_2_56FAA]
 gi|316898970|gb|EFV20994.1| ykud domain-containing protein [Anaerostipes sp. 3_2_56FAA]
          Length = 226

 Score = 60.7 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/224 (12%), Positives = 66/224 (29%), Gaps = 57/224 (25%)

Query: 1   MTNRY--NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFK 58
           M  R+   +L+  L   + G +        A          S  +   S      ++ +K
Sbjct: 2   MKKRWMAIVLMAVLIWNMAGTNLETRTAYAASKQTIWQKKFSQYRYNKSVNQLIFVK-YK 60

Query: 59  NENILEIWK-RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW-------- 109
            ++   ++  +  D ++  + + K          K   GD + P G +            
Sbjct: 61  KKSKATVYMYQKRDHKWKRILKCKGYVGKKGI-HKKREGDLKTPSGTFGFTGAFGIKKNP 119

Query: 110 --------------------------------------NNLNPNSKYFLSINIGFPNEFD 131
                                                 + ++    Y+  + + + N   
Sbjct: 120 GAKMNYTRVNKYLYWCGDKKYYNRLIDVRKKKHRCRGEHLIDYKPHYYYGMFLNY-NP-- 176

Query: 132 KAHNRTGADLMIH---GECASAGCYAMNNKQMQEIYAIVRDSLR 172
           K   + G+ + +H    +  +AGC A++ K M++I        R
Sbjct: 177 KHKYKKGSAIFLHCKGKKPYTAGCIAVSRKNMKKIIKNAESGAR 220


>gi|269792192|ref|YP_003317096.1| ErfK/YbiS/YcfS/YnhG family protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269099827|gb|ACZ18814.1| ErfK/YbiS/YcfS/YnhG family protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 228

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 49/138 (35%), Gaps = 22/138 (15%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           T       I+I K++  L + K         +K + +    G    K +  D   PEG +
Sbjct: 28  TPEKDEYWIKIDKSKLRLYLMKGEEQ-----VKSFPVAIGRGKGDVKKDRLDLITPEGVF 82

Query: 106 YI------------GWNNLN----PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECAS 149
            +              +  N    P    + S  I F N +  A + T +   I G+  +
Sbjct: 83  KVRRIVQDARNMVFDPSWFNEPGEPQKGVYGSKLISFYNPWQIAIHGTNSPSSI-GKRVT 141

Query: 150 AGCYAMNNKQMQEIYAIV 167
            GC  M N+ ++ +   +
Sbjct: 142 HGCIRMRNRDIETLVTYI 159


>gi|302390198|ref|YP_003826019.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200826|gb|ADL08396.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosediminibacter oceani DSM
           16646]
          Length = 229

 Score = 60.3 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/182 (17%), Positives = 51/182 (28%), Gaps = 44/182 (24%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     ++ F + IFL     S      A  P S             P     I I+  E
Sbjct: 1   MRKSIRVIAF-MIIFLM----SFYSPSPAYQPTSPKPPDK-------PQGDVSIVIYALE 48

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L +            K + +   +          D   P G + I   +         
Sbjct: 49  RKLVVMVDG-----KPFKTFPVAVGTF---------DTPTPIGLFRITEKSKWGEGFGTR 94

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVRDSLR 172
            + +  P          G    IHG           S GC  M+N+ ++++Y  V+   +
Sbjct: 95  WMRLSVP------WGTYG----IHGTNKPHSIGSFASHGCIRMHNRHVEQLYDWVKVGTK 144

Query: 173 GN 174
             
Sbjct: 145 VY 146


>gi|88811972|ref|ZP_01127225.1| hypothetical protein NB231_06266 [Nitrococcus mobilis Nb-231]
 gi|88790856|gb|EAR21970.1| hypothetical protein NB231_06266 [Nitrococcus mobilis Nb-231]
          Length = 186

 Score = 59.2 bits (142), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 51/163 (31%), Gaps = 47/163 (28%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                   + I  + +  E+ +     +  L++   I    G   P    GDE  P G Y
Sbjct: 23  VRADSRVWVLIDTHRDRAEVLR----GDQPLVRFPNISWGRGGVAPVHTAGDETTPLGHY 78

Query: 106 YIGWNNLNPNSKYFLSINIGFPNE--FDKAHNRTG-----------ADLMIHGE------ 146
            I    +  +S++ + + + +P     D+A  R G              + HG+      
Sbjct: 79  RITR--IKYHSRFHVFLELNYPTLTHLDRAF-RDGIVDTMTYQDLLNYALAHGQLPQATE 135

Query: 147 ---------------------CASAGCYAMNNKQMQEIYAIVR 168
                                  + GC A+ + Q+  +   V+
Sbjct: 136 LGGHIGIHGLGRADPAMHARFHWTQGCIALTDNQIDRLLDYVQ 178


>gi|224825430|ref|ZP_03698535.1| ErfK/YbiS/YcfS/YnhG [Lutiella nitroferrum 2002]
 gi|224602351|gb|EEG08529.1| ErfK/YbiS/YcfS/YnhG [Lutiella nitroferrum 2002]
          Length = 183

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/167 (14%), Positives = 44/167 (26%), Gaps = 47/167 (28%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGF 104
           T       I +      L +++ +       L+ +  I    G   P    GD   P G 
Sbjct: 20  THAGTERWIEVDTAARTLTVYQGS-----RPLQRFDNISVGRGGVAPLHYHGDGSTPLGS 74

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRT--------------------------- 137
           ++I          +     + +P                                     
Sbjct: 75  FHIMRIRTPHV--FGSFYQLDYPRPEHAEQAFLDGRIDAGTRDDILLAARAGRLPPQFTA 132

Query: 138 -GADLMIHGE-----------CASAGCYAMNNKQMQEIYAIVRDSLR 172
            G  + IHG              + GC A++N Q+ +  +  R  +R
Sbjct: 133 LGGAIGIHGVGRGSYRIHRDFNWTNGCVALSNAQLHQFASWARLGMR 179


>gi|260892380|ref|YP_003238477.1| ErfK/YbiS/YcfS/YnhG family protein [Ammonifex degensii KC4]
 gi|260864521|gb|ACX51627.1| ErfK/YbiS/YcfS/YnhG family protein [Ammonifex degensii KC4]
          Length = 206

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 62/211 (29%), Gaps = 58/211 (27%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                + +   +  L ++  +      L+K Y +                  P G + + 
Sbjct: 21  NSSLFLVVDTWQCRLLVFSED-----RLVKVYPVAVGKAET---------PTPVGNWSVT 66

Query: 109 WNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGE--CASAG------CYAMNNKQ 159
              +N  S +    I +  P          G    +HG     S G      C  M N+ 
Sbjct: 67  RKAMNWGSGFGTRWIGLDVP------WGIYG----LHGTNKPWSIGRTESQGCIRMFNRD 116

Query: 160 MQEIYAIVRDS---------LRG-----NMQSHIQIQAFPFRMTSKNMQLYQNNPNYS-- 203
           ++E+Y  VR           LRG            +      M  + +   Q   +    
Sbjct: 117 IEELYPRVRPGTPVIVVGKILRGPRVLREGDCGSDV------MEVQRVLRRQGFYSGPIS 170

Query: 204 --FWNMLKLGHDYFEKNHQEPFIQ-IINKQY 231
             F    K     F+++H+ P +  +  K Y
Sbjct: 171 GRFDAQTKEAVRRFQQHHRLPSLGEVDEKTY 201


>gi|167747918|ref|ZP_02420045.1| hypothetical protein ANACAC_02648 [Anaerostipes caccae DSM 14662]
 gi|167652649|gb|EDR96778.1| hypothetical protein ANACAC_02648 [Anaerostipes caccae DSM 14662]
          Length = 226

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/228 (13%), Positives = 70/228 (30%), Gaps = 64/228 (28%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF--- 57
           M  +  + +  + + +     + +L  +  +  S+  I   +  +          IF   
Sbjct: 1   MVKKRWMAIVLMAVLIWNMAGT-NLETRTAYAASKQTIWQKKFSQYRYNKSVNQLIFVKY 59

Query: 58  --KNENILEIWKRNVDAEYVLLKEYKICAWS-GTFG-PKIETGDEQAPEGFYYIGW---- 109
             K++  + ++++       +LK    C    G  G  K   GD + P G +        
Sbjct: 60  KKKSKATVYMYQKRDHKWKRILK----CKGYVGKKGIHKKREGDLKTPSGTFGFTGAFGI 115

Query: 110 ------------------------------------------NNLNPNSKYFLSINIGFP 127
                                                     + ++    Y+  + + + 
Sbjct: 116 KKNPGAKMNYTRVNKYLYWCGDKKYYNRLIDVRKKKHRCRGEHLIDYKPHYYYGMFLNY- 174

Query: 128 NEFDKAHNRTGADLMIH---GECASAGCYAMNNKQMQEIYAIVRDSLR 172
           N   K   + G+ + +H    +  +AGC A++ K M++I        R
Sbjct: 175 NP--KHKYKKGSAIFLHCKGKKPYTAGCIAVSRKNMKKIIKNAESGAR 220


>gi|121996921|ref|YP_001001708.1| ErfK/YbiS/YcfS/YnhG [Halorhodospira halophila SL1]
 gi|121588326|gb|ABM60906.1| ErfK/YbiS/YcfS/YnhG [Halorhodospira halophila SL1]
          Length = 195

 Score = 58.8 bits (141), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 42/144 (29%), Gaps = 42/144 (29%)

Query: 64  EIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSI 122
           E ++  V         ++               GD   P G + I    +N  S+Y L +
Sbjct: 45  EAYRMTVFEGERPFAHFENPAVGRYGTAETRRRGDRTTPLGKFRINR--INEQSEYHLFL 102

Query: 123 NIGFPNEFDKAHNR-TG-------------------------------------ADLMIH 144
            + +P+  +    R  G                                      D+  H
Sbjct: 103 GLDYPSLENARKARDAGTINQEEYLEFLDDFARLGRPPQGTALGGHIGIHGVGDGDVQFH 162

Query: 145 -GECASAGCYAMNNKQMQEIYAIV 167
                + GC A+ + Q++ + ++V
Sbjct: 163 RNVNWTDGCVALEDDQIEALASLV 186


>gi|282856102|ref|ZP_06265386.1| ErfK/YbiS/YcfS/YnhG family [Pyramidobacter piscolens W5455]
 gi|282586029|gb|EFB91313.1| ErfK/YbiS/YcfS/YnhG family [Pyramidobacter piscolens W5455]
          Length = 267

 Score = 58.8 bits (141), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 50/133 (37%), Gaps = 22/133 (16%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG----- 108
           I I K    L + + N      ++  + +       G K + GD + PEG + +      
Sbjct: 106 IYIDKAGFRLYLAEGN-----KVIDSWGVALGK-VTGNKAKAGDMRTPEGNFSVQQIQDA 159

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTG-ADLMIHGEC--------ASAGCYAMNNKQ 159
            +  +        I   +   F +   +TG   + IHG          AS GC  M N+ 
Sbjct: 160 SSWTHDFKDGKGVIKNAYGPWFIRL--KTGWKGIGIHGTHDPDSIGTLASEGCIRMRNED 217

Query: 160 MQEIYAIVRDSLR 172
           +Q++  +V   ++
Sbjct: 218 LQKLKPLVAKGMK 230


>gi|304403864|ref|ZP_07385526.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus curdlanolyticus
           YK9]
 gi|304346842|gb|EFM12674.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus curdlanolyticus
           YK9]
          Length = 469

 Score = 58.8 bits (141), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 53/146 (36%), Gaps = 35/146 (23%)

Query: 42  QKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP 101
           Q K +    P  I + K+ + L +   +     VL++ YKI    G           + P
Sbjct: 316 QSKLSLSNEPLRIIVDKSVHRLAVVSGD-----VLVRSYKIGLGGG-----------RTP 359

Query: 102 EGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM--IHGECA--------SAG 151
           EG + I     NPN +               +   T ++    IHG           S G
Sbjct: 360 EGEFNISEKVENPNGRSDGPFG---------SRGMTLSNTRYAIHGTDEPQSLGGDESLG 410

Query: 152 CYAMNNKQMQEIYAIVRDSLRGNMQS 177
           C  M+ + ++E+Y +V    R  +Q 
Sbjct: 411 CIRMSREDVEELYDLVPLGTRVTIQK 436


>gi|114320736|ref|YP_742419.1| ErfK/YbiS/YcfS/YnhG [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227130|gb|ABI56929.1| ErfK/YbiS/YcfS/YnhG [Alkalilimnicola ehrlichii MLHE-1]
          Length = 187

 Score = 58.4 bits (140), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/161 (10%), Positives = 46/161 (28%), Gaps = 47/161 (29%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEY-KICAWSGTFGPKIETGDEQAPEGFY 105
                  + +      L +++ +       ++ + +I        P    G  + P G +
Sbjct: 25  RYNGEIWLEVDAETARLTVYQGH-----RPVQVFERISVGRAGTAPFRYRGSNRTPSGEF 79

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHN-RTGA-----------DLMIHGEC------ 147
            I    ++ +S++ + + + +P          +G             L  H         
Sbjct: 80  RINR--ISHDSRFHIFLGLDYPTPRHAREALESGLFDEDDYRAYHEHLRRHRTPPQDTAL 137

Query: 148 ---------------------ASAGCYAMNNKQMQEIYAIV 167
                                 + GC A+ N++++ +   V
Sbjct: 138 GGHIGIHGIGDGDPEIHDRFHWTQGCVAVTNEEIEALVEWV 178


>gi|284047661|ref|YP_003398000.1| ErfK/YbiS/YcfS/YnhG family protein [Acidaminococcus fermentans DSM
           20731]
 gi|283951882|gb|ADB46685.1| ErfK/YbiS/YcfS/YnhG family protein [Acidaminococcus fermentans DSM
           20731]
          Length = 205

 Score = 58.4 bits (140), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 51/147 (34%), Gaps = 24/147 (16%)

Query: 44  KRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEG 103
           ++T   H   + I K E  L +           + ++ +       G K  +GD + PEG
Sbjct: 60  RQTPEPHDYALLIKKGEFTLYLLDHG-----EPVAKWPVALGKNP-GQKQVSGDMKTPEG 113

Query: 104 FYYIGWNN--LNPNSKYF---LSINIGFPNEFDKAHNR---TG--ADLMIHGEC------ 147
            + +       + +  +      I   +   F     R    G    + IHG        
Sbjct: 114 TFPVDEIIDASSWSHDFHDGKGVIQHAYGPWFISLDTRNLSKGKWDGIGIHGTHDPASIG 173

Query: 148 --ASAGCYAMNNKQMQEIYAIVRDSLR 172
             AS GC  + N  +Q++   V+  ++
Sbjct: 174 TRASEGCIRLENGNLQKLKPYVKVGMK 200


>gi|288574492|ref|ZP_06392849.1| ErfK/YbiS/YcfS/YnhG family protein [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570233|gb|EFC91790.1| ErfK/YbiS/YcfS/YnhG family protein [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 135

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 39/112 (34%), Gaps = 15/112 (13%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI----GWNNLNPNSKYFLSINIGFPNEF 130
            L   + +       G K + GD + PEG + +      +   P         +G+   F
Sbjct: 20  RLFGCWPVATGRN-IGQKRKVGDMRTPEGLFPVQSVHDASYWQPYRDKKTGDTVGYGPWF 78

Query: 131 DKAHNRTGADLMIH----------GECASAGCYAMNNKQMQEIYAIVRDSLR 172
            +      + + IH          G  AS GC  M N+ +  I  +VR   +
Sbjct: 79  IRLKTPPWSGIGIHGTDEGHLSEIGTDASHGCIRMKNEDLLRIKEVVRPGQK 130


>gi|304313392|ref|YP_003812990.1| hypothetical protein HDN1F_37850 [gamma proteobacterium HdN1]
 gi|301799125|emb|CBL47368.1| Hypothetical protein HDN1F_37850 [gamma proteobacterium HdN1]
          Length = 248

 Score = 58.0 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 67/223 (30%), Gaps = 67/223 (30%)

Query: 5   YNILLFALFIFLNGC-------HHSRSLIDKAEHPL-----------SENLIISMQKKRT 46
           +  L F + +FL+           S     +   P+            +    + + +  
Sbjct: 24  FAALAFLIALFLSNSIRAEVQFTTSIRYTPQTPPPVQHTDAAQSSTPPQTSQQAPEAQPL 83

Query: 47  SPFHP--TVIRIFKNENILEIWKRNVDAEYVLLKEYK-ICAWSGTFGPKIETGDEQAPEG 103
               P    + +  +   L + +         +K +  +        P    GD   P G
Sbjct: 84  PWVSPHQRWLLVDASSQTLSVMRGAQA-----VKRFDNVSLGRRGTQPIHYQGDTSTPLG 138

Query: 104 FYYIGWNNLNPNSKYFLSINIGFPNE-----------------FDKAHN---------RT 137
             YI   ++  +S Y L  ++ +P                    D  +          RT
Sbjct: 139 EMYID--DIRKSSNYTLFFSLNYPTAKHALIALKAGKITTLDYLDIFNAEREGRKPPYRT 196

Query: 138 --GADLMIHGE-----------CASAGCYAMNNKQMQEIYAIV 167
             G ++ IHG              + GC A++N+Q++ +   V
Sbjct: 197 PLGGEIGIHGLGHAKQEMHREFNWTRGCVALDNQQIRTLAHYV 239


>gi|30249996|ref|NP_842066.1| hypothetical protein NE2056 [Nitrosomonas europaea ATCC 19718]
 gi|30139103|emb|CAD85967.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 182

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 44/161 (27%), Gaps = 45/161 (27%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
                  I I   E  L + + +       L    I             GD Q P G + 
Sbjct: 20  YANSDIWILIDTLEQRLSVMRGDKAQ----LAFNNIAIGRYGASSSRMKGDNQTPLGSFQ 75

Query: 107 IGWNNLNPNSKYFLSINIGFPN--EFDKAHNRT--------------------------- 137
           I W  +  + +Y+    + FPN    D A                               
Sbjct: 76  ISW--IKQHHRYYRFFGVDFPNQEAADLALAEKRISRQAWLSITKAIESSRLPPQDTPLG 133

Query: 138 ---------GADLMIHGE-CASAGCYAMNNKQMQEIYAIVR 168
                      D  +H     + GC A+ N Q+ E+ + ++
Sbjct: 134 GYIGIHGIGRGDRTVHARFNWTNGCVALTNAQIDELSSWIK 174


>gi|295696513|ref|YP_003589751.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus tusciae DSM 2912]
 gi|295412115|gb|ADG06607.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus tusciae DSM 2912]
          Length = 216

 Score = 57.6 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 45/129 (34%), Gaps = 33/129 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
             P  I +  + + L +++  +      +++Y +              D   P G + + 
Sbjct: 29  GPPMRIEVDTDAHRLTVYRDGIA-----IRQYPVALGRP---------DSPTPIGHWKVI 74

Query: 109 WNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQ 159
               N    +    + +  P          G    IHG          ASAGC  M N+ 
Sbjct: 75  NKYKNWGGGFGTRWLGLNVP------WGIYG----IHGTNRPHSIGWSASAGCIRMRNQD 124

Query: 160 MQEIYAIVR 168
           ++E+Y ++R
Sbjct: 125 VEELYEMIR 133


>gi|256839836|ref|ZP_05545345.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|298375594|ref|ZP_06985551.1| ErfK/YbiS/YcfS/YnhG superfamily [Bacteroides sp. 3_1_19]
 gi|256738766|gb|EEU52091.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|298268094|gb|EFI09750.1| ErfK/YbiS/YcfS/YnhG superfamily [Bacteroides sp. 3_1_19]
          Length = 167

 Score = 57.2 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 48/152 (31%), Gaps = 35/152 (23%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
            + +++ +         + + K +  + +     D     L  + I      +G K +  
Sbjct: 2   PMATLRAQEEKADGTNRVIVSKQDMRITVLCPQGDT----LAVFPIACGRN-YGDKQQEW 56

Query: 97  DEQAPEGFYYI----GWNNLNPNS---------KYFLSINIGFPNEFDKAHNRTGADLMI 143
           D + PEG + I      +    +S                +  P         TG  + I
Sbjct: 57  DFRTPEGHFVIESVEDTSLWPRDSTRQETPGEIYGPRFFRLKTP-------GFTG--IGI 107

Query: 144 HGECA--------SAGCYAMNNKQMQEIYAIV 167
           HG           + GC  ++N+ ++    +V
Sbjct: 108 HGTANPQVIPGRITMGCIRLSNEDLKAFSRLV 139


>gi|150007649|ref|YP_001302392.1| hypothetical protein BDI_1004 [Parabacteroides distasonis ATCC
           8503]
 gi|149936073|gb|ABR42770.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 167

 Score = 57.2 bits (137), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 48/152 (31%), Gaps = 35/152 (23%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
            + +++ +         + + K +  + +     D     L  + I      +G K +  
Sbjct: 2   PMATLRAQEEKADGTNRVIVSKQDMRITVLCPQGDT----LAVFPIACGRN-YGDKQQEW 56

Query: 97  DEQAPEGFYYI----GWNNLNPNS---------KYFLSINIGFPNEFDKAHNRTGADLMI 143
           D + PEG + I      +    +S                +  P         TG  + I
Sbjct: 57  DFRTPEGHFVIESVEDTSLWPRDSTRQETPGEIYGPRFFRLKTP-------GFTG--IGI 107

Query: 144 HGECA--------SAGCYAMNNKQMQEIYAIV 167
           HG           + GC  ++N+ ++    +V
Sbjct: 108 HGTANPQVIPGRITMGCIRLSNEDLKAFSRLV 139


>gi|295694715|ref|YP_003587953.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus tusciae DSM 2912]
 gi|295410317|gb|ADG04809.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus tusciae DSM 2912]
          Length = 276

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 49/146 (33%), Gaps = 34/146 (23%)

Query: 33  LSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           +     +++  ++         I I     +L +++R+      L++ + +        P
Sbjct: 63  VGPATWVALGIEQVEWGGGQFHIAIDTERRVLSLFQRD-----RLIRSFPVAVGK-PTTP 116

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLS-INIGFPNEFDKAHNRTGADLMIHGECA-- 148
                    P G + I     NP   +  + + +  PN         G  +  HG     
Sbjct: 117 --------TPVGDWVIVEKIANPGGPFGAAWMRLSVPN--------GGYGI--HGTNNPG 158

Query: 149 ------SAGCYAMNNKQMQEIYAIVR 168
                 S GC  M+N+ + ++Y  V 
Sbjct: 159 SVGRAVSHGCVRMHNEDVIQVYQTVP 184


>gi|114567403|ref|YP_754557.1| ErfK/YbiS/YcfS/YnhG [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338338|gb|ABI69186.1| ErfK/YbiS/YcfS/YnhG [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 332

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 42/141 (29%), Gaps = 33/141 (23%)

Query: 41  MQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQA 100
           +Q          +I I      L +       +  L+KEY +                  
Sbjct: 132 LQGDSQDKRGRLLIEIDVASRKLVL-----TEDGKLVKEYPVAVGKSKT---------PT 177

Query: 101 PEGFYYIGWNNLNP-NSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAG 151
           P G + +    LN  N      + +  P          G    IHG           S G
Sbjct: 178 PLGEWKVVHKGLNWGNGFGTRWMGLNVP------WGIYG----IHGTNKPGSIGSYASHG 227

Query: 152 CYAMNNKQMQEIYAIVRDSLR 172
           C  M N+ ++E+Y +V    R
Sbjct: 228 CIRMFNRHVEELYPLVPAGTR 248


>gi|255013825|ref|ZP_05285951.1| hypothetical protein B2_07952 [Bacteroides sp. 2_1_7]
          Length = 165

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 48/151 (31%), Gaps = 35/151 (23%)

Query: 38  IISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGD 97
           + +++ +         + + K +  + +     D     L  + I      +G K +  D
Sbjct: 1   MATLRAQEEKADGTNRVIVSKQDMRITVLCPQGDT----LAVFPIACGRN-YGDKQQEWD 55

Query: 98  EQAPEGFYYI----GWNNLNPNS---------KYFLSINIGFPNEFDKAHNRTGADLMIH 144
            + PEG + I      +    +S                +  P         TG  + IH
Sbjct: 56  FRTPEGHFVIESVEDTSLWPRDSTRQETPGEIYGPRFFRLKTP-------GFTG--IGIH 106

Query: 145 GECA--------SAGCYAMNNKQMQEIYAIV 167
           G           + GC  ++N+ ++    +V
Sbjct: 107 GTANPQVIPGRITMGCIRLSNEDLKAFSRLV 137


>gi|150017149|ref|YP_001309403.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium beijerinckii NCIMB
           8052]
 gi|149903614|gb|ABR34447.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium beijerinckii NCIMB
           8052]
          Length = 230

 Score = 56.8 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 51/179 (28%), Gaps = 43/179 (24%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  R  I    L I      +S      AE              +        I +  +E
Sbjct: 1   MKRRRFIRNTILLIIFVFILNSLRYAVNAES-------------KIHSNSNISILVDISE 47

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L +     +   ++LK+Y I +               +P G + +             
Sbjct: 48  ERLYLIDTEKN---IILKKYTIASGKQET---------PSPVGTWKVVRMAKWSGGFGTR 95

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVRDSL 171
            I +  P          G    IHG           S GC  M NK ++E+Y  V+  +
Sbjct: 96  WIGLNVP------WGIYG----IHGTNKPYSIGSEASHGCIRMRNKDIEELYEYVKRGM 144


>gi|121535699|ref|ZP_01667503.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosinus carboxydivorans
           Nor1]
 gi|121305730|gb|EAX46668.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosinus carboxydivorans
           Nor1]
          Length = 238

 Score = 56.5 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 45/132 (34%), Gaps = 33/132 (25%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           T+P     I I   E ILE++         L K+Y++                  P G +
Sbjct: 50  TAPTGTVSIIIKVPERILEVYNDG-----QLYKKYRVAVGKSKT---------PTPVGEW 95

Query: 106 YIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMN 156
            + W + N  S +    + +  P          G    IHG           S GC  M 
Sbjct: 96  KVVWKDYNWGSGFGTRWMGLNVP------WGVYG----IHGTNNPWSIGRFASHGCIRMR 145

Query: 157 NKQMQEIYAIVR 168
           NK ++E++  V 
Sbjct: 146 NKDVEELFEWVP 157


>gi|317132365|ref|YP_004091679.1| ErfK/YbiS/YcfS/YnhG family protein [Ethanoligenens harbinense
           YUAN-3]
 gi|315470344|gb|ADU26948.1| ErfK/YbiS/YcfS/YnhG family protein [Ethanoligenens harbinense
           YUAN-3]
          Length = 235

 Score = 56.1 bits (134), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 45/144 (31%), Gaps = 32/144 (22%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           +      +  +   +  +P +I I   EN L ++K        L + Y            
Sbjct: 26  VQHAFQANGMRASATSPNPYMILIQVQENRLSLFKNG-----KLYRSYSCATGKE----- 75

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE------ 146
               D  +P G + I              + +  P          G    IHG       
Sbjct: 76  ----DTPSPCGTFQINRKARWGEGFGGYFLGLNCP------WGNYG----IHGTTRPDSV 121

Query: 147 --CASAGCYAMNNKQMQEIYAIVR 168
              +S GC+ M  K ++ +Y++V 
Sbjct: 122 GQPSSHGCFRMYGKDIRALYSLVP 145


>gi|226314511|ref|YP_002774407.1| hypothetical protein BBR47_49260 [Brevibacillus brevis NBRC 100599]
 gi|226097461|dbj|BAH45903.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 237

 Score = 55.7 bits (133), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 57/185 (30%), Gaps = 44/185 (23%)

Query: 1   MTNR---YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV-IRI 56
           M NR   + ++ FA  + L       ++    E  + + ++ +              I +
Sbjct: 1   MVNRTITHLLICFAAILLL-------TVSFPVEIEIGQKIVYAEHSLPIISDQGIFTIEV 53

Query: 57  FKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN- 115
           +  ++ L + K         +K Y +        P         P G Y + +   +   
Sbjct: 54  YPRKHKLIVKKHG-----KTIKTYPVAVG-NPSTP--------TPVGEYKVIYKGKDWGP 99

Query: 116 SKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIV 167
           S     + +  P          G    IHG           S GC  M N  + E++ ++
Sbjct: 100 SFGPRWLGLNVP------WGIYG----IHGTNKPYSIGQHLSHGCIRMRNNDVIELFKMI 149

Query: 168 RDSLR 172
               +
Sbjct: 150 PLGTK 154


>gi|91201948|emb|CAJ75008.1| hypothetical protein kuste4246 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 314

 Score = 55.7 bits (133), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 43/132 (32%), Gaps = 35/132 (26%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K+E  L +   +       +K+Y+I                + PEG + +     N
Sbjct: 190 ILISKSEFTLTVLLND-----RYVKQYRIGTGKND----------KTPEGTFEVKNKMKN 234

Query: 114 PNSKYFLSINIGFPNEFDKAHNR----------TGADLMIHGEC--------ASAGCYAM 155
           P           + +E +    R           G  +  HG          +S GC  M
Sbjct: 235 PTWYSPYGGVYSYGDEKNILGTRWIGFKEKENLAGFGI--HGTTMPETIGTASSDGCIRM 292

Query: 156 NNKQMQEIYAIV 167
            N  ++E++  V
Sbjct: 293 KNSDVEEVFDFV 304


>gi|52080005|ref|YP_078796.1| peptidoglycan-binding protein YkuD [Bacillus licheniformis ATCC
           14580]
 gi|52785379|ref|YP_091208.1| YkuD [Bacillus licheniformis ATCC 14580]
 gi|319646218|ref|ZP_08000448.1| spore protein ykuD [Bacillus sp. BT1B_CT2]
 gi|81385713|sp|Q65K99|YKUD_BACLD RecName: Full=Putative L,D-transpeptidase YkuD; AltName: Full=Spore
           protein YkuD homolog
 gi|52003216|gb|AAU23158.1| Peptidoglycan-binding protein YkuD [Bacillus licheniformis ATCC
           14580]
 gi|52347881|gb|AAU40515.1| YkuD [Bacillus licheniformis ATCC 14580]
 gi|317391968|gb|EFV72765.1| spore protein ykuD [Bacillus sp. BT1B_CT2]
          Length = 165

 Score = 55.3 bits (132), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 48/130 (36%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +  N   L +++R+      L+K Y I         KI T   Q P G + I   
Sbjct: 56  PYRIAVSLNGRTLRLYERD-----RLVKTYPIAVG------KILT---QTPRGEFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+N+ + E
Sbjct: 102 QPNPGGPF-GAYWLS------LSKQHYG----IHGTNNPSSIGKAVSRGCIRMHNRDVLE 150

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 151 LASIVPNGTR 160


>gi|148381127|ref|YP_001255668.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str.
           ATCC 3502]
 gi|153930963|ref|YP_001385502.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str.
           ATCC 19397]
 gi|153934739|ref|YP_001388908.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str.
           Hall]
 gi|148290611|emb|CAL84740.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927007|gb|ABS32507.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str.
           ATCC 19397]
 gi|152930653|gb|ABS36152.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A str.
           Hall]
          Length = 231

 Score = 54.9 bits (131), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 41/126 (32%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSST---------PSPIGTWKIT 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|296329732|ref|ZP_06872217.1| murein transglycosylase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674129|ref|YP_003865801.1| murein transglycosylase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296153230|gb|EFG94094.1| murein transglycosylase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305412373|gb|ADM37492.1| murein transglycosylase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 167

 Score = 54.9 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 47/130 (36%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L +++ N      ++K Y I         KI T   Q P G +YI   
Sbjct: 58  PYHIAVSIGAKTLTLYQNN-----QVIKTYPIAVG------KILT---QTPIGEFYIINR 103

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+NK + E
Sbjct: 104 QRNPGGPF-GAYWLS------LSRQHYG----IHGTNNPSSIGKAVSKGCVRMHNKDVIE 152

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 153 LASIVPNGTR 162


>gi|158321448|ref|YP_001513955.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus oremlandii OhILAs]
 gi|158141647|gb|ABW19959.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus oremlandii OhILAs]
          Length = 254

 Score = 54.9 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 39/130 (30%), Gaps = 32/130 (24%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
             +    + I  +E  L +   N      L+K Y +              D   P G + 
Sbjct: 59  PEYEDIRVLIDISEKRLYLMNGND-----LVKIYPVATGKL---------DTPTPIGTWK 104

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNK 158
           +              + +  P          G    IHG           SAGC  MNN 
Sbjct: 105 VVHKAKWGGGFGTRWMGLNVP------WGTYG----IHGTNKPNSIGSNASAGCVRMNNT 154

Query: 159 QMQEIYAIVR 168
            ++++Y  V+
Sbjct: 155 DVEDLYKYVK 164


>gi|291514044|emb|CBK63254.1| Uncharacterized protein conserved in bacteria [Alistipes shahii WAL
           8301]
          Length = 152

 Score = 54.9 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 37/109 (33%), Gaps = 19/109 (17%)

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG-----WNNLNPNSKYFLSINIGFPNEF 130
           L   Y I       G K + GD + PEG + +          +        I   + + F
Sbjct: 12  LRAVYPIACGRA-LGNKEKPGDMKTPEGLFSVQQIQDASAWTHDFGDGKGEIRGAYGSHF 70

Query: 131 DKAHNRTGA-DLMIHGEC--------ASAGCYAMNNKQMQEI---YAIV 167
            +     G   + IHG          A+ GC  +NN  + E+   Y  V
Sbjct: 71  IRLKT-PGHCGIGIHGTHDPASIGTRATEGCVRLNNSDLLELVKKYVYV 118


>gi|323140901|ref|ZP_08075814.1| ErfK/YbiS/YcfS/YnhG [Phascolarctobacterium sp. YIT 12067]
 gi|322414639|gb|EFY05445.1| ErfK/YbiS/YcfS/YnhG [Phascolarctobacterium sp. YIT 12067]
          Length = 197

 Score = 54.5 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 60/207 (28%), Gaps = 66/207 (31%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  +   L+F++ + L+    + +                            +I I K  
Sbjct: 1   MLKKLLGLIFSVCLLLSCSLAAAAPASALFG-----------------NARYLICIHKQS 43

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L+++++        +  Y I       G K  TGD + P       W +      Y+ 
Sbjct: 44  YRLDVYQQ---GVEQAVCSYPIAVAKNP-GDKQYTGDNRTPT-----SWGSAAAIPSYYT 94

Query: 121 SINIGFPNE----------------FDKAHNR---------------TGA-DLMIHGEC- 147
              +G P+                  D +  +               TG   + IHG   
Sbjct: 95  GAAVGVPSAQVPFRIEEICPAHYWTHDFSDGKGVIEGAYGPWFLSLDTGWIGIGIHGTHD 154

Query: 148 -------ASAGCYAMNNKQMQEIYAIV 167
                  AS GC  + N  +Q +  +V
Sbjct: 155 PASIGTMASEGCIRLRNADIQSLKELV 181


>gi|296133608|ref|YP_003640855.1| ErfK/YbiS/YcfS/YnhG family protein [Thermincola sp. JR]
 gi|296032186|gb|ADG82954.1| ErfK/YbiS/YcfS/YnhG family protein [Thermincola potens JR]
          Length = 318

 Score = 54.5 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 46/151 (30%), Gaps = 41/151 (27%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P     + +      L ++  +      + K Y++                  P G + I
Sbjct: 128 PKGEVRLEVHIKTRTLIVYDDD-----KVFKTYRVAVGKNKT---------PTPVGEWRI 173

Query: 108 GWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNK 158
                N  + +    + +  P          G    IHG           S GC  M N+
Sbjct: 174 VRKAKNWGTGFGTRWLGLSVP------WGLFG----IHGTNKPWSIGSKASHGCIRMFNR 223

Query: 159 QMQEIYAIVRDSLRGNMQSHIQI--QAFPFR 187
            ++E+Y  V+        + + +  Q FP R
Sbjct: 224 DVEELYEWVKLG------TRVTVIGQVFPVR 248


>gi|312876406|ref|ZP_07736390.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796764|gb|EFR13109.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 190

 Score = 54.5 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 56/171 (32%), Gaps = 41/171 (23%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           +P +I +  +++ L ++K  +     L K Y I        P         P G + I  
Sbjct: 32  NPYLIYVSIDDSRLYVFKEGI-----LYKSYPISPGK-PSTP--------TPVGTFKIIS 77

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQ 161
            +          + +         + + G    IHG           S GC  M NK ++
Sbjct: 78  KDYWGEGFGGRWMGLN------VRYGKYG----IHGTIYESYIGAHVSKGCVRMLNKDVK 127

Query: 162 EIYAI--------VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           E+++         V + L G  ++  +   +P       M + +      F
Sbjct: 128 ELFSYIPIGTTVIVSEGLYGEFRNGFRT-IYPGDTGEDVMAVQRRLQELGF 177


>gi|332982349|ref|YP_004463790.1| ErfK/YbiS/YcfS/YnhG family protein [Mahella australiensis 50-1 BON]
 gi|332700027|gb|AEE96968.1| ErfK/YbiS/YcfS/YnhG family protein [Mahella australiensis 50-1 BON]
          Length = 266

 Score = 54.5 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 48/133 (36%), Gaps = 37/133 (27%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP--EGF 104
            P     I I   +N+L + K N      ++K+Y +             G  + P   G 
Sbjct: 71  PPGDGQQIFIDLEDNVLYLLKDN-----KVMKKYPVA-----------EGKYKTPSPIGA 114

Query: 105 YYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAM 155
           + I     +  S +    + +  P          G    IHG          +S GC+ M
Sbjct: 115 WQIVSKRTDWGSGFGTRWLGLNVP------WGVYG----IHGTNKPDSVGWSSSHGCFRM 164

Query: 156 NNKQMQEIYAIVR 168
            NK ++E++ +V+
Sbjct: 165 QNKHVEELFDLVK 177


>gi|260593415|ref|ZP_05858873.1| ErfK/YbiS/YcfS/YnhG family protein [Prevotella veroralis F0319]
 gi|260534691|gb|EEX17308.1| ErfK/YbiS/YcfS/YnhG family protein [Prevotella veroralis F0319]
          Length = 253

 Score = 54.1 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 70/199 (35%), Gaps = 41/199 (20%)

Query: 4   RYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPT----------- 52
           R   +LF++   L+        +  +   + E  ++    K T                 
Sbjct: 5   RKIFILFSVAFCLS---IEAQTLPYSPDNICEKQVVVHGLKTTRAPADISISLGAENKNN 61

Query: 53  -VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP-----EGFYY 106
             I I K +  L ++++ +D   VL+  Y  C ++   G K   GD + P        + 
Sbjct: 62  CFIVISKKDYYLYVYEKRLDDT-VLVARYDAC-FAVNRGNKTRIGDMRTPHCTPSIPSFS 119

Query: 107 IG-----WNNLNPNSKYFLSINIGFPNEFDKAHNRTGA-DLMIHGECA---------SAG 151
           I       +  +       +I + +   F + +  TG   + IHG            S G
Sbjct: 120 ISQICNAASWKHDFRDGRGNI-LAYGPYFLRLNIGTGNRSIGIHGSTNNRESVPGLASEG 178

Query: 152 CYAMNNKQMQEI---YAIV 167
           C  + ++ ++++   YA V
Sbjct: 179 CIRLKDEDVRDLRNRYAFV 197


>gi|158334425|ref|YP_001515597.1| hypothetical protein AM1_1246 [Acaryochloris marina MBIC11017]
 gi|158304666|gb|ABW26283.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 180

 Score = 54.1 bits (129), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 57/179 (31%), Gaps = 33/179 (18%)

Query: 6   NILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEI 65
            I L  +   L      R++ + A  P     + ++         P  + +  ++  + +
Sbjct: 8   LIALSVVAGALALGQPVRAVEEIAIAPPLPG-LDNVTDHLPPAVDPMRLELNLSKRRVTV 66

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN----SKYFLS 121
           ++ +       +K Y +                  P G + +     NP      K ++ 
Sbjct: 67  YQHDQA-----VKSYPVAIGRAG---------WATPAGDFEVKTKYRNPPWLHPFKGYV- 111

Query: 122 INIGFP-NEFDKAH----NRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIV 167
           I  G P N   +            +  HG           S GC  M ++ ++E+Y +V
Sbjct: 112 IPGGDPENPLGRRWMGFWTDGNNWIGFHGTPNRDSVGRSASHGCVRMYDEDIEEMYELV 170


>gi|297197389|ref|ZP_06914786.1| lipoprotein [Streptomyces sviceus ATCC 29083]
 gi|297146702|gb|EFH28291.1| lipoprotein [Streptomyces sviceus ATCC 29083]
          Length = 247

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 65/226 (28%), Gaps = 65/226 (28%)

Query: 1   MTNRYNILLFALFIFLNGCHH---------SRSLIDKAEHPLSENLIISMQKKRTSPFHP 51
           +T R ++ L A  +FL+GC                + +  P S  + + +  ++     P
Sbjct: 2   ITRRTHVALLAASLFLSGCGGGAVASTESAPPPSREPSRTPASPEISVEVAPQQIPGLGP 61

Query: 52  -----------TVIRIFKNEN-----ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIET 95
                        + +           + +++R     +     +        +      
Sbjct: 62  RTRAKIPADARQAVVVTGRGRDSPVSTVVLYERTAAG-WRAGASWPAHNALKGWSDHHLA 120

Query: 96  GDEQAPEGFYYI--------GWNNLNPNSKYFLS-------------------INIGF-- 126
           GD ++P G Y +              P  +                       I I +  
Sbjct: 121 GDLRSPIGVYTLTDAGGLLKDPGTKLPYDRGVGFTSPGTGFEGEPLAGSFDYVIAINYNR 180

Query: 127 -----PNEFDKAHNRT-GADLMI---HGECASAGCYAMNNKQMQEI 163
                P ++ +      G  + +   HG   + GC ++  K M+E+
Sbjct: 181 QPGTSPLDWTRPLGAGRGGGIWLHVDHGGP-THGCVSIAEKHMKEL 225


>gi|227872445|ref|ZP_03990787.1| LamB/YcsF family protein [Oribacterium sinus F0268]
 gi|227841705|gb|EEJ51993.1| LamB/YcsF family protein [Oribacterium sinus F0268]
          Length = 253

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 64/227 (28%), Gaps = 68/227 (29%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV-IRIFKNE--- 60
             + LF L +          L  K    L      S                + K E   
Sbjct: 21  LILSLFCLSMIFTAFAGPGELYQK---KLESQTSTSNNDTEIRIGKKLFQTEVGKKEDQL 77

Query: 61  -----NILEIWKRNVDAEYVLLKEYKICAWSGTFGPK----IETGDEQAPEGFYYIG--- 108
                + L +W +  D  Y+  K Y      G  G K     + GD   P G Y I    
Sbjct: 78  LVMLDHELSLWNKGEDRYYLQWKTYS---GYGRNGLKEGTERKEGDGTTPLGAYPISFAF 134

Query: 109 -----------WNNLNPNSK-----------------------------YFLSINIGFPN 128
                      +  +   S                              Y  ++ IGF N
Sbjct: 135 GFPSSVNTKLPYKQIQKTSYWSGEKNTYNTWVESPTKIAGERLYSYKICYEKALAIGF-N 193

Query: 129 EFDKAHNRTGADLMIH----GECASAGCYAMNNKQMQEIYAIVRDSL 171
           +      R G+ + +H        S+GC  +  + M+++  ++++ L
Sbjct: 194 QNPVVFGR-GSAIFLHIKAPDTWESSGCITIEKQAMEDLLPLLKEKL 239


>gi|325981386|ref|YP_004293788.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosomonas sp. AL212]
 gi|325530905|gb|ADZ25626.1| ErfK/YbiS/YcfS/YnhG family protein [Nitrosomonas sp. AL212]
          Length = 178

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 37/106 (34%), Gaps = 41/106 (38%)

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPN-----------EFD----------KAHN 135
           D++ P G + +GW  +N  S+Y+    + +PN             D          K+  
Sbjct: 62  DDKTPLGRFKVGW--VNEKSRYYRFFGLDYPNLDTAKRALEENRIDEETWLSIKQAKSRG 119

Query: 136 RTGADLMI------------------HGECASAGCYAMNNKQMQEI 163
           +T     +                  H    + GC A+ N+Q+ ++
Sbjct: 120 KTPPQDTLLGGHIGIHGIGRGDQEIHHKYNWTNGCVALTNEQIDQL 165


>gi|28210382|ref|NP_781326.1| hypothetical protein CTC00656 [Clostridium tetani E88]
 gi|28202819|gb|AAO35263.1| conserved protein (peptidoglycan binding) [Clostridium tetani E88]
          Length = 232

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 54/176 (30%), Gaps = 43/176 (24%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     I+   LF+ L  C            P         +K          I +  +E
Sbjct: 1   MKRHNRIISTLLFLVLLIC------------PKVAKASDLNRKSIQKNKEGYNILVDISE 48

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF- 119
             + + ++  +     ++ Y I        P        +P G + I   + N  S +  
Sbjct: 49  FKMYLIEKGSN---KPIRRYPIAGGK-PETP--------SPYGTWKITSKSANWGSGFGT 96

Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQEIYAIV 167
             + +  P        + G    IHG           S GC  M NK ++E+Y  V
Sbjct: 97  RWMGLNVP------WGQYG----IHGTNKPLSINNPDSKGCIRMFNKDVEELYKYV 142


>gi|320162414|ref|YP_004175639.1| hypothetical protein ANT_30130 [Anaerolinea thermophila UNI-1]
 gi|319996268|dbj|BAJ65039.1| hypothetical protein ANT_30130 [Anaerolinea thermophila UNI-1]
          Length = 358

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 40/129 (31%), Gaps = 33/129 (25%)

Query: 59  NENILEIWKRNVDAEYVLLKEY----KICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
               +E+W ++      L+  Y     +       G K   GD   P+G Y       + 
Sbjct: 218 EAKRIEVWLKD-----QLVIAYENDEPVLITRAATGGKFIDGDYSTPQGRYLTNRKRPSR 272

Query: 115 NSKYFLSINIGFPNEFDKAHNRTG---------ADLMIHGECA--------SAGCYAMNN 157
           +     S ++  PN +D      G         + +  HG           S GC  ++ 
Sbjct: 273 HMA---SGDLAAPNSYDL----PGVPWVCYLTESGISFHGTYWHNDFGKPRSHGCINLSP 325

Query: 158 KQMQEIYAI 166
              + IY  
Sbjct: 326 AAARWIYRW 334


>gi|134299346|ref|YP_001112842.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum reducens MI-1]
 gi|134052046|gb|ABO50017.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum reducens MI-1]
          Length = 255

 Score = 53.8 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 41/125 (32%), Gaps = 33/125 (26%)

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL------NPNS 116
           L ++ +       L+K Y +         K+       PEG + I             N 
Sbjct: 137 LYLYDQGY-----LVKIYPVATGK----EKLF-----TPEGSFKIANKLPIKNADDPENL 182

Query: 117 KYFLSINIGFPNEFDKA-----HNRTGADLMIHGEC--------ASAGCYAMNNKQMQEI 163
                + +  P+E DK          G    IHG          AS GC  +NN  + E+
Sbjct: 183 YGPRWMGLAVPDEKDKRANNDKRAPVGHKYGIHGTNEPNSIGTHASGGCIRLNNHDILEL 242

Query: 164 YAIVR 168
           Y +V 
Sbjct: 243 YDMVP 247


>gi|220933023|ref|YP_002509931.1| ErfK/YbiS/YcfS/YnhG family protein [Halothermothrix orenii H 168]
 gi|219994333|gb|ACL70936.1| ErfK/YbiS/YcfS/YnhG family protein [Halothermothrix orenii H 168]
          Length = 263

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 42/139 (30%), Gaps = 33/139 (23%)

Query: 39  ISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDE 98
             + +          I I   +  L ++K          K Y +     T          
Sbjct: 63  SVLAEIEIPEGEKYYIIINTYQRTLTLYKDG-----KPYKRYPVAIGKPTT--------- 108

Query: 99  QAPEGFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------S 149
           ++P G + I   + +    +    + +  P          G    IHG           S
Sbjct: 109 RSPVGEWAIIGKSKDWGGGFGTRWLGLNVP------WGIYG----IHGTNKPGSIGRAAS 158

Query: 150 AGCYAMNNKQMQEIYAIVR 168
            GC  M N+ ++E+Y IV 
Sbjct: 159 HGCIRMFNRDVEELYDIVP 177


>gi|303239377|ref|ZP_07325905.1| ErfK/YbiS/YcfS/YnhG family protein [Acetivibrio cellulolyticus CD2]
 gi|302593163|gb|EFL62883.1| ErfK/YbiS/YcfS/YnhG family protein [Acetivibrio cellulolyticus CD2]
          Length = 235

 Score = 53.4 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 43/127 (33%), Gaps = 32/127 (25%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
              +I I+ +E  L +++         +K+Y I +               +P G + I  
Sbjct: 44  PQYLIVIYIDEKKLYLFENE-----ECIKKYPIASGMPG---------WPSPIGSWKIVT 89

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQ 161
            +          + +           R G    IHG          AS GC  M NK ++
Sbjct: 90  KDDWGEGFGGRWLGLN------VKWGRYG----IHGTSEEYTIGSAASHGCIRMFNKDIK 139

Query: 162 EIYAIVR 168
           E+Y IV 
Sbjct: 140 ELYNIVP 146


>gi|187776901|ref|ZP_02993374.1| hypothetical protein CLOSPO_00440 [Clostridium sporogenes ATCC
           15579]
 gi|187775560|gb|EDU39362.1| hypothetical protein CLOSPO_00440 [Clostridium sporogenes ATCC
           15579]
          Length = 231

 Score = 53.4 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/137 (18%), Positives = 43/137 (31%), Gaps = 33/137 (24%)

Query: 38  IISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGD 97
              M+           I I    N +++++        ++K Y I     +         
Sbjct: 29  QQKMETNPMD-NSNICILIDITANNMDVYRNG-----EVIKSYSIATGKSST-------- 74

Query: 98  EQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CAS 149
             +P G + I       +S     + +  P        + G    IHG          +S
Sbjct: 75  -PSPIGTWKIINKGTWGSSFGGRWMGLNVP------WGKYG----IHGTDAPHSIGWNSS 123

Query: 150 AGCYAMNNKQMQEIYAI 166
            GC  M NK + E+Y I
Sbjct: 124 HGCIRMKNKNVAELYKI 140


>gi|150392091|ref|YP_001322140.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus metalliredigens
           QYMF]
 gi|149951953|gb|ABR50481.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus metalliredigens
           QYMF]
          Length = 253

 Score = 53.4 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 61/185 (32%), Gaps = 42/185 (22%)

Query: 4   RYNILLFAL-FIFLNGCHHSRSLIDKAEHPLSENLII-----SMQKKRTSPFHPTV---- 53
           R  +L FA+  I   G  + ++       P     +       + + +    +P      
Sbjct: 5   RRLLLFFAIILIGTAGVLYIKNGSLFGGIPTPGGDVRGYNEYILWEHQMLEENPNYENVK 64

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I +  +   L +   N      LLK Y I +      P        +P G + +      
Sbjct: 65  ILVDISVKKLYLLNGN-----ELLKTYTIASGK-PSTP--------SPLGSWEVIQKARW 110

Query: 114 PNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYA 165
             +     + I  P        + G    IHG           SAGC  MNN+ ++++Y 
Sbjct: 111 GGAFGTRWMGINVP------WGKYG----IHGTDKPNSIGYNASAGCIRMNNRDVEDLYQ 160

Query: 166 IVRDS 170
            V++ 
Sbjct: 161 YVKNG 165


>gi|311067920|ref|YP_003972843.1| murein transglycosylase [Bacillus atrophaeus 1942]
 gi|310868437|gb|ADP31912.1| murein transglycosylase [Bacillus atrophaeus 1942]
          Length = 168

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 46/130 (35%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +  +   L +++ N      L+K Y I         KI T     P G YYI   
Sbjct: 59  PYHIVVSISGKTLRLFQNN-----RLIKTYPIAVG------KILT---TTPTGEYYIVNR 104

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +          ++    +  HG           S GC  M NK + E
Sbjct: 105 QPNPGGPF-GAYWMS--------LSKLHYGI--HGTNNPSSIGKAVSKGCIRMYNKDVVE 153

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 154 LASIVPNGTR 163


>gi|281357530|ref|ZP_06244018.1| ErfK/YbiS/YcfS/YnhG family protein [Victivallis vadensis ATCC
           BAA-548]
 gi|281316133|gb|EFB00159.1| ErfK/YbiS/YcfS/YnhG family protein [Victivallis vadensis ATCC
           BAA-548]
          Length = 422

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 60/163 (36%), Gaps = 26/163 (15%)

Query: 23  RSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKI 82
            ++   +  PL+ N++   ++    P  P  I++ K+  +L+++         L   + I
Sbjct: 260 DAIKISSRMPLANNILPLGKRLVIYPG-PWKIKVEKSARLLKLYNEFPAGG-RLYAVFDI 317

Query: 83  CAWSGTFGP--------KIETGDEQAPEGFYYIGWNNLNPNSKYFLSI-NIGFPNEFDKA 133
                   P        K++  D   PEG      +  N    YFL +   G P   DK 
Sbjct: 318 GIGRLGRTPSADFVISTKLKNPDWYTPEGRVIKYGDPENMLGDYFLKLAPTGTP---DKP 374

Query: 134 HNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVR 168
               G  +  HG           S GC  M+N  ++ +Y IV 
Sbjct: 375 L--LGYGI--HGTRDDASVTKSQSNGCIRMHNADVETLYRIVP 413


>gi|170755984|ref|YP_001782818.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum B1 str.
           Okra]
 gi|169121196|gb|ACA45032.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum B1 str.
           Okra]
          Length = 231

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 41/126 (32%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSST---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|153938990|ref|YP_001392530.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum F str.
           Langeland]
 gi|152934886|gb|ABS40384.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum F str.
           Langeland]
 gi|295320516|gb|ADG00894.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum F str.
           230613]
          Length = 231

 Score = 53.0 bits (126), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 41/126 (32%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSST---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|168179172|ref|ZP_02613836.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum NCTC
           2916]
 gi|226950607|ref|YP_002805698.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A2 str.
           Kyoto]
 gi|182669937|gb|EDT81913.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum NCTC
           2916]
 gi|226843014|gb|ACO85680.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 231

 Score = 53.0 bits (126), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 41/126 (32%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSST---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|28275296|ref|NP_783551.1| hypothetical protein SO_4656.3 [Shewanella oneidensis MR-1]
          Length = 67

 Score = 53.0 bits (126), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 14/45 (31%)

Query: 137 TGADLMIHGE--------------CASAGCYAMNNKQMQEIYAIV 167
            G  +MIHG+                + GC A+ N +M EI+  V
Sbjct: 13  PGGLIMIHGQHNGLGWLSFASQFFNWTNGCIAVTNSEMDEIWQAV 57


>gi|154685816|ref|YP_001420977.1| YkuD [Bacillus amyloliquefaciens FZB42]
 gi|154351667|gb|ABS73746.1| YkuD [Bacillus amyloliquefaciens FZB42]
          Length = 166

 Score = 53.0 bits (126), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 44/130 (33%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I ++     LE+++        L++ Y I         KI T     P G +YI   
Sbjct: 57  PYSIIVYIGAKKLELYRLG-----RLIRTYPIAVG------KILT---TTPTGEFYIVNR 102

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
              P   +  +  +        +    G    IHG           S GC  M N+ + E
Sbjct: 103 QPKPGGPF-GAYWLS------LSKIHYG----IHGTNNPSSIGKAVSKGCIRMYNQDVTE 151

Query: 163 IYAIVRDSLR 172
           + A V +  R
Sbjct: 152 LAATVPNGTR 161


>gi|323357749|ref|YP_004224145.1| hypothetical protein MTES_1301 [Microbacterium testaceum StLB037]
 gi|323274120|dbj|BAJ74265.1| uncharacterized protein conserved in bacteria [Microbacterium
           testaceum StLB037]
          Length = 252

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 31/101 (30%), Gaps = 22/101 (21%)

Query: 77  LKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN-SKYFLSINIGFPNEFDKAHN 135
           +K Y I   +G             P G +++       N      +  +      D   +
Sbjct: 152 VKTYPIATGTGGT---------PTPHGSFFLTELIEPTNAGYGPYAFGLS--AFSDVLTS 200

Query: 136 RTGAD--LMIHGEC--------ASAGCYAMNNKQMQEIYAI 166
             G    + +HG           S GC  M+N  + E+  +
Sbjct: 201 FGGGPGQIGLHGTDDESTIGQSVSHGCIRMSNADITELARL 241


>gi|187736183|ref|YP_001878295.1| ErfK/YbiS/YcfS/YnhG family protein [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187426235|gb|ACD05514.1| ErfK/YbiS/YcfS/YnhG family protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 156

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 50/158 (31%), Gaps = 43/158 (27%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           IRI      L + K        +L +  + +     G   E G  + P G + I     +
Sbjct: 6   IRINLPRQELVLEKSG-----KILLQCPVSSGKAGTGH--EEGSGKTPTGHFRICKKIGD 58

Query: 114 ------------PNSKYFLSINIGFPNEFD---------------KAHNRTGADLMIHGE 146
                       P  +Y  +I        D                A+ R+   + IHG 
Sbjct: 59  GEPEDTIFISRLPAGRYPTAIPKSLNEHSDFILTRILWLDGLEPHNANTRS-RYIYIHGT 117

Query: 147 --------CASAGCYAMNNKQMQEIYAIVRDSLRGNMQ 176
                    AS GC  ++ + M  ++A+  + +   +Q
Sbjct: 118 NDTELLGTPASHGCIRLSPRDMMALFALAEEGMDVFIQ 155


>gi|170760335|ref|YP_001788499.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169407324|gb|ACA55735.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 231

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 40/126 (31%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I                 +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSAT---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|326202068|ref|ZP_08191938.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium papyrosolvens DSM
           2782]
 gi|325987863|gb|EGD48689.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium papyrosolvens DSM
           2782]
          Length = 236

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 45/140 (32%), Gaps = 32/140 (22%)

Query: 37  LIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETG 96
           +  S  +   +     +I I  +E  L +++ +       +K+Y I +            
Sbjct: 32  IKGSFTRHAANKQQQFLILIHIDEKTLYLFEND-----KCIKKYPIASGKPG-------- 78

Query: 97  DEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA-------- 148
              +P G + I   +          + +             G    IHG           
Sbjct: 79  -WPSPIGEWKIVEKSQWGKGFGGRWLGLN------VRWGNYG----IHGTKNEASIGRSA 127

Query: 149 SAGCYAMNNKQMQEIYAIVR 168
           S GC  M N+ ++E+Y +V 
Sbjct: 128 SHGCIRMYNRDIKELYDLVP 147


>gi|308173372|ref|YP_003920077.1| L,D-transpeptidase [Bacillus amyloliquefaciens DSM 7]
 gi|307606236|emb|CBI42607.1| L,D-transpeptidase [Bacillus amyloliquefaciens DSM 7]
 gi|328553699|gb|AEB24191.1| L,D-transpeptidase [Bacillus amyloliquefaciens TA208]
          Length = 166

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 45/130 (34%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I ++     L++++        L++ Y I         KI T     P G +YI   
Sbjct: 57  PYSIVVYIGAKKLQLYRLG-----RLIRTYPIAVG------KILT---TTPTGEFYIVNR 102

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
              P   +  +  +          ++    +  HG           S GC  M+N+ + E
Sbjct: 103 QPKPGGPF-GAYWLS--------LSKLHYGI--HGTNDPSSIGKAVSKGCIRMHNQDVTE 151

Query: 163 IYAIVRDSLR 172
           + A V +  +
Sbjct: 152 LAATVPNGTK 161


>gi|153954823|ref|YP_001395588.1| hypothetical protein CKL_2205 [Clostridium kluyveri DSM 555]
 gi|146347681|gb|EDK34217.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 126

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 39/130 (30%), Gaps = 33/130 (25%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
           SP     I I +    L ++K        + K Y +                  P G + 
Sbjct: 14  SPNVTYSITINRAARRLTLYKNG-----KVYKTYPVAVGKSGT---------PTPAGTFR 59

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNK 158
           I    +NP   Y             +    +   + IHG           S GC  M NK
Sbjct: 60  IINKQINPGGPYGA-----------RWMGLSAKGIGIHGTNNPHSIGSYVSNGCIRMYNK 108

Query: 159 QMQEIYAIVR 168
            + E++ IV 
Sbjct: 109 DVIELFNIVP 118


>gi|295394274|ref|ZP_06804504.1| possible secreted protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972858|gb|EFG48703.1| possible secreted protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 342

 Score = 52.6 bits (125), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 56/187 (29%), Gaps = 61/187 (32%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFK------NENILEIWKRNVDAEYVLLKEYKICA-- 84
           ++  ++         P     I I            +E+W+   D  +     +K     
Sbjct: 132 ITTGVLAYGLPHGIKPKGGRQIVIAHTSARSSKTGTVELWELRNDERWHRTHTFKDARFG 191

Query: 85  --WSGTFGPKIETGDEQAPEGFY---------------YIGWNNLNPNSKY---FLSIN- 123
                T   K   GD + P G Y                I +   + N ++     S++ 
Sbjct: 192 YKGLATASDK-REGDGKTPMGQYRIPFTFGTKAKPKGTRIEYRRADHNDQWCSRSGSLHY 250

Query: 124 ---IGFPN----EFD---------------------KAHNRTGADLMI--HGECASAGCY 153
              +  PN      D                     +   R G+ + +  HG+ ++AGC 
Sbjct: 251 NTWMSVPNRSCPAKDAEVFSTIPQYSHVAVVDYNSARKAGR-GSAIFVHKHGKGSTAGCV 309

Query: 154 AMNNKQM 160
           ++  KQM
Sbjct: 310 SVTGKQM 316


>gi|168183495|ref|ZP_02618159.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum Bf]
 gi|237796634|ref|YP_002864186.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum Ba4 str.
           657]
 gi|182673343|gb|EDT85304.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum Bf]
 gi|229263482|gb|ACQ54515.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium botulinum Ba4 str.
           657]
          Length = 231

 Score = 52.6 bits (125), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 41/126 (32%), Gaps = 32/126 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIVKSYSIATGKSST---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYAI 166
            E+Y I
Sbjct: 135 AELYKI 140


>gi|219855282|ref|YP_002472404.1| hypothetical protein CKR_1939 [Clostridium kluyveri NBRC 12016]
 gi|219569006|dbj|BAH06990.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 130

 Score = 52.6 bits (125), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 39/130 (30%), Gaps = 33/130 (25%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
           SP     I I +    L ++K        + K Y +                  P G + 
Sbjct: 18  SPNVTYSITINRAARRLTLYKNG-----KVYKTYPVAVGKSGT---------PTPAGTFR 63

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNK 158
           I    +NP   Y             +    +   + IHG           S GC  M NK
Sbjct: 64  IINKQINPGGPYGA-----------RWMGLSAKGIGIHGTNNPHSIGSYVSNGCIRMYNK 112

Query: 159 QMQEIYAIVR 168
            + E++ IV 
Sbjct: 113 DVIELFNIVP 122


>gi|322807493|emb|CBZ05068.1| protein erfK/srfK precursor [Clostridium botulinum H04402 065]
          Length = 231

 Score = 52.2 bits (124), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 40/125 (32%), Gaps = 32/125 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I    N +++++        ++K Y I     +           +P G + I 
Sbjct: 39  NSNICILIDITANNMDVYRNG-----EIIKSYSIATGKSST---------PSPIGTWKII 84

Query: 109 WNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQM 160
                 +S     + +  P        + G    IHG          +S GC  M NK +
Sbjct: 85  NKGTWGSSFGGRWMGLNVP------WGKYG----IHGTNAPNSIGWSSSHGCIRMKNKNV 134

Query: 161 QEIYA 165
            E+Y 
Sbjct: 135 AELYK 139


>gi|321315163|ref|YP_004207450.1| murein transglycosylase [Bacillus subtilis BSn5]
 gi|291483940|dbj|BAI85015.1| hypothetical protein BSNT_02352 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320021437|gb|ADV96423.1| murein transglycosylase [Bacillus subtilis BSn5]
          Length = 167

 Score = 52.2 bits (124), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 46/130 (35%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L ++  N      ++K Y I         KI T   Q P G +YI   
Sbjct: 58  PYHIAVSIGAKTLTLFLNN-----RVMKTYPIAVG------KILT---QTPTGEFYIINR 103

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+NK + E
Sbjct: 104 QRNPGGPF-GAYWLS------LSKQHYG----IHGTNNPASIGKAVSKGCIRMHNKDVIE 152

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 153 LASIVPNGTR 162


>gi|312792945|ref|YP_004025868.1| erfk/ybis/ycfs/ynhg family protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180085|gb|ADQ40255.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 223

 Score = 51.5 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 56/171 (32%), Gaps = 41/171 (23%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           +P +I +  +++ L ++K  +     L K Y I        P         P G + I  
Sbjct: 32  NPYLIYVSIDDSRLYVFKEGI-----LYKSYPISPGK-PSTP--------TPVGTFKIIS 77

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQ 161
            +          + +         + + G    IHG           S GC  M NK ++
Sbjct: 78  KDYWGEGFGGRWMGLN------VRYGKYG----IHGTIYESYIGAHVSKGCVRMLNKDVK 127

Query: 162 EIYAI--------VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           E+++         V + + G  ++  +   +P       M + +      F
Sbjct: 128 ELFSYIPIGTTVIVSEGIYGEFRNGFRT-IYPGDTGEDVMAVQRRLKELGF 177


>gi|312621812|ref|YP_004023425.1| erfk/ybis/ycfs/ynhg family protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202279|gb|ADQ45606.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 223

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 60/185 (32%), Gaps = 41/185 (22%)

Query: 36  NLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIET 95
             ++++        +P +I +  +++ L ++K  +     L K Y I     +       
Sbjct: 18  TSLVTISSISNYNKNPYLIYVSIDDSKLYVFKEGI-----LYKSYPISPGKTST------ 66

Query: 96  GDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------C 147
                P G + I   +          + +  P      + + G    IHG          
Sbjct: 67  ---PTPVGTFKIISKDYWGEGFGGRWMGLNVP------YGKYG----IHGTIYESYIGAH 113

Query: 148 ASAGCYAMNNKQMQEIYAIVR--------DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNN 199
            S GC  M NK ++E++  +         + + G  ++  +   +P       M + +  
Sbjct: 114 VSKGCIRMLNKDVKELFLYIPIGTTVVISEGIYGEFRNGFRT-IYPGDTGVDVMAVQRRL 172

Query: 200 PNYSF 204
               F
Sbjct: 173 KELGF 177


>gi|147676430|ref|YP_001210645.1| hypothetical protein PTH_0095 [Pelotomaculum thermopropionicum SI]
 gi|146272527|dbj|BAF58276.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 185

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 43/136 (31%), Gaps = 35/136 (25%)

Query: 42  QKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAP 101
           + +  +     +I +      L  ++ +      L+  Y +        P         P
Sbjct: 3   ENRGRTYGSHILINL--ATRQLSYFEGS-----RLMNTYPVGVGK-PSTP--------TP 46

Query: 102 EGFYYIGWNNLNPNS-KYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGC 152
            G Y I    +NP        + +  P        R G    IHG           S GC
Sbjct: 47  TGKYSIIEKIMNPGGVLGTRWMGLSIP------GGRYG----IHGTNNPSSIGGYVSNGC 96

Query: 153 YAMNNKQMQEIYAIVR 168
             M N+ ++E++A V 
Sbjct: 97  IRMFNEDVEELFAKVE 112


>gi|222529956|ref|YP_002573838.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456803|gb|ACM61065.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor bescii DSM
           6725]
          Length = 223

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 52/152 (34%), Gaps = 41/152 (26%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           +P +I +  +++ L ++K  +     L K Y +        P         P G + I  
Sbjct: 32  NPYLIYVSIDDSRLYVFKNGI-----LYKSYPVSPGK-PSTP--------TPIGTFKIVS 77

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQ 161
            +          + +  P      + + G    IHG           S GC  M NK ++
Sbjct: 78  KDYWGEGFGGRWMGLNVP------YGKYG----IHGTIYESYIGAHVSKGCIRMLNKDVK 127

Query: 162 EIYAIVR--------DSLRGNMQSHIQIQAFP 185
           E++  +         + + G  ++  +   +P
Sbjct: 128 ELFLYIPIGTTVVISEGIYGEFRNGFRT-IYP 158


>gi|146297696|ref|YP_001181467.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145411272|gb|ABP68276.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 234

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 54/171 (31%), Gaps = 41/171 (23%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           +P +I +  +++ L ++K  +     L K Y I        P         P G + I  
Sbjct: 43  NPYLIFVSIDDSKLYVFKNGI-----LYKSYPISPGK-PSTP--------TPVGTFRIIS 88

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQ 161
                +      + +         + + G    IHG           S GC  M N  ++
Sbjct: 89  KAYWGDGFGGRWMGLN------VRYGKYG----IHGTIYENYIGAHVSQGCVRMRNDDIK 138

Query: 162 EIYAIVR--------DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           E+++ +         +   G  ++  +   FP       M + +      F
Sbjct: 139 ELFSYIPIGTTVILSEGAYGEFRNGFRT-IFPGDTGDDVMAVQRRLKELGF 188


>gi|284929484|ref|YP_003422006.1| hypothetical protein UCYN_09450 [cyanobacterium UCYN-A]
 gi|284809928|gb|ADB95625.1| uncharacterized conserved protein [cyanobacterium UCYN-A]
          Length = 181

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 60/182 (32%), Gaps = 35/182 (19%)

Query: 7   ILLFALFIFLNGCH----HSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV--IRIFKNE 60
             LFA    L   +       + I K    +   +   +     +        I I   E
Sbjct: 5   FSLFAFTFILTSQNLTLLGEDTTISKQSEIIISRIKNPISIIALTEDKAMASHISINLKE 64

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP--NSKY 118
             + +++ +      ++K YK+       G K        P+G + +     NP   + +
Sbjct: 65  RRVYVYQNS-----EVIKSYKVA-----IGKKGWE----TPKGNFAVMEMVENPQWKNPW 110

Query: 119 FLSINIGFPN-----EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYA 165
              I+   PN      +     + G  +  HG           S GC  M N+ ++E+Y 
Sbjct: 111 NGRISAAGPNSPLGERWIAFSQQDGKYVGFHGTAGEHSMGKAVSHGCVRMRNQDVKELYE 170

Query: 166 IV 167
           +V
Sbjct: 171 LV 172


>gi|114320738|ref|YP_742421.1| ErfK/YbiS/YcfS/YnhG family protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227132|gb|ABI56931.1| ErfK/YbiS/YcfS/YnhG family protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 329

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 55/191 (28%), Gaps = 48/191 (25%)

Query: 32  PLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           P     ++   +    P     + +   E  L  ++     E   ++ Y +         
Sbjct: 82  PGEGTEVVVPTRFILPPGPREGVVVNVAEMRLYYYRPVTAGERRRVETYPVSVGRM---- 137

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSKYFLSI------------NIGFPNEFDKAHNR--- 136
                D + P G   I     +P+     SI                P   D    R   
Sbjct: 138 -----DWETPVGRTEITAKAEDPSWYPPESIREYARREQGKELPRVVPPGPDNPLGRHAL 192

Query: 137 ----TGADLMIHGEC--------ASAGCYAMNNKQMQEIY---------AIVRDSLRGNM 175
                G   +IHG           ++GC  M  + ++E++          +V    +   
Sbjct: 193 RLGIPGY--LIHGTNRPWGIGMRVTSGCIRMYPEDIEELFPRLPVGTPVRLVNAPFKAGW 250

Query: 176 Q-SHIQIQAFP 185
           +   + +QA+P
Sbjct: 251 KGDTLYLQAYP 261


>gi|311896707|dbj|BAJ29115.1| hypothetical protein KSE_33050 [Kitasatospora setae KM-6054]
          Length = 304

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 48/152 (31%), Gaps = 41/152 (26%)

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG---WNNLNPN 115
           ++N + +W R  D  +   + +        +     +GD ++P G + +        +P 
Sbjct: 141 SDNTVTLWTRGDDGSWQAGQAWPAHNAYKGWTADHRSGDLRSPIGLFSLTDAGGRKADPG 200

Query: 116 SKYF--------------------LSIN----IGFPN------EFDKAH---NRTGADLM 142
           SK                       S +    I + N        D  +      G  + 
Sbjct: 201 SKLPYDENKKFVMSGRGFNNEPLAGSFDYVVAINY-NRVEGTSPLDTTYPQGAAKGGGIW 259

Query: 143 IH---GECASAGCYAMNNKQMQEIYAIVRDSL 171
           +H   G   + GC ++    M E+   +  +L
Sbjct: 260 LHLDHGGP-THGCVSLTEDHMVELIRTLDPAL 290


>gi|328911454|gb|AEB63050.1| L,D-transpeptidase [Bacillus amyloliquefaciens LL3]
          Length = 160

 Score = 51.1 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 43/126 (34%), Gaps = 33/126 (26%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I ++     L++++        L++ Y I         KI T     P G +YI   
Sbjct: 57  PYSIVVYIGAKKLQLYRLG-----RLIRTYPIAVG------KILT---TTPTGEFYIVNR 102

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
              P   +  +  +          ++    +  HG           S GC  M+N+ + E
Sbjct: 103 QPKPGGPF-GAYWLS--------LSKLHYGI--HGTNDPSSIGKAVSKGCIRMHNQDVTE 151

Query: 163 IYAIVR 168
           + A V 
Sbjct: 152 LAATVP 157


>gi|157692082|ref|YP_001486544.1| peptidoglycan binding protein [Bacillus pumilus SAFR-032]
 gi|157680840|gb|ABV61984.1| peptidoglycan binding protein [Bacillus pumilus SAFR-032]
          Length = 165

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 41/128 (32%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +  +   L ++  +      L++ Y I                  P G YYI   
Sbjct: 56  PYRISVSISSKRLVLFSGS-----ELIRSYPIATGRIL---------NMTPTGSYYIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M N+ + E
Sbjct: 102 QPNPGGPF-GAYWLS------LSKVHYG----IHGTNNPSSIGKAVSRGCIRMYNQNVIE 150

Query: 163 IYAIVRDS 170
           + +IV + 
Sbjct: 151 LASIVPNG 158


>gi|260887313|ref|ZP_05898576.1| ErfK/YbiS/YcfS/YnhG family protein [Selenomonas sputigena ATCC
           35185]
 gi|260862949|gb|EEX77449.1| ErfK/YbiS/YcfS/YnhG family protein [Selenomonas sputigena ATCC
           35185]
          Length = 429

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 52/202 (25%), Gaps = 56/202 (27%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDK--------------AEHPLSENLIIS--MQKK 44
           M  +     F      +G        +K              AE P  E +  S      
Sbjct: 20  MMFKQIAAFFVCLSMFSGVSGWAGATEKEQGSSYGAWVKDISAESPEPEKVHASEVKSAA 79

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
                 P  I I      L ++K N       ++ Y +     +            P G+
Sbjct: 80  AEKTGDPYKIIINVAARSLGVYKNN-----EKIRLYPVGLGKLST---------PTPVGY 125

Query: 105 YYIGWNNLNPN-----------SKYFLSINIGFPNEFDKAHNRTGADLMIHGEC------ 147
           + +     NP                 +  +G+   + +     G    IHG        
Sbjct: 126 FSVLTKEENPTWVDPGDSKNTIPSGEGN-PLGY--RWMQVWGNYG----IHGTNHPESIG 178

Query: 148 --ASAGCYAMNNKQMQEIYAIV 167
              S GC  M    ++E+Y   
Sbjct: 179 SYVSNGCIRMKEADVEEVYDYA 200


>gi|194014419|ref|ZP_03053036.1| peptidoglycan binding protein [Bacillus pumilus ATCC 7061]
 gi|194013445|gb|EDW23010.1| peptidoglycan binding protein [Bacillus pumilus ATCC 7061]
          Length = 166

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 41/128 (32%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +  +   L ++  +      L++ Y I                  P G YYI   
Sbjct: 57  PYRISVSISSKRLVLFSGS-----ELIRSYPIATGRIL---------NMTPTGSYYIVNR 102

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M N+ + E
Sbjct: 103 QPNPGGPF-GAYWLS------LSKVHYG----IHGTNNPSSIGKAVSRGCIRMYNQNVIE 151

Query: 163 IYAIVRDS 170
           + +IV + 
Sbjct: 152 LASIVPNG 159


>gi|134297972|ref|YP_001111468.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum reducens MI-1]
 gi|134050672|gb|ABO48643.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum reducens MI-1]
          Length = 192

 Score = 50.7 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 38/132 (28%), Gaps = 33/132 (25%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
                   + I      + ++         L K Y +     T            P G Y
Sbjct: 5   MMYRAGIELLIDPQSRQINVYIGK-----QLSKSYPVGVGKATT---------PTPAGNY 50

Query: 106 YIGWNNLNPNS-KYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMN 156
            +     +P        + +  P          G +  IHG           SAGC  M 
Sbjct: 51  QVVNKVTHPGGILGTRWLGLNIP----------GGNYGIHGTSNPSSIGKLVSAGCIRMY 100

Query: 157 NKQMQEIYAIVR 168
           N+ ++E++ ++ 
Sbjct: 101 NENVEELFPMIP 112


>gi|256004227|ref|ZP_05429210.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           2360]
 gi|255991817|gb|EEU01916.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           2360]
 gi|316939606|gb|ADU73640.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           1313]
          Length = 289

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 44/131 (33%), Gaps = 37/131 (28%)

Query: 48  PFHPTVIRIFKN--ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           P  P+ +RI  +     L +++        L+K Y +        P         P G +
Sbjct: 176 PVAPSSVRIIVSIAAKTLSLYRDG-----RLVKSYPVATGK-PTTP--------TPRGTF 221

Query: 106 YIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMN 156
            I    +NP   +    + +  P          G    IHG           S GC  M 
Sbjct: 222 TIINKQVNPGGPFGTRWMGLSQP--------HYG----IHGTNNPASIGTAASNGCIRMY 269

Query: 157 NKQMQEIYAIV 167
           N+ + E++ +V
Sbjct: 270 NEDVNELFNLV 280


>gi|281419482|ref|ZP_06250496.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum JW20]
 gi|281406888|gb|EFB37152.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum JW20]
          Length = 289

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 44/131 (33%), Gaps = 37/131 (28%)

Query: 48  PFHPTVIRIFKN--ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           P  P+ +RI  +     L +++        L+K Y +        P         P G +
Sbjct: 176 PVAPSSVRIIVSIAAKTLSLYRDG-----RLVKSYPVATGK-PTTP--------TPRGTF 221

Query: 106 YIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMN 156
            I    +NP   +    + +  P          G    IHG           S GC  M 
Sbjct: 222 TIINKQVNPGGPFGTRWMGLSQP--------HYG----IHGTNNPASIGTAASNGCIRMY 269

Query: 157 NKQMQEIYAIV 167
           N+ + E++ +V
Sbjct: 270 NEDVNELFNLV 280


>gi|125975485|ref|YP_001039395.1| ErfK/YbiS/YcfS/YnhG [Clostridium thermocellum ATCC 27405]
 gi|125715710|gb|ABN54202.1| ErfK/YbiS/YcfS/YnhG [Clostridium thermocellum ATCC 27405]
          Length = 289

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 44/131 (33%), Gaps = 37/131 (28%)

Query: 48  PFHPTVIRIFKN--ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
           P  P+ +RI  +     L +++        L+K Y +        P         P G +
Sbjct: 176 PVAPSSVRIIVSIAAKTLSLYRDG-----RLVKSYPVATGK-PTTP--------TPRGTF 221

Query: 106 YIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMN 156
            I    +NP   +    + +  P          G    IHG           S GC  M 
Sbjct: 222 TIINKQVNPGGPFGTRWMGLSQP--------HYG----IHGTNNPASIGTAASNGCIRMY 269

Query: 157 NKQMQEIYAIV 167
           N+ + E++ +V
Sbjct: 270 NEDVNELFNLV 280


>gi|205373543|ref|ZP_03226346.1| hypothetical protein Bcoam_09775 [Bacillus coahuilensis m4-4]
          Length = 164

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 46/125 (36%), Gaps = 33/125 (26%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
           SP +P  I I + ++ L ++K N      + K Y I         KI +   + P G Y 
Sbjct: 52  SPSNPFRILINRQDHTLTLYKDNT-----VYKTYPIAVG------KIAS---ETPIGNYI 97

Query: 107 IGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNK 158
           I     NP   +  ++ +        +    G    IHG           S GC  M NK
Sbjct: 98  IINKAPNPGGPF-GAMWMS------ISKEHYG----IHGTNNPSSIGKNVSLGCIRMYNK 146

Query: 159 QMQEI 163
            + E+
Sbjct: 147 DVVEL 151


>gi|300856612|ref|YP_003781596.1| hypothetical protein CLJU_c34530 [Clostridium ljungdahlii DSM
           13528]
 gi|300436727|gb|ADK16494.1| conserved protein [Clostridium ljungdahlii DSM 13528]
          Length = 220

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 52/179 (29%), Gaps = 53/179 (29%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M     ILL  LF                  P +  +     KK         I +   E
Sbjct: 1   MRKISFILLLILFF-----------------PNASIIRAKESKKNLG------ILVDVTE 37

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
            +L +  ++ +    ++++Y + +               +P G + +             
Sbjct: 38  EMLYLIDKDKN---TIIRKYPVASGKSET---------PSPIGTWKVVSMASWSGGFGTR 85

Query: 121 SINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVRDSL 171
            I +  P        + G    IHG           S GC  M N  ++++Y  V   +
Sbjct: 86  WIGLNVP------WGKFG----IHGTNKPHSIGGEASHGCIRMLNSDVEDLYNYVYYGM 134


>gi|169830630|ref|YP_001716612.1| ErfK/YbiS/YcfS/YnhG family protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637474|gb|ACA58980.1| ErfK/YbiS/YcfS/YnhG family protein [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 266

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 47/133 (35%), Gaps = 33/133 (24%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K+ N L  +      E  ++  Y +               E  PEG + +      
Sbjct: 138 IIINKSANRLYFY---QGGELAVI--YSVATGKRP---------EYTPEGTFTVVNKVSL 183

Query: 114 P-----NSKYFLS-INIGFPNEFDKAHN---RTGADLM--IHGEC--------ASAGCYA 154
           P     + ++ L  + +  P E D+      R    +   IHG          AS GC  
Sbjct: 184 PGDNDSDPRFGLRWLGLAVPCEKDRRRENDPRAPGGIKYGIHGTNEPDSIGTHASGGCVR 243

Query: 155 MNNKQMQEIYAIV 167
           + N+ + E++ +V
Sbjct: 244 LRNEDIVELFELV 256


>gi|312114874|ref|YP_004012470.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220003|gb|ADP71371.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 139

 Score = 50.3 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 39/130 (30%), Gaps = 29/130 (22%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                +RI K+  ++ ++             + +    G             P G Y   
Sbjct: 22  QADVEVRISKSRQMMYVYLDG-----EHYYSWPVSTARGG---------YNTPNGVYRPQ 67

Query: 109 W--------NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQM 160
                       N    Y +  + G+       H     D+   G   S GC  ++ +  
Sbjct: 68  RLAVFHRSSKYNNSPMPYSIFFHGGY-----AIHGS--YDIGNLGRPVSHGCIRLHPEDA 120

Query: 161 QEIYAIVRDS 170
           +E+Y +V DS
Sbjct: 121 RELYGLVSDS 130


>gi|253573319|ref|ZP_04850662.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251846847|gb|EES74852.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 486

 Score = 50.3 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 47/154 (30%), Gaps = 43/154 (27%)

Query: 34  SENLIISMQKKRTSP--FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGP 91
           +  ++         P    P  + +    + L +   N     VL++ Y +         
Sbjct: 323 APEVLAEGMAPGQRPFFAEPYEMIVDTKTHTLAVVSGN-----VLIRSYPVGLGGS---- 373

Query: 92  KIETGDEQAPEGFYYIGWNNLNPNSK-----YFLSINIGFPNEFDKAHNRTGADLMIHGE 146
                  + PEG + I    +NPN +         + +            T   +  HG 
Sbjct: 374 -------RTPEGTFVISEKVINPNGRDSGEFGSRGMQLS----------DTNYAI--HGT 414

Query: 147 CA--------SAGCYAMNNKQMQEIYAIVRDSLR 172
                     S GC  M  K ++E++ +V    R
Sbjct: 415 NEPDSIGKDESLGCIRMGKKDVEELFDLVPKGTR 448


>gi|15895682|ref|NP_349031.1| peptidoglycan-binding domain-containing protein [Clostridium
           acetobutylicum ATCC 824]
 gi|15025432|gb|AAK80371.1|AE007742_5 Uncharacterized protein, ErfK family; contains
           peptidoglycan-binding domain [Clostridium acetobutylicum
           ATCC 824]
 gi|325509832|gb|ADZ21468.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 235

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 43/140 (30%), Gaps = 32/140 (22%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
             +     +I +    N + +++ +      LLK Y I        P        +P G 
Sbjct: 39  GYNSKKKILIVVDVVSNRMCVFQDD-----KLLKTYTIAGGK-PSTP--------SPIGT 84

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMN 156
           + I   +          +    P        + G    IHG           S GC  M 
Sbjct: 85  WTIVGKDTWGEGFGGRWMGFNVP------WGKYG----IHGTIFPDSIGGNTSHGCIRMR 134

Query: 157 NKQMQEIYAIVRDSLRGNMQ 176
           N  ++E+Y I     +  +Q
Sbjct: 135 NDDVRELYKITPVGTKVIVQ 154


>gi|67921138|ref|ZP_00514657.1| ErfK/YbiS/YcfS/YnhG [Crocosphaera watsonii WH 8501]
 gi|67857255|gb|EAM52495.1| ErfK/YbiS/YcfS/YnhG [Crocosphaera watsonii WH 8501]
          Length = 191

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 55/176 (31%), Gaps = 39/176 (22%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFH----PTVIRIFKNENILEIWKRNVDAE 73
                 +  +     L     +      T+P +     T + +   E  + +++ +    
Sbjct: 28  AIASEGTTPETPPTELPVTSPVEEAAIPTAPENNQTLATHVVLNLKERRVYVYQDD---- 83

Query: 74  YVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----GWNNLNPNSKYFLSINIGFPN 128
             ++  Y++                + P+G + +          NP +    +     PN
Sbjct: 84  -QVIANYRVAIGRPG---------WETPKGNFSVIQMVEDPQWKNPWNGRVSAPG---PN 130

Query: 129 -----EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRDSL 171
                 +       G  +  HG           S GC  M N+ ++E+Y +V++ +
Sbjct: 131 SPLGERWIGFSREGGKYIGFHGTPGEHVMGQAVSHGCVRMRNRDVKELYELVQNGI 186


>gi|167465780|ref|ZP_02330869.1| hypothetical protein Plarl_24988 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 488

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 45/144 (31%), Gaps = 35/144 (24%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
              +     +      P  I + +    L +   N      +++ + +       G K  
Sbjct: 326 ATSVKPEHAEDQLFEEPLRIVVDRRAYRLAVISGNT-----IIRTFPVGLG----GEK-- 374

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM--IHGECA---- 148
                 P+G + I     NPN K               +   T +D +  IHG       
Sbjct: 375 -----TPDGEFTITEKVRNPNGKSNGEFG---------SRGMTLSDTLYAIHGTNEPDSI 420

Query: 149 ----SAGCYAMNNKQMQEIYAIVR 168
               S GC  M  + ++E++ +V 
Sbjct: 421 GQDESKGCIRMGKEDVEELFDLVP 444


>gi|322384184|ref|ZP_08057894.1| murein transglycosylase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321151076|gb|EFX44393.1| murein transglycosylase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 500

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 45/144 (31%), Gaps = 35/144 (24%)

Query: 35  ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIE 94
              +     +      P  I + +    L +   N      +++ + +       G K  
Sbjct: 338 ATSVKPEHAEDQLFEEPLRIVVDRRAYRLAVISGNT-----IIRTFPVGLG----GEK-- 386

Query: 95  TGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLM--IHGECA---- 148
                 P+G + I     NPN K               +   T +D +  IHG       
Sbjct: 387 -----TPDGEFTITEKVRNPNGKSNGEFG---------SRGMTLSDTLYAIHGTNEPDSI 432

Query: 149 ----SAGCYAMNNKQMQEIYAIVR 168
               S GC  M  + ++E++ +V 
Sbjct: 433 GQDESKGCIRMGKEDVEELFDLVP 456


>gi|294497041|ref|YP_003560741.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus megaterium QM B1551]
 gi|294346978|gb|ADE67307.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus megaterium QM B1551]
          Length = 178

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 41/133 (30%), Gaps = 42/133 (31%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           +I I K  N L  +         L K Y +                  P GF+ I     
Sbjct: 37  LIIINKKTNQLAYFHNG-----KLEKTYSVATGKTWSD---------TPVGFFKIVNKIK 82

Query: 113 N-PNSKYFLS------------INIGFPNEFDKAHNRTGADLMIHGECA--------SAG 151
           N P     ++            + +        A+  TG    IHG  +        S G
Sbjct: 83  NRPYYTGHIAGGAPNNPLGSLWLGLN-------ANGTTGDTYAIHGNNSEDSIGKYVSHG 135

Query: 152 CYAMNNKQMQEIY 164
           C  M+N  ++E++
Sbjct: 136 CVRMHNADIEELF 148


>gi|281417038|ref|ZP_06248058.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum JW20]
 gi|281408440|gb|EFB38698.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum JW20]
          Length = 230

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 65/190 (34%), Gaps = 46/190 (24%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I I  +E  L ++K       VLLK Y +        P        +PEG + I   +
Sbjct: 34  YYIYINLDELKLYLYKDG-----VLLKTYPVSGGK-PETP--------SPEGTWKIISKS 79

Query: 112 LNPNSKYFLS-INIGFPNEFDKAHNRTGADLMIHGE---------CASAGCYAMNNKQMQ 161
            +    +  S + +  P        + G    IHG           AS GC  M NK  +
Sbjct: 80  -DWGGNFGGSWMGLNVP------WGQYG----IHGTKYPWYIGRQNASHGCIRMYNKNAK 128

Query: 162 EIYAIVRDS-----------LRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKL 210
           E+Y IV               +      +       +   K +  + + P+  F + LK 
Sbjct: 129 ELYDIVPYGTIVTIVHKNRPFKELKSGDVGSDVLKVQKALKKLGYFHDWPSGKFQDNLKK 188

Query: 211 GHDYFEKNHQ 220
               F+KN++
Sbjct: 189 SVIKFQKNNK 198


>gi|148270116|ref|YP_001244576.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga petrophila RKU-1]
 gi|147735660|gb|ABQ47000.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga petrophila RKU-1]
          Length = 382

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 45/152 (29%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
             +P  I +    + L ++        VLLK Y +                  P G Y++
Sbjct: 247 RENPVTIVVNLFSSKLALYYDG-----VLLKVYPVALGRSDA----------TPPGRYWV 291

Query: 108 GWNNLNPNSKYFL----------SINIGFPNEFDKAHNRTGADLMIHGE--CA------S 149
               ++P   +F            +   +    D  +        IHG           S
Sbjct: 292 LRKEIDPALYWFGEYISPRTPLNGLGTRYLQLSDPTYA-------IHGTSKPWEIGKRIS 344

Query: 150 AGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
            GC  M N+ ++EI     D+  G     + +
Sbjct: 345 HGCIRMFNRDVEEI-----DAFAGVGTEVVVV 371


>gi|319649778|ref|ZP_08003931.1| hypothetical protein HMPREF1013_00535 [Bacillus sp. 2_A_57_CT2]
 gi|317398532|gb|EFV79217.1| hypothetical protein HMPREF1013_00535 [Bacillus sp. 2_A_57_CT2]
          Length = 165

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 42/135 (31%), Gaps = 33/135 (24%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I + + +  L +          + K Y I                Q P G + I   
Sbjct: 56  PYTIIVSRGKRSLTLLYNG-----AIQKVYPIAVGKMLT---------QTPIGEFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   Y   + +          ++ G  +  HG           S GC  M N+ + E
Sbjct: 102 EPNPGGPY-GVMWLS--------LSKAGYGI--HGTNNPSSIGQSVSQGCIRMYNQDVLE 150

Query: 163 IYAIVRDSLRGNMQS 177
           +  IV +  R  +Q 
Sbjct: 151 LSRIVPNGTRVRIQP 165


>gi|15644434|ref|NP_229486.1| hypothetical protein TM1686 [Thermotoga maritima MSB8]
 gi|4982262|gb|AAD36753.1|AE001809_5 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 395

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 45/152 (29%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
             +P  I +    + L ++        VLLK Y +                  P G Y++
Sbjct: 260 RENPVTIVVNLFSSKLALYYDG-----VLLKVYPVALGRSDA----------TPPGRYWV 304

Query: 108 GWNNLNPNSKYFL----------SINIGFPNEFDKAHNRTGADLMIHGE--CA------S 149
               ++P   +F            +   +    D  +        IHG           S
Sbjct: 305 LRKEIDPALYWFGEYISPRTPLNGLGTRYLQLSDPTYA-------IHGTSKPWEIGKRIS 357

Query: 150 AGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
            GC  M N+ ++EI     D+  G     + +
Sbjct: 358 HGCIRMFNRDVEEI-----DAFAGVGTEVVVV 384


>gi|172037339|ref|YP_001803840.1| hypothetical protein cce_2426 [Cyanothece sp. ATCC 51142]
 gi|171698793|gb|ACB51774.1| unknown [Cyanothece sp. ATCC 51142]
          Length = 198

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/174 (12%), Positives = 49/174 (28%), Gaps = 44/174 (25%)

Query: 16  LNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYV 75
           L         +++A  P       ++            + +   E  +  ++ +      
Sbjct: 46  LPATSTVTPPVEEAAIPTPPETTQTLATH---------LVLNLKERRVYAYQDD-----Q 91

Query: 76  LLKEYKICAWSGTFGPKIETGDEQAPEGFYYI-----GWNNLNPNSKYFLSINIGFPN-- 128
           ++  Y +                + P G + +          NP +    +     PN  
Sbjct: 92  VIANYPVAIGKPG---------WETPRGDFSVIQMVEDPQWKNPWNGRVSAAG---PNSP 139

Query: 129 ---EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRDSL 171
               +       G  +  HG           S GC  M N+ ++ +Y +V+  +
Sbjct: 140 LGERWIGFWREGGKYIGFHGTPGEHVMGQAVSHGCVRMRNRDVKALYELVQTGI 193


>gi|158334241|ref|YP_001515413.1| ErfK/YbiS/YcfS/YnhG family protein [Acaryochloris marina MBIC11017]
 gi|158304482|gb|ABW26099.1| ErfK/YbiS/YcfS/YnhG family protein [Acaryochloris marina MBIC11017]
          Length = 201

 Score = 49.9 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/190 (15%), Positives = 53/190 (27%), Gaps = 43/190 (22%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
            +   +  A  +   G   S  +   AE  + E  +  + + R                 
Sbjct: 20  MKTEFIKIACVVISVGTIASFDVAQAAEQNIPETPLPGLDQPRNYLPSA------HGTRR 73

Query: 63  LEIWKRNVDAEY----VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP---- 114
           LE+              +LK Y +                  P G + +     NP    
Sbjct: 74  LELSISRRQVTLFQGDQVLKSYPVAVGKAG---------WPTPVGDFEVQTKVRNPSWQN 124

Query: 115 --NSKYFLSINIGFP-NEFDKAH------NRTGADLMIHGECA--------SAGCYAMNN 157
               K ++ I  G P N             +    +  HG           S GC  M +
Sbjct: 125 PFQGKGYV-IPGGAPDNPLSTRWLGFWTNGKN--WIGFHGTPNRASVGSAASHGCVRMYD 181

Query: 158 KQMQEIYAIV 167
           + +QE++ +V
Sbjct: 182 EHIQELFELV 191


>gi|221313601|ref|ZP_03595406.1| hypothetical protein BsubsN3_07732 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
          Length = 167

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 45/130 (34%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L +   N      ++K Y I         KI T   Q P G +YI   
Sbjct: 58  PYHIAVSIGAKTLTLSLNN-----RVMKTYPIAVG------KILT---QTPTGEFYIINR 103

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+NK + E
Sbjct: 104 QRNPGGPF-GAYWLS------LSKQHYG----IHGTNNPASIGKAVSKGCIRMHNKDVIE 152

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 153 LASIVPNGTR 162


>gi|221309274|ref|ZP_03591121.1| hypothetical protein Bsubs1_07796 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221318523|ref|ZP_03599817.1| hypothetical protein BsubsJ_07666 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322797|ref|ZP_03604091.1| hypothetical protein BsubsS_07777 [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 159

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 45/130 (34%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L +   N      ++K Y I         KI T   Q P G +YI   
Sbjct: 50  PYHIAVSIGAKTLTLSLNN-----RVMKTYPIAVG------KILT---QTPTGEFYIINR 95

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+NK + E
Sbjct: 96  QRNPGGPF-GAYWLS------LSKQHYG----IHGTNNPASIGKAVSKGCIRMHNKDVIE 144

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 145 LASIVPNGTR 154


>gi|16078468|ref|NP_389287.1| murein transglycosylase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|81342402|sp|O34816|YKUD_BACSU RecName: Full=Putative L,D-transpeptidase YkuD; AltName: Full=Spore
           protein YkuD
 gi|2632225|emb|CAA10867.1| YkuD protein [Bacillus subtilis]
 gi|2633775|emb|CAB13277.1| murein transglycosylase [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 164

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 45/130 (34%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +      L +   N      ++K Y I         KI T   Q P G +YI   
Sbjct: 55  PYHIAVSIGAKTLTLSLNN-----RVMKTYPIAVG------KILT---QTPTGEFYIINR 100

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +  +        +    G    IHG           S GC  M+NK + E
Sbjct: 101 QRNPGGPF-GAYWLS------LSKQHYG----IHGTNNPASIGKAVSKGCIRMHNKDVIE 149

Query: 163 IYAIVRDSLR 172
           + +IV +  R
Sbjct: 150 LASIVPNGTR 159


>gi|150390862|ref|YP_001320911.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus metalliredigens
           QYMF]
 gi|149950724|gb|ABR49252.1| ErfK/YbiS/YcfS/YnhG family protein [Alkaliphilus metalliredigens
           QYMF]
          Length = 332

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 48/152 (31%), Gaps = 32/152 (21%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           ++ +    +      P     + I K + IL +++ +      ++K+Y +          
Sbjct: 97  VNGSERRYLDVIDQPPTKGKWMTINKTKRILTLYEGD-----KVMKKYPVAQGKEP---- 147

Query: 93  IETGDEQAPEGFYYIGWNNLNP-----------------NSKYFLSINIGFPNEFDKAHN 135
                   PEG + I    +NP                 N   +  + I          +
Sbjct: 148 -----GLTPEGKFTIVNKLVNPGWGGAGIAQPVKGGSPNNPLGYRWMGINHGGGGSYGIH 202

Query: 136 RTGADLMIHGECASAGCYAMNNKQMQEIYAIV 167
                  I G  AS GC  M N  + E++ I+
Sbjct: 203 GNNNPRSI-GTNASLGCVRMINSDVAELFDII 233


>gi|329928325|ref|ZP_08282196.1| ErfK/YbiS/YcfS/YnhG [Paenibacillus sp. HGF5]
 gi|328937882|gb|EGG34287.1| ErfK/YbiS/YcfS/YnhG [Paenibacillus sp. HGF5]
          Length = 223

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 40/129 (31%), Gaps = 33/129 (25%)

Query: 49  FHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG 108
                I I+   + L + +        ++K Y +        P         P G + + 
Sbjct: 32  QSNLEIAIYPERHKLLVREHG-----QIIKTYSVAVG-NPSTP--------TPVGDFRVK 77

Query: 109 WNNLNPN-SKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQ 159
           +   N   S     I +  P          G    IHG           S GC  M+NK 
Sbjct: 78  YKGTNWGPSFGPRWIGLNVP------WGNFG----IHGTNKPYSIGQHLSHGCIRMHNKD 127

Query: 160 MQEIYAIVR 168
           + E+Y ++ 
Sbjct: 128 VIELYELIP 136


>gi|220929205|ref|YP_002506114.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium cellulolyticum H10]
 gi|219999533|gb|ACL76134.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium cellulolyticum H10]
          Length = 236

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 54/172 (31%), Gaps = 48/172 (27%)

Query: 5   YNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILE 64
             +LL ALF  +N                +  +  +  +  T+     +I +  +E  L 
Sbjct: 16  VFLLLIALFFAVN----------------TFVIKGNFTRHATNNQQQFLIFVHIDEKTLY 59

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINI 124
           +++         +K+Y I +               +P G + I   +          + +
Sbjct: 60  LFENE-----KCIKKYPIASGKPG---------WPSPIGEWKIVEKSQWGKGFGGRWLGL 105

Query: 125 GFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQEIYAIVR 168
                        G    IHG          AS GC  M N+ ++E+Y I  
Sbjct: 106 N------VRWGNYG----IHGTQDESSIGRSASHGCIRMYNRDIKELYDIAP 147


>gi|125972839|ref|YP_001036749.1| ErfK/YbiS/YcfS/YnhG [Clostridium thermocellum ATCC 27405]
 gi|256005881|ref|ZP_05430828.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           2360]
 gi|125713064|gb|ABN51556.1| ErfK/YbiS/YcfS/YnhG [Clostridium thermocellum ATCC 27405]
 gi|255990150|gb|EEU00285.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           2360]
 gi|316940925|gb|ADU74959.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium thermocellum DSM
           1313]
          Length = 230

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 46/129 (35%), Gaps = 35/129 (27%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
             I I  +E  L ++K       VLLK Y +        P        +PEG + I   +
Sbjct: 34  YYIYINLDELKLYLYKDG-----VLLKTYPVSGGK-PETP--------SPEGTWKIISKS 79

Query: 112 LNPNSKYFLS-INIGFPNEFDKAHNRTGADLMIHGE---------CASAGCYAMNNKQMQ 161
            +    +  S + +  P        + G    IHG           AS GC  M NK  +
Sbjct: 80  -DWGGNFGGSWMGLNVP------WGQYG----IHGTKYPWYIGRQNASHGCIRMYNKNAK 128

Query: 162 EIYAIVRDS 170
           E+Y IV   
Sbjct: 129 ELYDIVPYG 137


>gi|332799591|ref|YP_004461090.1| ErfK/YbiS/YcfS/YnhG family protein [Tepidanaerobacter sp. Re1]
 gi|332697326|gb|AEE91783.1| ErfK/YbiS/YcfS/YnhG family protein [Tepidanaerobacter sp. Re1]
          Length = 307

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 49/192 (25%), Gaps = 47/192 (24%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P     + IF  E  L +            K++ +                  P G + I
Sbjct: 114 PKGEVSLVIFTLERQLIVLDDG-----KPFKQFPVAVGKFNT---------PTPIGIFTI 159

Query: 108 GWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQ 159
              ++         + +  P          G    IHG           S+GC  M N  
Sbjct: 160 TQKDIWSGEFGSRWMRLSVP------WGIYG----IHGTNKPWSIGTFESSGCIRMYNTH 209

Query: 160 MQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNH 219
           ++++Y  V+   +  M   +     PF      +                 G D  E   
Sbjct: 210 VEQVYEWVKIGTKVFMVGGVD---GPFTFGLNTLSQGS------------RGSDVLEVQK 254

Query: 220 QEPFIQIINKQY 231
           +       N  Y
Sbjct: 255 RLAGYGFYNGDY 266


>gi|282855703|ref|ZP_06265010.1| secreted protein [Pyramidobacter piscolens W5455]
 gi|282586435|gb|EFB91696.1| secreted protein [Pyramidobacter piscolens W5455]
          Length = 220

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 49/155 (31%), Gaps = 55/155 (35%)

Query: 60  ENILEIWKRNVDAEYVLLKEYKICAWSGTFG--PKIETGDEQAPEGFYYI---------- 107
           +  L +WK++    +   K  +     G  G       GD++ P G + I          
Sbjct: 48  DRALSLWKKSDAGAWE--KTLEAPCGYGKLGLTENKREGDKKTPVGAFPILHAFGNKPNP 105

Query: 108 ----GWNNLNPNSK-------------------------------YFLSINIGFPNEFDK 132
                W  + PNS                                Y  ++ +G+ N    
Sbjct: 106 GTAMKWRPVTPNSYWADDVNQPKIYNTWVESAKKIHGEHLADYYQYDYAMAVGY-NADPA 164

Query: 133 AHNRTGADLMIHGE----CASAGCYAMNNKQMQEI 163
              R G+ + +H +      +AGC ++  + M E+
Sbjct: 165 VPGR-GSAIFVHVKSRRHWTTAGCLSLERRDMIEL 198


>gi|295400837|ref|ZP_06810813.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294977100|gb|EFG52702.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 165

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 41/128 (32%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L + K        +++ Y I                  P G + I   
Sbjct: 56  PYTIHISVSRRQLTLKKNGS-----IVRIYPIAVGKMVTA---------TPVGDFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  +I +        +    G    IHG           S GC  M+NK + E
Sbjct: 102 QPNPGGPF-GAIWLS------LSKIHYG----IHGTNNPSSIGKYVSKGCIRMHNKDVLE 150

Query: 163 IYAIVRDS 170
           + ++V + 
Sbjct: 151 LASLVPNG 158


>gi|291455450|ref|ZP_06594840.1| lipoprotein [Streptomyces albus J1074]
 gi|291358399|gb|EFE85301.1| lipoprotein [Streptomyces albus J1074]
          Length = 248

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 61/187 (32%), Gaps = 44/187 (23%)

Query: 20  HHSRSLIDKAEHPLSENL--IISMQKKRTSPFHPTVIRIF-----KNENILEIWKRNVDA 72
             +R    +A       L  I    +K+       V+ ++     +    + ++ ++ D 
Sbjct: 41  GEARQPDARASSAAPGELPGISERFRKQIPDDTRQVVAVYGDGADRATATVVLYTKDGDG 100

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG-----------------------W 109
            +    ++        + P     D+++P G + +                         
Sbjct: 101 -WKKRADWPAHNGKKGWTPDHHEDDKRSPVGVFTLTDAGGVLADPGPGGLPYTRSDAFAA 159

Query: 110 NNLNPNSKYF---LSINIGF-------PNEFDKAHNRT-GADLMIHGECAS--AGCYAMN 156
                 S +    L I I +       PN+  +   ++ G  + +H +  S  +GC +++
Sbjct: 160 PRTWAESHWHDFDLVIAIDYNRVKGTPPNDPTRPEGQSKGGSIWLHMDHGSGTSGCVSLS 219

Query: 157 NKQMQEI 163
            + M+ +
Sbjct: 220 EQGMRHL 226


>gi|239983640|ref|ZP_04706164.1| lipoprotein [Streptomyces albus J1074]
          Length = 245

 Score = 49.5 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 61/187 (32%), Gaps = 44/187 (23%)

Query: 20  HHSRSLIDKAEHPLSENL--IISMQKKRTSPFHPTVIRIF-----KNENILEIWKRNVDA 72
             +R    +A       L  I    +K+       V+ ++     +    + ++ ++ D 
Sbjct: 38  GEARQPDARASSAAPGELPGISERFRKQIPDDTRQVVAVYGDGADRATATVVLYTKDGDG 97

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG-----------------------W 109
            +    ++        + P     D+++P G + +                         
Sbjct: 98  -WKKRADWPAHNGKKGWTPDHHEDDKRSPVGVFTLTDAGGVLADPGPGGLPYTRSDAFAA 156

Query: 110 NNLNPNSKYF---LSINIGF-------PNEFDKAHNRT-GADLMIHGECAS--AGCYAMN 156
                 S +    L I I +       PN+  +   ++ G  + +H +  S  +GC +++
Sbjct: 157 PRTWAESHWHDFDLVIAIDYNRVKGTPPNDPTRPEGQSKGGSIWLHMDHGSGTSGCVSLS 216

Query: 157 NKQMQEI 163
            + M+ +
Sbjct: 217 EQGMRHL 223


>gi|126658355|ref|ZP_01729504.1| hypothetical protein CY0110_27385 [Cyanothece sp. CCY0110]
 gi|126620287|gb|EAZ91007.1| hypothetical protein CY0110_27385 [Cyanothece sp. CCY0110]
          Length = 191

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/170 (14%), Positives = 54/170 (31%), Gaps = 37/170 (21%)

Query: 20  HHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKE 79
             + S       PL E  I++ ++   +     V+ +   E  + +++ +      ++  
Sbjct: 36  PATPSTELPVTLPLEEAAIVTPEETIETLATRVVLNL--KERKVYVYQDD-----QVIAN 88

Query: 80  YKICAWSGTFGPKIETGDEQAPEGFYYI-----GWNNLNPNSKYFLSINIGFPN-----E 129
           Y +                + P G + +          NP +    +     PN      
Sbjct: 89  YPVAIGKPG---------WETPRGEFSVIQMVEDPQWKNPWNGRVSAAG---PNSPLGER 136

Query: 130 FDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRDSL 171
           +       G  +  HG           S GC  M N+ ++ +Y +V+  +
Sbjct: 137 WIGFWREGGKYIGFHGTPGEHVMGQAVSHGCVRMRNQDVKALYELVQTGI 186


>gi|207111612|ref|ZP_03245774.1| conserved hypothetical secreted protein [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 42

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 8/40 (20%)

Query: 127 PNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNK 158
           PN +D    RTG  + +HG           + GC A+ N 
Sbjct: 1   PNLYDTLKKRTGHGIWVHGMPLNGDRNELNTKGCIAIENP 40


>gi|315652262|ref|ZP_07905254.1| S-layer family protein and secreted protein with 1 GW repeat fusion
           protein [Eubacterium saburreum DSM 3986]
 gi|315485385|gb|EFU75775.1| S-layer family protein and secreted protein with 1 GW repeat fusion
           protein [Eubacterium saburreum DSM 3986]
          Length = 231

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 73/214 (34%), Gaps = 70/214 (32%)

Query: 9   LFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN---ILEI 65
           L A F+ ++    S  +   A  P+ +  I        +  H  +I   KN      +  
Sbjct: 7   LCATFVVMSTLLASTGVNAYAALPVEKLSISK------TANHIILIVGHKNNKNRVTVND 60

Query: 66  WKRNVDAEYVLLKEYKICAWSGTFG--PKIETGDEQAPEGFYY--------------IGW 109
           + ++ D  +  +K + +   +GT G   +   GD++ PEG +               I +
Sbjct: 61  YTKSSDGTW--IKNWYVNGIAGTNGISTEKREGDKKTPEGVFNAMFSFGLKDNPGSLIEY 118

Query: 110 NNL--------NPNSKYF---------------------------LSINIGFPNEFDKAH 134
             +        + NS Y+                            ++ + + N      
Sbjct: 119 RKITDGDYWVDDSNSAYYNTWVNTSKVNKDWASAEDLKTAYPFYNYALALNY-NTE-AVP 176

Query: 135 NRTGADLMIH-----GECASAGCYAMNNKQMQEI 163
            + G+ + IH      + +SAGC  +  + M+++
Sbjct: 177 GK-GSAIFIHCTKTDNDTSSAGCVRIPEEYMKKL 209


>gi|94968756|ref|YP_590804.1| ErfK/YbiS/YcfS/YnhG [Candidatus Koribacter versatilis Ellin345]
 gi|94550806|gb|ABF40730.1| ErfK/YbiS/YcfS/YnhG [Candidatus Koribacter versatilis Ellin345]
          Length = 205

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 62/169 (36%), Gaps = 36/169 (21%)

Query: 34  SENLIISMQKKRTSPFHPT-VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           +   + + + +      PT +I +   +  L + + +      ++K Y +     +    
Sbjct: 27  TAQTVQATEARPMEAPRPTRLILVSIPDRKLALLEDD-----KVVKVYPVAVGKDST--- 78

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR------TGADLMIHGE 146
                  +PEG + I  +  NP + Y     +  P   +   +R       G  +  HG 
Sbjct: 79  ------PSPEGTFTIKSHVTNP-TYYHEGKVVA-PGPQNPLGSRWMGLSEKGYGI--HGT 128

Query: 147 CA--------SAGCYAMNNKQMQEIYAIVR--DSLRGNMQSHIQI-QAF 184
            A        S GC  M  K ++E++ +V+  D +    +   Q+ Q F
Sbjct: 129 NAPKSIGKAASHGCIRMAKKDLEELFTLVKVGDGVDIRGERDEQMAQVF 177


>gi|28210881|ref|NP_781825.1| tonB-dependent receptor protein [Clostridium tetani E88]
 gi|28203320|gb|AAO35762.1| tonB-dependent receptor protein [Clostridium tetani E88]
          Length = 312

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 45/147 (30%), Gaps = 48/147 (32%)

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
           +  H   + I K++ IL ++         + K+Y + A +              PEG + 
Sbjct: 168 TLKHGYSMVINKDKRILTVYLDG-----KVYKKYPVAAGASPS---------YTPEGKFT 213

Query: 107 IGWNNLNP-----------------NSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA- 148
           I    +NP                 N      + +             G+   IHG    
Sbjct: 214 IVSKLINPTWISTRTGQVISGGTPQNPLGKRWLGLSI---------DGGSMYGIHGSNNP 264

Query: 149 -------SAGCYAMNNKQMQEIYAIVR 168
                  S GC  M N  ++E++  + 
Sbjct: 265 WSIGTNVSLGCIRMFNNDVEELFDFIP 291


>gi|331004214|ref|ZP_08327693.1| hypothetical protein HMPREF0491_02555 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411487|gb|EGG90898.1| hypothetical protein HMPREF0491_02555 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 231

 Score = 49.1 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 70/224 (31%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNEN- 61
            +    + A F  L+    S  +   A  P+ +  +        +  H  +I   KN   
Sbjct: 1   MKLFKKICATFALLSTLLASTYVNTYAALPVEQLAVSK------TANHIILIVGHKNNKN 54

Query: 62  --ILEIWKRNVDAEYVLLKEYKI--CAWSGTFGPKIETGDEQAPEGFYY----------- 106
              +  + ++ D  +   K + +   A +     +   GD++ PEG +            
Sbjct: 55  KVTVNDYTKSSDGTWT--KNWYVGGIAGTNGISTQKSEGDKKTPEGVFNAMFAFGLKDNP 112

Query: 107 ---IGWNNL--------NPNSKYF---------------------------LSINIGFPN 128
              + +  +        + NS Y+                            ++ + + N
Sbjct: 113 GSILDYRKIGDGDYWVDDSNSAYYNKWVNISNVNKDWNSAENLKSASPFYNYALALNY-N 171

Query: 129 EFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAIV 167
                  + G+ + IH      + +SAGC  +  + M+++   V
Sbjct: 172 TE-AVPGK-GSAIFIHCTKTDNDTSSAGCIRIPEEYMKKLVQTV 213


>gi|167630552|ref|YP_001681051.1| erfk/ybis/ycfs/ynhg [Heliobacterium modesticaldum Ice1]
 gi|167593292|gb|ABZ85040.1| erfk/ybis/ycfs/ynhg [Heliobacterium modesticaldum Ice1]
          Length = 307

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 67/208 (32%), Gaps = 39/208 (18%)

Query: 18  GCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLL 77
           GC  S +       P+  N     +K  ++P     + +  ++N L +          + 
Sbjct: 82  GCVSSST-WLALSPPVMTNQPAEPRKPPSAPVGVITLVVELDKNTLSVLIDGN-----VY 135

Query: 78  KEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP-NSKYFLSINIGFPNEFDKAHNR 136
           K Y +              D  +P G + I     +  +      +    P         
Sbjct: 136 KTYPVATGKR---------DTPSPVGEWRIVDKQKHWGDGFGSRWLGFNVP------WGI 180

Query: 137 TGADLMIHGE--CASAG------CYAMNNKQMQEIYAIV--RDSLRGNMQSHIQI--QAF 184
            G    IHG     S G      C+ M+N+ ++E++  +  R  +R      +++   A+
Sbjct: 181 YG----IHGTNKPWSVGKSVSGGCFRMHNRDVEELFEWIPLRTVVRVIDSQKVKLSKSAY 236

Query: 185 PFRMTSKNMQLYQNN-PNYSFWNMLKLG 211
              MT + +   Q       F   L  G
Sbjct: 237 KIGMTGQEVARIQFRLQEKGFSPGLADG 264


>gi|89099360|ref|ZP_01172237.1| hypothetical protein B14911_22317 [Bacillus sp. NRRL B-14911]
 gi|89085969|gb|EAR65093.1| hypothetical protein B14911_22317 [Bacillus sp. NRRL B-14911]
          Length = 170

 Score = 48.8 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 43/130 (33%), Gaps = 33/130 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L + K  +     L K Y +                Q P G Y I   
Sbjct: 61  PYSISITLSTRRLSLLKNGI-----LQKTYPVGIGKMLT---------QTPPGDYVIVNR 106

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   + + + +          ++ G  +  HG           S GC  MNN+ + E
Sbjct: 107 EPNPGGPFGI-MWLS--------LSKAGYGI--HGTNNPASIGKAVSKGCVRMNNQDVLE 155

Query: 163 IYAIVRDSLR 172
           +  IV +  R
Sbjct: 156 LSGIVPNGTR 165


>gi|323701623|ref|ZP_08113295.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533396|gb|EGB23263.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum nigrificans
           DSM 574]
          Length = 193

 Score = 48.8 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 32/99 (32%), Gaps = 28/99 (28%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNS-KYFLSINIGFPNEFDKA 133
            L+K Y I        P         P G Y +    +NP        + +  P      
Sbjct: 29  QLIKTYPIAVGK-PATP--------TPAGDYQVINKVVNPGGVLGTRWMGLNIP------ 73

Query: 134 HNRTGADLMIHGECA--------SAGCYAMNNKQMQEIY 164
               G +  IHG           S GC  M+N  ++E++
Sbjct: 74  ----GGNYGIHGTNNPSSIGNRVSLGCIRMHNSHVEELF 108


>gi|78042988|ref|YP_359059.1| ErfK/YbiS/YcfS/YnhG family protein [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995103|gb|ABB14002.1| ErfK/YbiS/YcfS/YnhG family protein [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 143

 Score = 48.8 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 32/107 (29%), Gaps = 32/107 (29%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSIN-----IGFPNE 129
             +K + +        P         P G Y I     NP    +  +      +  P  
Sbjct: 46  QKIKSWPVAVG-APSTP--------TPTGIYRIKNKISNPGGSPYGVLGSRWMGLTIP-- 94

Query: 130 FDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVR 168
                   G +  IHG           S GC  M NK ++E++  V 
Sbjct: 95  --------GGNYGIHGTNNPASIGREVSRGCIRMLNKDIEELFPQVP 133


>gi|258513554|ref|YP_003189776.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777259|gb|ACV61153.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 175

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 26/77 (33%), Gaps = 19/77 (24%)

Query: 100 APEGFYYIGWNNLNPNSK-YFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SA 150
            P G Y +    +NP        + +  P          G    IHG           S 
Sbjct: 39  TPTGNYSVVNKIINPGGMLGTRWLGLNIP----------GGVYGIHGTNNPDSIGKAVSN 88

Query: 151 GCYAMNNKQMQEIYAIV 167
           GC  M N+ ++EI+  +
Sbjct: 89  GCIRMQNQDIEEIFPYI 105


>gi|225028593|ref|ZP_03717785.1| hypothetical protein EUBHAL_02872 [Eubacterium hallii DSM 3353]
 gi|224954075|gb|EEG35284.1| hypothetical protein EUBHAL_02872 [Eubacterium hallii DSM 3353]
          Length = 248

 Score = 48.4 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 58/209 (27%), Gaps = 59/209 (28%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIF-----KNENILEIWK 67
            I L            A     +    +   ++          IF     K++  + ++ 
Sbjct: 34  AIPLQAATAKSQSTTVANRSKVKKDKWTTLLQKYEKSKKVNQLIFVKYKGKSKANIVLY- 92

Query: 68  RNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN---NLNPNSK------- 117
             V+ ++  +            G K   GD++ P G Y          NP SK       
Sbjct: 93  EKVNGKFKKVFGCIGYVGKNGIG-KKREGDKKTPTGTYSFTKAFGIKKNPRSKIKYIKLN 151

Query: 118 ------------------------------------YFLSINIGFPNEFDKAHNRTGADL 141
                                               Y  ++ I + N+      + G+ +
Sbjct: 152 KYHYWSGDRRYYNQMIDIRKVKASRSGEHLIDYKPHYNYALAIDY-NKNCVY--KKGSAI 208

Query: 142 MIHGECA---SAGCYAMNNKQMQEIYAIV 167
            +H   +   + GC A+  K M++I   V
Sbjct: 209 FLHCTGSNPYTGGCVAVKQKYMKKIMQTV 237


>gi|312127038|ref|YP_003991912.1| erfk/ybis/ycfs/ynhg family protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777057|gb|ADQ06543.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 223

 Score = 48.4 bits (114), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 54/171 (31%), Gaps = 41/171 (23%)

Query: 50  HPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           +P +I +  +++ L ++K  +     L K Y I        P         P G + I  
Sbjct: 32  NPYLIYVSIDDSRLYVFKEGI-----LYKSYPISPGK-PSTP--------TPVGTFKIIS 77

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQ 161
            +          + +         + + G    IHG           S GC  M NK ++
Sbjct: 78  KDYWGEGFGGRWMGLN------VRYGKYG----IHGTIYESYIGAHVSKGCVRMLNKDVK 127

Query: 162 EIYAIVR--------DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           E+++ +             G  ++  +   +P       M + +      F
Sbjct: 128 ELFSYIPIGTTVIISQGEYGEFRNGFRT-IYPGDTGEDVMAVQRRLKELGF 177


>gi|169831666|ref|YP_001717648.1| ErfK/YbiS/YcfS/YnhG family protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638510|gb|ACA60016.1| ErfK/YbiS/YcfS/YnhG family protein [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 307

 Score = 48.4 bits (114), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 42/158 (26%), Gaps = 49/158 (31%)

Query: 24  SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKIC 83
           S   K   PL              P     I I   +  L + +          K++   
Sbjct: 107 STPVKTSEPLPP------------PTGEVEIIIDVQKRTLTVMENGY-----PYKQFPCA 149

Query: 84  AWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY---FLSINIGFPNEFDKAHNRTGAD 140
                            P G + I     N  + +   +L +NI             G  
Sbjct: 150 VGKNET---------PTPVGNWSIRRKARNWGTGFGTRWLGLNID--------WGIYG-- 190

Query: 141 LMIHGECA--------SAGCYAMNNKQMQEIYAIVRDS 170
             IHG           S GC  M N+ ++E++  V   
Sbjct: 191 --IHGTNKPYSIGTRASHGCIRMFNRHVEELFPWVEAG 226


>gi|226096828|dbj|BAH45270.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 474

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 44/135 (32%), Gaps = 41/135 (30%)

Query: 46  TSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFY 105
            +PF P  +++  + + L++   +      L++ Y +                  PEG+Y
Sbjct: 325 VAPFEPLQLQLTTSTHTLKLISGS-----HLVRSYPVAIGKND----------STPEGYY 369

Query: 106 YIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG-----ADLMIHGEC--------ASAGC 152
            I                I  P   D  +   G         +HG           S GC
Sbjct: 370 TIQQK-------------INQPRGHDNIYGTRGMVFQENGYALHGTNHPESIGSSVSLGC 416

Query: 153 YAMNNKQMQEIYAIV 167
             + N  ++E+Y+ V
Sbjct: 417 VRLYNAAVEELYSFV 431


>gi|312112233|ref|YP_003990549.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y4.1MC1]
 gi|311217334|gb|ADP75938.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y4.1MC1]
          Length = 111

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 42/130 (32%), Gaps = 35/130 (26%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I  N++ L+++  +      L+K Y I        P         P G Y I     N
Sbjct: 5   IDISTNKHQLKLYDGH-----RLIKVYPIAVGKM-LTP--------TPSGIYTIINKQRN 50

Query: 114 PNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIY 164
           P   +  L + +           R    +  HG           S GC  M N  + E+ 
Sbjct: 51  PGGAFGVLWLGLS----------RPHYGI--HGTNNPSSIGKNVSRGCIRMYNHDVIELS 98

Query: 165 AIVRDSLRGN 174
           ++V    R  
Sbjct: 99  SMVPVGTRVY 108


>gi|291532676|emb|CBL05789.1| Uncharacterized protein conserved in bacteria [Megamonas
           hypermegale ART12/1]
          Length = 395

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 65/216 (30%), Gaps = 37/216 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M      LL  +    N   ++++     E     +    +Q           I I    
Sbjct: 1   MKKFIVFLLLGVMFVFNTVAYAQAENTAQEKIGGADKATDIQVNNNVNTVKRWILINIPA 60

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
             L ++  +       ++ Y +         KIET   + P GFY +    +NP      
Sbjct: 61  RSLRLYDND-----KCIEMYPVGVG------KIET---KTPVGFYKVVEKIVNPTWTDPA 106

Query: 121 SINIGFPNEFDKAHNRT----GADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV- 167
            +++  P+  D          G +  IHG           S GC  M    +++++  V 
Sbjct: 107 DVSVVIPSGEDNPLGYRWIGIGGNYGIHGTNRPDSVGHYVSNGCVRMVEADVEKVFDKVD 166

Query: 168 ----------RDSLRGNMQSHIQIQAFPFRMTSKNM 193
                     R  +       +    +P     +N+
Sbjct: 167 VGTEVQIIYNRLVIDKTFDGRVAYYIYPDGYDMQNL 202


>gi|269926314|ref|YP_003322937.1| ErfK/YbiS/YcfS/YnhG family protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789974|gb|ACZ42115.1| ErfK/YbiS/YcfS/YnhG family protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 616

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 54/153 (35%), Gaps = 25/153 (16%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEY--VLLKEYKICAWSGTFG 90
           +S  LI+S      +      + I KN   L + + N ++     ++KE  +   +    
Sbjct: 14  ISAGLILSYINTSQASGDEYYLVIVKNRQRLYLARGNPESPLWSDVIKEIPVATGALW-- 71

Query: 91  PKIETGDEQAPEGFYYIGWNNLNPNSKYF------------LSINIGFPNEF-DKAHNRT 137
              + G  + P G++ +   +  PN   +              + +  PN      H   
Sbjct: 72  --TQKG-LETPSGYFKVIEKSNRPNQGGYDFSDTGDVVLTPYFMRLAIPNRGGIGIHTYK 128

Query: 138 GAD--LM---IHGECASAGCYAMNNKQMQEIYA 165
           G    +    + G  ++ GC A     +Q++Y 
Sbjct: 129 GYTLKIWRFGVPGGESTHGCIAGPPNDIQDLYK 161


>gi|149198883|ref|ZP_01875925.1| tonB-dependent receptor protein [Lentisphaera araneosa HTCC2155]
 gi|149138081|gb|EDM26492.1| tonB-dependent receptor protein [Lentisphaera araneosa HTCC2155]
          Length = 325

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 37/113 (32%), Gaps = 33/113 (29%)

Query: 75  VLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFP-NEFDKA 133
            L + Y I              D + P G ++I      P+ K +     G P N     
Sbjct: 219 KLFRFYNIGIGK----------DNRTPFGEFFISGKKREPSWKGY---PFGHPENVLGTR 265

Query: 134 HNR---------TGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRD 169
             R          G  +  HG          +S GC  M N+ ++E++  + D
Sbjct: 266 WMRLTKISDGSNEGYGI--HGTSEPESIGTASSLGCIRMRNEDVEELFNFIPD 316


>gi|170288938|ref|YP_001739176.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga sp. RQ2]
 gi|170176441|gb|ACB09493.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga sp. RQ2]
          Length = 382

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 46/149 (30%), Gaps = 39/149 (26%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
             +P  I +    + L ++        VLLK Y +                  P G Y+I
Sbjct: 247 RENPVTIVVNLFSSKLALYYDG-----VLLKVYPVALGRSDT----------TPPGRYWI 291

Query: 108 GWNNLNPNSKYFL----------SINIGF-----PNEFDKAHNRTGADLMIHGECASAGC 152
               ++P   +F            +   +     P       ++        G+  S GC
Sbjct: 292 LRKEIDPALYWFGEYISPRTPLNGLGTRYLQLSNPTYAIHGTSKP----WEIGKRISHGC 347

Query: 153 YAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
             M N+ ++EI     D+  G     + +
Sbjct: 348 IRMFNRDVEEI-----DAFAGVGTEVVVV 371


>gi|296131671|ref|YP_003638918.1| ErfK/YbiS/YcfS/YnhG family protein [Thermincola sp. JR]
 gi|296030249|gb|ADG81017.1| ErfK/YbiS/YcfS/YnhG family protein [Thermincola potens JR]
          Length = 126

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 40/132 (30%), Gaps = 33/132 (25%)

Query: 45  RTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGF 104
               +   +IR+     +L + + N   +      Y +        P         P G 
Sbjct: 9   DEPLYSNILIRVDVTNRLLYLERGNRTTQI-----YPVAVGK-PSTP--------TPPGT 54

Query: 105 YYIGWNNLNPNS-KYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAM 155
           Y I    +NP        + +  P+              IHG           S GC  M
Sbjct: 55  YSIIEKTVNPGGILGTRWMGLDIPD----------GPYGIHGTWNRDSIGKAVSNGCIRM 104

Query: 156 NNKQMQEIYAIV 167
            N+ ++E++  V
Sbjct: 105 YNEDVEEVFRQV 116


>gi|326386917|ref|ZP_08208531.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208597|gb|EGD59400.1| ErfK/YbiS/YcfS/YnhG [Novosphingobium nitrogenifigens DSM 19370]
          Length = 243

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 28/124 (22%)

Query: 51  PTVIRIFKNENILEIWKRNVD-AEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109
           P VI +     +L +++   +     +LK Y               GD+  P G + I  
Sbjct: 113 PLVITVDLAARVLSVFENGHEVGATAILKGY---------------GDKPTPIGVFPITQ 157

Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA-----SAGCYAMNNKQMQEIY 164
            + +  S  + +     P  +      T   + IHG        + GC  + +   ++++
Sbjct: 158 KDAHHVSNLYDA-----PMPWMMRL--TNDGVSIHGSKVERGYATNGCIGVPDAFAEKLF 210

Query: 165 AIVR 168
            + +
Sbjct: 211 RLAK 214


>gi|56421815|ref|YP_149133.1| hypothetical protein GK3280 [Geobacillus kaustophilus HTA426]
 gi|56381657|dbj|BAD77565.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 165

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 40/128 (31%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L +  R        ++ Y I                  P G + I   
Sbjct: 56  PYTIHISISRRQLTLKHRGRT-----IRTYPIGVGKMVTA---------TPVGDFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
             NP   +  ++ +        +    G    IHG           S GC  M+NK + E
Sbjct: 102 QPNPGGPF-GAMWLS------LSKVHYG----IHGTNDPSSIGKYVSKGCIRMHNKDVLE 150

Query: 163 IYAIVRDS 170
           + +IV + 
Sbjct: 151 LASIVPNG 158


>gi|317122862|ref|YP_004102865.1| ErfK/YbiS/YcfS/YnhG family protein [Thermaerobacter marianensis DSM
           12885]
 gi|315592842|gb|ADU52138.1| ErfK/YbiS/YcfS/YnhG family protein [Thermaerobacter marianensis DSM
           12885]
          Length = 260

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 41/135 (30%), Gaps = 33/135 (24%)

Query: 43  KKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPE 102
           +   +     +I I  ++  L +++         ++ Y I A             E +P 
Sbjct: 65  RSAVAAAEDVLIVIDIDQRELTVYRNG-----QPVRTYPIAAGRPG---------EPSPV 110

Query: 103 GFYYIGWNNLNPNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCY 153
           G + +      P   +      +  P          G    IHG           S GC 
Sbjct: 111 GEWRVTDIAHWPGGPFGARWFGLSAP------WGSYG----IHGTNNPGSIGTYASLGCI 160

Query: 154 AMNNKQMQEIYAIVR 168
            M N+ +  +  +V+
Sbjct: 161 RMFNEDVLTLDDLVK 175


>gi|86749621|ref|YP_486117.1| hypothetical protein RPB_2501 [Rhodopseudomonas palustris HaA2]
 gi|86572649|gb|ABD07206.1| ErfK/YbiS/YcfS/YnhG [Rhodopseudomonas palustris HaA2]
          Length = 588

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 41/142 (28%), Gaps = 25/142 (17%)

Query: 19  CHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLK 78
              +     + +  L       ++K    P  P VI +   +  + ++  N         
Sbjct: 82  AQPAPKRYQRKQPHLDTRQQKLIEKPTAKPQGPLVIAVSIEQQKMRVYDANG-----FFA 136

Query: 79  EYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTG 138
           E  I    G  G          P G + +   N    S  +    + +          T 
Sbjct: 137 EAPIST--GMRGH-------ATPMGVFSVIQKNKWHRSNIYSGAPMPY------MQRLTW 181

Query: 139 ADLMIH-----GECASAGCYAM 155
           + + +H     G  AS GC  M
Sbjct: 182 SGIALHAGVVPGYPASHGCIRM 203


>gi|291614448|ref|YP_003524605.1| ErfK/YbiS/YcfS/YnhG family protein [Sideroxydans lithotrophicus
           ES-1]
 gi|291584560|gb|ADE12218.1| ErfK/YbiS/YcfS/YnhG family protein [Sideroxydans lithotrophicus
           ES-1]
          Length = 159

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 50/156 (32%), Gaps = 45/156 (28%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN-- 111
           I I   E  LE++    D +   L+ Y++   +   G   E G    P G + I      
Sbjct: 3   IAIHIPEQTLELF----DDDGKPLRRYRVSTGANGVGE--ENGSFCTPRGKHVIRARIGA 56

Query: 112 -LNPNSKYFLSINIG--FPNEFDKAH--------------------NRTGA------DLM 142
               N+ +      G  +  E  +                      NR+G+       + 
Sbjct: 57  GQPENTVFVKRRPTGEIYTPELGRQQPGRDWILTRILWLSGCESGYNRSGSCDTMRRYIY 116

Query: 143 IHGECA--------SAGCYAMNNKQMQEIYAIVRDS 170
           IHG           S GC  M N  M E++ +V+  
Sbjct: 117 IHGTPDGTALGKPGSHGCIRMRNADMVELFELVKTG 152


>gi|307826415|ref|ZP_07656615.1| hypothetical protein MettuDRAFT_4462 [Methylobacter tundripaludum
           SV96]
 gi|307732533|gb|EFO03410.1| hypothetical protein MettuDRAFT_4462 [Methylobacter tundripaludum
           SV96]
          Length = 138

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 105 YYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGAD 140
           Y I    LNPNS Y LS+ + +PN FD  H R G  
Sbjct: 97  YRIV--ELNPNSHYHLSMKLNYPNGFDLLHARQGGG 130


>gi|299535205|ref|ZP_07048529.1| spore protein ykuD-like protein [Lysinibacillus fusiformis ZC1]
 gi|298729326|gb|EFI69877.1| spore protein ykuD-like protein [Lysinibacillus fusiformis ZC1]
          Length = 164

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 45/129 (34%), Gaps = 39/129 (30%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  N   L ++K N+     L K+Y I                + P G + I   
Sbjct: 55  PYHIEISTNNRWLRLYKNNI-----LQKQYPIAVGRML---------HETPVGSFIIINK 100

Query: 111 NLNPNSKY---FLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQ 159
             NP   +   ++S+          +    G    IHG           S GC  M N+ 
Sbjct: 101 APNPGGPFGTMWMSL----------SKEHYG----IHGTNDPSSIGHAVSHGCIRMQNRD 146

Query: 160 MQEIYAIVR 168
           ++E+ +IV 
Sbjct: 147 VEELASIVP 155


>gi|126649562|ref|ZP_01721803.1| hypothetical protein BB14905_06478 [Bacillus sp. B14905]
 gi|126593887|gb|EAZ87810.1| hypothetical protein BB14905_06478 [Bacillus sp. B14905]
          Length = 143

 Score = 48.0 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 44/126 (34%), Gaps = 33/126 (26%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I      L +++ N+     L K+Y I                + P G + I   
Sbjct: 34  PYRIEISTENRWLRLYRNNI-----LQKQYPIAVGRML---------HETPVGSFIIINK 79

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
           + NP   +  ++ +        +    G    IHG           S GC  M N+ ++E
Sbjct: 80  DPNPGGPF-GTMWMS------LSKEHYG----IHGTNDPSSIGHAVSHGCIRMQNQDVEE 128

Query: 163 IYAIVR 168
           + +IV 
Sbjct: 129 LASIVP 134


>gi|91977411|ref|YP_570070.1| hypothetical protein RPD_2942 [Rhodopseudomonas palustris BisB5]
 gi|91683867|gb|ABE40169.1| ErfK/YbiS/YcfS/YnhG [Rhodopseudomonas palustris BisB5]
          Length = 575

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 56/182 (30%), Gaps = 33/182 (18%)

Query: 17  NGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVL 76
                 +    +  H L       ++K+ T P  P +I +  ++  L ++  N      L
Sbjct: 64  APAQPPQKRYPRKHHQLDSRQEKLIEKQATKPQGPLLISVSIDQQKLRVYDANG-----L 118

Query: 77  LKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNR 136
           L E  +   + +            P G + +   N    S  +    + +          
Sbjct: 119 LAESPVSTGTRS---------HATPMGVFSVIQKNKWHRSNIYSGAPMPY------MQRI 163

Query: 137 TGADL-----MIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSK 191
           T + +     M+ G  AS GC  M      +++   R   R        +   P  +T  
Sbjct: 164 TWSGIALHAGMVPGYPASHGCIRMPTAFATKMWGWTRMGAR--------VIVTPGDITPT 215

Query: 192 NM 193
           N 
Sbjct: 216 NF 217


>gi|121534863|ref|ZP_01666682.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosinus carboxydivorans
           Nor1]
 gi|121306462|gb|EAX47385.1| ErfK/YbiS/YcfS/YnhG family protein [Thermosinus carboxydivorans
           Nor1]
          Length = 211

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 51/142 (35%), Gaps = 21/142 (14%)

Query: 28  KAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSG 87
           +A   +S +       +  S      I I K +  L +++ N        +++ +     
Sbjct: 79  QAAEKISVDPAPQPPARGKSSLSRPHILITKAKRQLTLFESNT-----PFRQWPVAIGK- 132

Query: 88  TFGPKIETGDEQAPEGFYYIGWNNLNPNS-KYFLSINIGFPNEFDKAHNRTGADL-MIHG 145
              P         P G + I    +NP        + +      D ++   G +   + G
Sbjct: 133 PHTP--------TPVGNFAIAAKIMNPGGVLGTRWMGLN----HD-SYGIHGTNAPWLIG 179

Query: 146 ECASAGCYAMNNKQMQEIYAIV 167
           +  S GC  M+N   +E++A++
Sbjct: 180 QMVSNGCIRMHNPHAEELFALI 201


>gi|312135699|ref|YP_004003037.1| erfk/ybis/ycfs/ynhg family protein [Caldicellulosiruptor owensensis
           OL]
 gi|311775750|gb|ADQ05237.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor owensensis
           OL]
          Length = 223

 Score = 47.6 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 54/169 (31%), Gaps = 41/169 (24%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
            +I +  +++ L ++K  +     L K Y I        P         P G + I   +
Sbjct: 34  YLIYVSIDDSRLYVFKEGI-----LYKSYPISPGK-PSTP--------TPVGTFKIISKD 79

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQEI 163
                     + +         + + G    IHG           S GC  M NK ++E+
Sbjct: 80  YWGEGFGGRWMGLN------VRYGKYG----IHGTIYESYIGAHVSKGCVRMLNKDVKEL 129

Query: 164 YAIVR--------DSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           ++ +         + + G  ++  +   +P       M + +      F
Sbjct: 130 FSYIPIGTTVVISEGIYGEFRNGFRT-IYPGDTGEDVMAVQKRLKELGF 177


>gi|330838933|ref|YP_004413513.1| ErfK/YbiS/YcfS/YnhG family protein [Selenomonas sputigena ATCC
           35185]
 gi|329746697|gb|AEC00054.1| ErfK/YbiS/YcfS/YnhG family protein [Selenomonas sputigena ATCC
           35185]
          Length = 409

 Score = 47.6 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 51/200 (25%), Gaps = 56/200 (28%)

Query: 3   NRYNILLFALFIFLNGCHHSRSLIDK--------------AEHPLSENLIIS--MQKKRT 46
            +     F      +G        +K              AE P  E +  S        
Sbjct: 2   FKQIAAFFVCLSMFSGVSGWAGATEKEQGSSYGAWVKDISAESPEPEKVHASEVKSAAAE 61

Query: 47  SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYY 106
               P  I I      L ++K N       ++ Y +     +            P G++ 
Sbjct: 62  KTGDPYKIIINVAARSLGVYKNN-----EKIRLYPVGLGKLST---------PTPVGYFS 107

Query: 107 IGWNNLNPN-----------SKYFLSINIGFPNEFDKAHNRTGADLMIHGEC-------- 147
           +     NP                 +  +G+   + +     G    IHG          
Sbjct: 108 VLTKEENPTWVDPGDSKNTIPSGEGN-PLGY--RWMQVWGNYG----IHGTNHPESIGSY 160

Query: 148 ASAGCYAMNNKQMQEIYAIV 167
            S GC  M    ++E+Y   
Sbjct: 161 VSNGCIRMKEADVEEVYDYA 180


>gi|281412542|ref|YP_003346621.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga naphthophila RKU-10]
 gi|281373645|gb|ADA67207.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga naphthophila RKU-10]
          Length = 382

 Score = 47.6 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 46/149 (30%), Gaps = 39/149 (26%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
             +P  I +    + L ++        VLLK Y +                  P G Y++
Sbjct: 247 RENPVTIVVNLFSSKLALYYDG-----VLLKVYPVALGRSDA----------TPPGRYWV 291

Query: 108 GWNNLNPNSKYFL----------SINIGF-----PNEFDKAHNRTGADLMIHGECASAGC 152
               ++P   +F            +   +     P       ++        G+  S GC
Sbjct: 292 LRKEIDPALYWFGEYISPRTPLNGLGTRYLQLSNPTYAIHGTSKP----WEIGKRISHGC 347

Query: 153 YAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
             M N+ ++EI     D+  G     + +
Sbjct: 348 IRMFNRDVEEI-----DAFAGVGTEVVVV 371


>gi|284052766|ref|ZP_06382976.1| ErfK/YbiS/YcfS/YnhG [Arthrospira platensis str. Paraca]
 gi|291565859|dbj|BAI88131.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 208

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/173 (11%), Positives = 45/173 (26%), Gaps = 32/173 (18%)

Query: 16  LNGCHHSRSLIDK---AEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDA 72
           L+    +  +          +      S          P  + +   E  + +++     
Sbjct: 43  LSASASAPRIYPYQSILNPDVPPLDDPSQFLPIGEQQAPVKVVLRLGERRVYVYRGESQ- 101

Query: 73  EYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP--NSKYFLSINIGFPN-- 128
               +  Y +                + P G + +     NP   + +   +    PN  
Sbjct: 102 ----IASYPVAVGKPG---------WETPTGTFQVTEKVENPQWENPWTGEVRPAGPNSA 148

Query: 129 ---EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVRDS 170
               +    +     +  HG          AS GC  M N+ +  ++  V   
Sbjct: 149 LGLRWIGFWHDGKDAIGFHGTPTVNSIGQAASHGCVRMRNEDIVALFEKVEMG 201


>gi|261420721|ref|YP_003254403.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y412MC61]
 gi|319768391|ref|YP_004133892.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y412MC52]
 gi|261377178|gb|ACX79921.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y412MC61]
 gi|317113257|gb|ADU95749.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. Y412MC52]
          Length = 165

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 40/128 (31%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L +  R        ++ Y I                  P G + I   
Sbjct: 56  PYTIHISISRRQLTLKHRGRT-----IRTYPIGVGKMVTA---------TPVGDFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
             NP   +  ++ +          ++    +  HG           S GC  M+NK + E
Sbjct: 102 QPNPGGPF-GAMWLS--------LSKLHYGI--HGTNDPSSIGKYVSKGCIRMHNKDVLE 150

Query: 163 IYAIVRDS 170
           + +IV + 
Sbjct: 151 LASIVPNG 158


>gi|192291819|ref|YP_001992424.1| hypothetical protein Rpal_3448 [Rhodopseudomonas palustris TIE-1]
 gi|192285568|gb|ACF01949.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 537

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 41/128 (32%), Gaps = 25/128 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           L       ++K+ T P  P VI +   +  L ++  N      L  E  +    G  G  
Sbjct: 84  LDHKAEKQIEKQATKPQGPVVIAVSIEQQKLRVYDANG-----LFAETPVST--GMRGH- 135

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GEC 147
                   P G + +   +    S  +    + +          T + + +H     G  
Sbjct: 136 ------STPMGVFSVIQKSKYHRSNIYSGAPMPY------MQRITWSGIALHAGALPGYP 183

Query: 148 ASAGCYAM 155
           AS GC  M
Sbjct: 184 ASHGCIRM 191


>gi|39936101|ref|NP_948377.1| hypothetical protein RPA3038 [Rhodopseudomonas palustris CGA009]
 gi|39649955|emb|CAE28479.1| ErfK/YbiS/YcfS/YnhG [Rhodopseudomonas palustris CGA009]
          Length = 537

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 41/128 (32%), Gaps = 25/128 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           L       ++K+ T P  P VI +   +  L ++  N      L  E  +    G  G  
Sbjct: 84  LDHKAEKQIEKQATKPQGPVVIAVSIEQQKLRVYDANG-----LFAETPVST--GMRGH- 135

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GEC 147
                   P G + +   +    S  +    + +          T + + +H     G  
Sbjct: 136 ------STPMGVFSVIQKSKYHRSNIYSGAPMPY------MQRITWSGIALHAGALPGYP 183

Query: 148 ASAGCYAM 155
           AS GC  M
Sbjct: 184 ASHGCIRM 191


>gi|297531502|ref|YP_003672777.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. C56-T3]
 gi|297254754|gb|ADI28200.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. C56-T3]
          Length = 165

 Score = 47.2 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 40/128 (31%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L +  R        ++ Y I                  P G + I   
Sbjct: 56  PYTIHISISRRQLTLKHRGRT-----IRTYPIGVGKMVTA---------TPVGDFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
             NP   +  ++ +        +    G    IHG           S GC  M+NK + E
Sbjct: 102 QPNPGGPF-GAMWLS------LSKIHYG----IHGTNDPSSIGKYVSKGCIRMHNKDVLE 150

Query: 163 IYAIVRDS 170
           + +IV + 
Sbjct: 151 LASIVPNG 158


>gi|295401784|ref|ZP_06811749.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976151|gb|EFG51764.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 111

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 41/130 (31%), Gaps = 35/130 (26%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I  N+  L+++  +      L+K Y I        P         P G Y I     N
Sbjct: 5   IDISTNKYQLKLYDGH-----RLIKVYPIAVGKM-LTP--------TPSGIYTIINKQRN 50

Query: 114 PNSKYF-LSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIY 164
           P   +  L + +           R    +  HG           S GC  M N  + E+ 
Sbjct: 51  PGGAFGVLWLGLS----------RPHYGI--HGTNNPSSIGKNVSRGCIRMYNHDVIELS 98

Query: 165 AIVRDSLRGN 174
           ++V    R  
Sbjct: 99  SMVPVGTRVY 108


>gi|328952431|ref|YP_004369765.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobacca acetoxidans DSM
           11109]
 gi|328452755|gb|AEB08584.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfobacca acetoxidans DSM
           11109]
          Length = 314

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 54/166 (32%), Gaps = 42/166 (25%)

Query: 26  IDKAEHPLSENLIISMQKKRTSPFHPTV-IRIFKNENILEIWKRNVDAEYVLLKEYKICA 84
            D    P+   +++        P HP   I +   E  L  +  N    +  +  Y I  
Sbjct: 80  WDPFLPPVGAEIVVPTTW--IVPDHPEHPIIVNTGEMRLYFFTDN----FTKVITYPIGM 133

Query: 85  WSGTFGPKIETGDEQAPEGFYYIGWNNLNP--------NSKYFLSINIGFP-NEFDK--- 132
                       D + P G + +     NP         +KY +S+    P N   K   
Sbjct: 134 GVL---------DFKTPTGVFKVTEKKTNPPWFVPKTLQAKYGMSVMESGPDNPLGKYKL 184

Query: 133 --AHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIVR 168
             +    G    IHG           S GC  M  + +++++ +V+
Sbjct: 185 TLSWGDYG----IHGTSQPFGVGRLVSHGCTRMYPEHIEKLFPLVK 226


>gi|311029721|ref|ZP_07707811.1| hypothetical protein Bm3-1_04054 [Bacillus sp. m3-13]
          Length = 166

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 40/128 (31%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I      L +         +++K Y I          +       P G Y I   
Sbjct: 56  PYSIEISITNRKLVL-----KGNGIIIKTYPIAVGRM-----LFE----TPVGNYVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
             NP   +  ++ +          ++    +  HG           S GC  M N+ + +
Sbjct: 102 QPNPGGPF-GAMWLS--------LSKLSYGI--HGTNDPSSIGKAVSRGCVRMYNQDVLQ 150

Query: 163 IYAIVRDS 170
           + ++V + 
Sbjct: 151 LASMVPNG 158


>gi|149180623|ref|ZP_01859127.1| hypothetical protein BSG1_16740 [Bacillus sp. SG-1]
 gi|148851776|gb|EDL65922.1| hypothetical protein BSG1_16740 [Bacillus sp. SG-1]
          Length = 165

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 37/121 (30%), Gaps = 33/121 (27%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I +  ++  L + +        ++K Y I                  P G Y I   
Sbjct: 56  PLSIHVSTSQRKLTLQRNGT-----VVKTYPIAVGKMLSA---------TPVGQYVIINK 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQE 162
             NP   +  ++ +        +    G    IHG           S GC  M N  ++E
Sbjct: 102 APNPGGPF-GTMWMS------LSKKHYG----IHGTNNPASIGKAVSKGCIRMYNSDVEE 150

Query: 163 I 163
           +
Sbjct: 151 L 151


>gi|316933731|ref|YP_004108713.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodopseudomonas palustris
           DX-1]
 gi|315601445|gb|ADU43980.1| ErfK/YbiS/YcfS/YnhG family protein [Rhodopseudomonas palustris
           DX-1]
          Length = 502

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 42/128 (32%), Gaps = 25/128 (19%)

Query: 33  LSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPK 92
           L   L   ++K+ + P  P VI +   +  L ++  N      L  E  +    G  G  
Sbjct: 82  LDHQLEKQIEKQASKPQGPVVIAVSIEQQKLRVYDANG-----LFAETPVST--GMRGH- 133

Query: 93  IETGDEQAPEGFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GEC 147
                   P G + +   N    S  +    + +          T + + +H     G  
Sbjct: 134 ------ATPLGVFSVIQKNKYHRSNIYSGAPMPY------MQRITWSGIALHAGALPGYP 181

Query: 148 ASAGCYAM 155
           AS GC  M
Sbjct: 182 ASHGCIRM 189


>gi|315646099|ref|ZP_07899219.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus vortex V453]
 gi|315278298|gb|EFU41614.1| ErfK/YbiS/YcfS/YnhG family protein [Paenibacillus vortex V453]
          Length = 146

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 46/133 (34%), Gaps = 32/133 (24%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
            I I K+ N L  +++       ++K + +                  PEG + I     
Sbjct: 20  FIVIDKSTNKLTYYEKG-----KVIKTFPVATGKKPS---------YTPEGLFKIHEKVK 65

Query: 113 NPNSKYFLSINIGFP-NEF-DKAHN---RTGADL----MIHGECAS--------AGCYAM 155
           N    Y   I  G P N   D+      +    +     IHG   S        AGC  M
Sbjct: 66  N-RPYYKEGIKGGDPRNPLGDRWLGINVKVNGRISYAYAIHGNNNSNSIGKYVSAGCIRM 124

Query: 156 NNKQMQEIYAIVR 168
           +NK ++ +Y  V+
Sbjct: 125 HNKDVRWLYDKVK 137


>gi|261855752|ref|YP_003263035.1| ErfK/YbiS/YcfS/YnhG family protein [Halothiobacillus neapolitanus
           c2]
 gi|261836221|gb|ACX95988.1| ErfK/YbiS/YcfS/YnhG family protein [Halothiobacillus neapolitanus
           c2]
          Length = 220

 Score = 46.8 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 62/210 (29%), Gaps = 59/210 (28%)

Query: 7   ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK-----KRTSPFHPTVIRIFKNEN 61
           +LL  L +F  G       ++ +   L  +++ + ++       +       I +  ++ 
Sbjct: 13  VLLAGLLLFTAGFGAQAQAMNPSTTVLPTSVVTAQKQVHSLLMNSGAGDAPFIIVDASDQ 72

Query: 62  ILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY--- 118
            L +++RN      L   + +   +   G     G  + P G + I     +        
Sbjct: 73  KLYLFERN-----QLKLNFSVSTSAVGVG--SAEGSNRTPLGLHRIAEKFGDGEPIGMIF 125

Query: 119 --------------------------------FLSINIGFPNEFDKAHNRTGADLMIHGE 146
                                            L   I      D +H R    + IHG 
Sbjct: 126 KARRPTGQLADIQTKPIKGDGDDVTTRIMWLQGLQPGINEGKGVD-SHAR---YIYIHGT 181

Query: 147 --------CASAGCYAMNNKQMQEIYAIVR 168
                     S GC  MNN Q+ E++  V 
Sbjct: 182 PEEGLIGRPESHGCIRMNNTQVIELFNQVP 211


>gi|186682714|ref|YP_001865910.1| ErfK/YbiS/YcfS/YnhG family protein [Nostoc punctiforme PCC 73102]
 gi|186465166|gb|ACC80967.1| ErfK/YbiS/YcfS/YnhG family protein [Nostoc punctiforme PCC 73102]
          Length = 182

 Score = 46.8 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 59/184 (32%), Gaps = 31/184 (16%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQ--KKRTSPFHPTVIRIFK 58
           +  +   L+  +  F  G          +   +++      +    + +  H   IR+ +
Sbjct: 3   LKTKILFLITIIVCFTEGFLSGYFKKLSSNKAITQQSQSPPKIPPSKNNTTHKISIRVKR 62

Query: 59  NENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKY 118
               + +++        +LK + I                + P G Y + +   NP  K 
Sbjct: 63  GARQVYVYQDK-----QVLKSFPIAIGKSG---------WETPLGNYQVIYMKKNPIFKN 108

Query: 119 FLSINIGFP---NEFDKA----HNRTGADLMIHGEC--------ASAGCYAMNNKQMQEI 163
           F + NI  P   N   K          + L  HG           S GC  M NK +  +
Sbjct: 109 FKTGNIIMPGANNPLGKRVIVFKIYKKSHLAFHGTNQDKLIGKAVSHGCIRMLNKDVIAL 168

Query: 164 YAIV 167
           Y +V
Sbjct: 169 YELV 172


>gi|307941572|ref|ZP_07656927.1| ErfK/YbiS/YcfS/YnhG family protein [Roseibium sp. TrichSKD4]
 gi|307775180|gb|EFO34386.1| ErfK/YbiS/YcfS/YnhG family protein [Roseibium sp. TrichSKD4]
          Length = 413

 Score = 46.8 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 51/165 (30%), Gaps = 31/165 (18%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLS-----ENLIISMQKKRTSPFHPTVIR 55
           MT+R+        + L     +      A  PL      ++          SP  P  + 
Sbjct: 1   MTSRFLRKTTGKLLLLGAVSLAFLAPAHA-APLPTLEEVKSKSEQKSDVAPSPNDPLHMV 59

Query: 56  IFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN 115
           +  +E  L +++        L++   I   SG  G          P G + I        
Sbjct: 60  VSLDEQKLSVYRGAN-----LVEVTPIS--SGKKGH-------STPTGVFSILEKRKRHF 105

Query: 116 SKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAM 155
           S  + +  + +          T + + +H     G  AS GC  +
Sbjct: 106 SNLYDNAPMPY------MQRLTWSGIALHEGRLPGYPASQGCVRL 144


>gi|295702406|ref|YP_003595481.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus megaterium DSM 319]
 gi|294800065|gb|ADF37131.1| ErfK/YbiS/YcfS/YnhG family protein [Bacillus megaterium DSM 319]
          Length = 177

 Score = 46.8 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 41/135 (30%), Gaps = 42/135 (31%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           + I K  N L  +         L K Y +                  P GF+ I     N
Sbjct: 37  LIINKKTNQLAYFHNG-----KLEKTYSVATGKTWSD---------TPVGFFKIVNKIKN 82

Query: 114 -PNSKYFLS------------INIGFPNEFDKAHNRTGADLMIHGECA--------SAGC 152
            P     ++            + +        A+  TG    IHG  +        S GC
Sbjct: 83  RPYYTGHIAGGASNNPLGSRWLGLN-------ANGTTGDTYAIHGNNSEDSIGKYVSHGC 135

Query: 153 YAMNNKQMQEIYAIV 167
             M+N  ++E++  V
Sbjct: 136 VRMHNADVEELFNKV 150


>gi|258514598|ref|YP_003190820.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257778303|gb|ACV62197.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 411

 Score = 46.8 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 44/129 (34%), Gaps = 33/129 (25%)

Query: 54  IRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLN 113
           I I K  N L  ++ N      L+K + +                  PEG + I    +N
Sbjct: 30  IIINKQNNKLAFYQNN-----QLVKIFPVATGREPS---------YTPEGSFKIINKIIN 75

Query: 114 PNSKYFLSINI--GFP-NEFDKAH---NRTGADLMIHGECA--------SAGCYAMNNKQ 159
           P   Y++ + I  G P N         N  G    IHG           S GC  M+N  
Sbjct: 76  P---YYIKLKIDGGAPDNPLGNRWMGLNAGGGTYGIHGNSNPASIGTYASGGCIRMSNND 132

Query: 160 MQEIYAIVR 168
           +  I+   R
Sbjct: 133 V--IWLYER 139


>gi|326202623|ref|ZP_08192491.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium papyrosolvens DSM
           2782]
 gi|325987207|gb|EGD48035.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium papyrosolvens DSM
           2782]
          Length = 213

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 62/179 (34%), Gaps = 37/179 (20%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV--------IRIFKNENILE 64
            + L   +H+ S+    +      L+  +   + +     +        I + K   +L 
Sbjct: 25  ALLLFQSNHNMSVTGTYDTATKNMLVQRLSSNKFAYLDNVIKAPTKGRWIAVNKTTRVLT 84

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN-SKYFLSIN 123
           +++        +LK+Y +   +     K          G Y +    ++P+      +  
Sbjct: 85  LYEGK-----KVLKKYAVAVGNPATLTKS---------GKYVVNCKLIDPDWGGGGFAKP 130

Query: 124 I--GFP-NEFDKAH---NRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVR 168
           +  G P N         NRT     IHG  +        S GC  M+N  ++E+Y +V 
Sbjct: 131 VRGGTPQNPLGTRWMGINRTDGSYGIHGTNSFYSIGKYISHGCMRMSNYCVEELYPLVP 189


>gi|169825867|ref|YP_001696025.1| spore protein ykuD-like protein [Lysinibacillus sphaericus C3-41]
 gi|168990355|gb|ACA37895.1| Spore protein ykuD-like protein [Lysinibacillus sphaericus C3-41]
          Length = 164

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 43/126 (34%), Gaps = 33/126 (26%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I      L +++ ++     L K+Y I                + P G + I   
Sbjct: 55  PYRIEISTENRWLRLYRNSI-----LQKQYPIAVGRML---------HETPVGSFIIINK 100

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
           + NP   +  ++ +        +    G    IHG           S GC  M N  ++E
Sbjct: 101 DPNPGGPF-GTMWMS------LSKEHYG----IHGTNDPSSIGHAVSHGCIRMQNPDVEE 149

Query: 163 IYAIVR 168
           + +IV 
Sbjct: 150 LASIVP 155


>gi|49087046|gb|AAT51409.1| PA0732 [synthetic construct]
          Length = 348

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 54/177 (30%), Gaps = 31/177 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK------KRTSPFHPTVI 54
           M     +LL A  +       +            +  + SM+          SP  P  I
Sbjct: 1   MKRSLAVLLLAFAVGSLHAAPASPANAPLPPADIKARLKSMKPGEYLWYPEVSPQGPVTI 60

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +   E    I++  +           I   + + G K        P G + I   +++ 
Sbjct: 61  VVSLTEQKAYIYRNGIA----------IGVSTLSSGKKGRE----TPTGVFSILQKSVDH 106

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAI 166
            S  + S  + +          T   + +H     G  AS GC  +     +++Y I
Sbjct: 107 KSDLYNSAPMPY------MQRLTWDGIALHAGNLPGYPASHGCIRLPMAFAKKLYGI 157


>gi|313105548|ref|ZP_07791816.1| hypothetical protein PA39016_000060021 [Pseudomonas aeruginosa
           39016]
 gi|310878318|gb|EFQ36912.1| hypothetical protein PA39016_000060021 [Pseudomonas aeruginosa
           39016]
          Length = 354

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 54/177 (30%), Gaps = 31/177 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK------KRTSPFHPTVI 54
           M     +LL A  +       +            +  + SM+          SP  P  I
Sbjct: 8   MKRSLAVLLLAFAVGSLHAAPASPANAPLPPADIKARLKSMKPGEYLWYPEVSPQGPVTI 67

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +   E    I++  +           I   + + G K        P G + I   +++ 
Sbjct: 68  VVSLTEQKAYIYRNGIA----------IGVSTLSSGKKGRE----TPTGVFSILQKSVDH 113

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAI 166
            S  + S  + +          T   + +H     G  AS GC  +     +++Y I
Sbjct: 114 KSDLYNSAPMPY------MQRLTWDGIALHAGNLPGYPASHGCIRLPMAFAKKLYGI 164


>gi|222099847|ref|YP_002534415.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga neapolitana DSM
           4359]
 gi|221572237|gb|ACM23049.1| ErfK/YbiS/YcfS/YnhG family protein [Thermotoga neapolitana DSM
           4359]
          Length = 375

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 48/159 (30%), Gaps = 39/159 (24%)

Query: 38  IISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGD 97
            +    +     +P  I +    + L ++        VLLK Y +               
Sbjct: 230 QVLKIGRVIFRENPVTIVVNLFSSKLGLYYDG-----VLLKVYPVALGRSDA-------- 276

Query: 98  EQAPEGFYYIGWNNLNPNSKYFL----------SINIGF-----PNEFDKAHNRTGADLM 142
              P G Y+I    ++P   +F            +   +     P       ++      
Sbjct: 277 --TPPGRYWILRKEIDPALYWFGEYISPRTPLNGLGTRYLQLSNPTYAIHGTSKP----W 330

Query: 143 IHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHIQI 181
             G+  S GC  M N+ ++E+     D+  G     I +
Sbjct: 331 EIGKRISHGCIRMFNRDVEEL-----DAFAGVGTEVIVV 364


>gi|239828519|ref|YP_002951143.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. WCH70]
 gi|239808812|gb|ACS25877.1| ErfK/YbiS/YcfS/YnhG family protein [Geobacillus sp. WCH70]
          Length = 165

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 39/128 (30%), Gaps = 33/128 (25%)

Query: 51  PTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWN 110
           P  I I  +   L +  R        ++ Y I                  P G + I   
Sbjct: 56  PYTIHISISRRQLTLKHRGRT-----IRTYPIGVGKMVTA---------TPVGDFVIVNR 101

Query: 111 NLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQE 162
             NP   +  ++ +        +    G    IHG           S GC  M+NK + E
Sbjct: 102 QPNPGGPF-GAMWLS------LSKVHYG----IHGTNDPSSIGKYVSKGCIRMHNKDVLE 150

Query: 163 IYAIVRDS 170
             +IV + 
Sbjct: 151 FASIVPNG 158


>gi|15595929|ref|NP_249423.1| hypothetical protein PA0732 [Pseudomonas aeruginosa PAO1]
 gi|107100190|ref|ZP_01364108.1| hypothetical protein PaerPA_01001213 [Pseudomonas aeruginosa PACS2]
 gi|218893325|ref|YP_002442194.1| hypothetical protein PLES_46131 [Pseudomonas aeruginosa LESB58]
 gi|254239094|ref|ZP_04932417.1| hypothetical protein PACG_05276 [Pseudomonas aeruginosa C3719]
 gi|254244987|ref|ZP_04938309.1| hypothetical protein PA2G_05866 [Pseudomonas aeruginosa 2192]
 gi|9946617|gb|AAG04121.1|AE004508_6 hypothetical protein PA0732 [Pseudomonas aeruginosa PAO1]
 gi|126171025|gb|EAZ56536.1| hypothetical protein PACG_05276 [Pseudomonas aeruginosa C3719]
 gi|126198365|gb|EAZ62428.1| hypothetical protein PA2G_05866 [Pseudomonas aeruginosa 2192]
 gi|218773553|emb|CAW29367.1| hypothetical protein PLES_46131 [Pseudomonas aeruginosa LESB58]
          Length = 347

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 54/177 (30%), Gaps = 31/177 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK------KRTSPFHPTVI 54
           M     +LL A  +       +            +  + SM+          SP  P  I
Sbjct: 1   MKRSLAVLLLAFAVGSLHAAPASPANAPLPPADIKARLKSMKPGEYLWYPEVSPQGPVTI 60

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +   E    I++  +           I   + + G K        P G + I   +++ 
Sbjct: 61  VVSLTEQKAYIYRNGIA----------IGVSTLSSGKKGRE----TPTGVFSILQKSVDH 106

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAI 166
            S  + S  + +          T   + +H     G  AS GC  +     +++Y I
Sbjct: 107 KSDLYNSAPMPY------MQRLTWDGIALHAGNLPGYPASHGCIRLPMAFAKKLYGI 157


>gi|220929989|ref|YP_002506898.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium cellulolyticum H10]
 gi|220000317|gb|ACL76918.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium cellulolyticum H10]
          Length = 307

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 59/179 (32%), Gaps = 37/179 (20%)

Query: 13  FIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTV--------IRIFKNENILE 64
            + L   +H+ S+    +      L+  +   +                + + K   +L 
Sbjct: 115 ALLLFQSNHNMSVTGAYDTATKNMLVQRLSSNKFVYLDKVTKAPTKGKWVTVNKTTRVLT 174

Query: 65  IWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPN-SKYFLSIN 123
           +++        +LK+Y +   +     K          G + +     NP+      +  
Sbjct: 175 LYEGT-----KVLKKYAVAVGNPASLTKS---------GKFIVTSKLKNPDWGGGGFADP 220

Query: 124 I--GFP-NEFDKAH---NRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVR 168
           +  G P N         NRT     IHG  +        S GC  M+N  ++E++ +V 
Sbjct: 221 VKGGTPQNPLGTRWLGINRTDGSYGIHGTNSFYSIGKYISHGCMRMSNHCVEELFPLVP 279


>gi|56750889|ref|YP_171590.1| hypothetical protein syc0880_c [Synechococcus elongatus PCC 6301]
 gi|56685848|dbj|BAD79070.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 208

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/190 (13%), Positives = 60/190 (31%), Gaps = 34/190 (17%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEH-----PLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
           LL+   + +  C  +  L            +    + +      +P   T + +   +  
Sbjct: 33  LLWNSSLLVACCAIASPLAAIPIPPPATMAVPAIPVEATIAPPPAPAPTTKLVLSLRQRR 92

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP--NSKYFL 120
           + +++  +      +  Y +    G  G        + P G + +    +NP     +  
Sbjct: 93  VTVYRDRLA-----IASYPV--GIGKPG-------WETPRGTFRVMSKIVNPTWQHPWNG 138

Query: 121 SINIGFPN-----EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           S+    PN      +          +  HG           S GC  M N+ ++ ++ +V
Sbjct: 139 SLVPPGPNNPLGDRWIGFWTDGKNSIGFHGTTAESLIGQAVSHGCVRMKNRDIRALFELV 198

Query: 168 RDSLRGNMQS 177
            +    ++Q 
Sbjct: 199 EEGAIVSVQP 208


>gi|116048645|ref|YP_792555.1| hypothetical protein PA14_54810 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115583866|gb|ABJ09881.1| hypothetical protein PA14_54810 [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 347

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 54/177 (30%), Gaps = 31/177 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK------KRTSPFHPTVI 54
           M     +LL A  +       +            +  + SM+          SP  P  I
Sbjct: 1   MKRSLAVLLLAFAVGSLHAAPASPANAPLPPADIKARLKSMKPGEYLWYPEVSPQGPVTI 60

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +   E    I++  +           I   + + G K        P G + I   +++ 
Sbjct: 61  VVSLTEQKAYIYRNGIA----------IGVSTLSSGKKGRE----TPTGVFSILQKSVDH 106

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAI 166
            S  + S  + +          T   + +H     G  AS GC  +     +++Y I
Sbjct: 107 KSDLYNSAPMPY------MQRLTWDGIALHAGNLPGYPASHGCIRLPMAFAKKLYGI 157


>gi|81299458|ref|YP_399666.1| hypothetical protein Synpcc7942_0647 [Synechococcus elongatus PCC
           7942]
 gi|81168339|gb|ABB56679.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 180

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/190 (12%), Positives = 60/190 (31%), Gaps = 34/190 (17%)

Query: 8   LLFALFIFLNGCHHSRSLIDKAEH-----PLSENLIISMQKKRTSPFHPTVIRIFKNENI 62
           LL+   + +  C  +  +            +    + +      +P   T + +   +  
Sbjct: 5   LLWNSSLLVACCAIASPVAAIPIPPPATMAVPAIPVEATIAPPPAPAPTTKLVLSLRQRR 64

Query: 63  LEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP--NSKYFL 120
           + +++  +      +  Y +    G  G        + P G + +    +NP     +  
Sbjct: 65  VTVYRDRLA-----IASYPV--GIGKPG-------WETPRGTFRVMSKIVNPTWQHPWNG 110

Query: 121 SINIGFPN-----EFDKAHNRTGADLMIHGEC--------ASAGCYAMNNKQMQEIYAIV 167
           S+    PN      +          +  HG           S GC  M N+ ++ ++ +V
Sbjct: 111 SLVPPGPNNPLGDRWIGFWTDGKNSIGFHGTTAESLIGQAVSHGCVRMKNRDIRALFELV 170

Query: 168 RDSLRGNMQS 177
            +    ++Q 
Sbjct: 171 EEGAIVSVQP 180


>gi|255527321|ref|ZP_05394199.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium carboxidivorans P7]
 gi|296184916|ref|ZP_06853327.1| ErfK/YbiS/YcfS/YnhG [Clostridium carboxidivorans P7]
 gi|255508968|gb|EET85330.1| ErfK/YbiS/YcfS/YnhG family protein [Clostridium carboxidivorans P7]
 gi|296050698|gb|EFG90121.1| ErfK/YbiS/YcfS/YnhG [Clostridium carboxidivorans P7]
          Length = 233

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 42/127 (33%), Gaps = 24/127 (18%)

Query: 48  PFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYI 107
           P    +I +  + N L ++K  +       K Y++ +            D  +P G + I
Sbjct: 40  PKSNYIIVVDVSSNNLIVFKDGIQ-----FKSYQVASGKY---------DTPSPLGTWKI 85

Query: 108 GWNNLNPNSKYFLSINIGFPNEFDKAHNRTG-ADLMIHGE---CASAGCYAMNNKQMQEI 163
              +          +    P        + G    +  G     +S GC  M N ++ E+
Sbjct: 86  VSKDNWGEGFGGYWMGFNVP------WGKYGIHGTLFPGSIGWNSSHGCIRMKNSEVAEL 139

Query: 164 YAIVRDS 170
           Y I+   
Sbjct: 140 YKIIPYG 146


>gi|296390924|ref|ZP_06880399.1| hypothetical protein PaerPAb_22335 [Pseudomonas aeruginosa PAb1]
          Length = 347

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 29/177 (16%), Positives = 54/177 (30%), Gaps = 31/177 (17%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQK------KRTSPFHPTVI 54
           M     +LL A  +       +            +  + SM+          SP  P  I
Sbjct: 1   MKRSLAVLLLAFAVGSLHAAPASPANAPLPPADIKARLKSMKPGEYLWYPEVSPQGPVTI 60

Query: 55  RIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNP 114
            +   E    I++  +           I   + + G K        P G + I   +++ 
Sbjct: 61  VVSLTEQKAYIYRNGIA----------IGVSTLSSGKKGRE----TPTGVFSILQKSVDH 106

Query: 115 NSKYFLSINIGFPNEFDKAHNRTGADLMIH-----GECASAGCYAMNNKQMQEIYAI 166
            S  + S  + +          T   + +H     G  AS GC  +     +++Y I
Sbjct: 107 KSDLYNSAPMPY------MQRLTWDGIALHAGNLPGYPASHGCIRLPMAFAKKLYGI 157


>gi|34498927|ref|NP_903142.1| hypothetical protein CV_3472 [Chromobacterium violaceum ATCC 12472]
 gi|34104776|gb|AAQ61133.1| hypothetical protein CV_3472 [Chromobacterium violaceum ATCC 12472]
          Length = 208

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 69/213 (32%), Gaps = 57/213 (26%)

Query: 1   MTNRYNILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNE 60
           M  ++ +LL  L           +L+ +A+            +       P V    K++
Sbjct: 1   MRAKFAVLLACLVQPCLAAVDDAALVLQAQTDGPLQATHPNARH---YGAPWVWVGVKSQ 57

Query: 61  --NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIG---------- 108
              +L+ W         + KE+ +       G    +G  Q P G++ +           
Sbjct: 58  TLRLLDDWG-------RIQKEFTVSTAKNGVGE--TSGSYQTPRGWHAVCEKLGAGAEAN 108

Query: 109 ----WNNLNPNSKYFLSINIGFPNEFDKAHNR------------TGAD-------LMIHG 145
                  + P  KY   +++ +PN+ D    R             G +       + IHG
Sbjct: 109 TIIFRRQVTPW-KYTPELHVQYPNK-DWILTRILWLCGQEPGLNQGGNVDSYDRAIYIHG 166

Query: 146 E--------CASAGCYAMNNKQMQEIYAIVRDS 170
                     +S GC  M N+ + E++  V + 
Sbjct: 167 AGDHVPWGRPSSLGCVRMKNRDVIELFDAVPNG 199


>gi|323701941|ref|ZP_08113610.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533027|gb|EGB22897.1| ErfK/YbiS/YcfS/YnhG family protein [Desulfotomaculum nigrificans
           DSM 574]
          Length = 314

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 47/156 (30%), Gaps = 39/156 (25%)

Query: 24  SLIDKAEHPLSENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKIC 83
            +  + E P++++  +        P     + I   +  L +            K++ I 
Sbjct: 106 QMARQIELPVTKSETLP------PPTGQIALIIDTTKRKLTVMADG-----KPYKQFNIA 154

Query: 84  AWSGTFGPKIETGDEQAPEGFYYIGWNNLNP-NSKYFLSINIGFPNEFDKAHNRTGADLM 142
                  P        +P G + +    +N  +      + +  P          G    
Sbjct: 155 CG-APETP--------SPVGSWQVAHKAINWGDGFGTRWLGLNVP------WGIYG---- 195

Query: 143 IHGECA--------SAGCYAMNNKQMQEIYAIVRDS 170
           IHG           S GC  M+N  ++E+Y  V   
Sbjct: 196 IHGTNKPFSIGTYASHGCIRMHNSSVEELYPWVPKG 231


>gi|307293274|ref|ZP_07573120.1| ErfK/YbiS/YcfS/YnhG family protein [Sphingobium chlorophenolicum
           L-1]
 gi|306881340|gb|EFN12556.1| ErfK/YbiS/YcfS/YnhG family protein [Sphingobium chlorophenolicum
           L-1]
          Length = 362

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 57/186 (30%), Gaps = 35/186 (18%)

Query: 18  GCHHSRSLIDKAEHPLSENLI------ISMQKKRTSPFHPTV--IRIFKNENILEIWKRN 69
           G   +  +   A  P++            +     +   P    I + K++ +L ++   
Sbjct: 186 GAGATIRVPAIANQPVARIEGDERGWGAMLASLGVAKDQPQADHIVVDKSDGVLRVY--- 242

Query: 70  VDAEYVLLKEYKICAWSG----TFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFLSINIG 125
            DA+  L+ ++     S       G     G  + P+  Y         +S     +  G
Sbjct: 243 -DAQNRLIAQFPATMGSQHDPLPIGTWEIKGLSRNPDFHYNPDLFWDASSSDQKAVLKPG 301

Query: 126 FPNE------FDKAHNRTGADLMIHGECA--------SAGCYAMNNKQMQEIYAIVRDSL 171
            PN        D +    G    IHG           S GC  + N     +  +V+  +
Sbjct: 302 -PNGPVGVVWIDLSKPHYG----IHGTPEPQTIGRAESHGCIRLTNWDAARLAQMVQSGV 356

Query: 172 RGNMQS 177
           +   Q 
Sbjct: 357 KAVFQP 362


>gi|302872405|ref|YP_003841041.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575264|gb|ADL43055.1| ErfK/YbiS/YcfS/YnhG family protein [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 223

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 54/169 (31%), Gaps = 41/169 (24%)

Query: 52  TVIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNN 111
            +I +  +++ L ++K  +     L K Y I        P         P G + I   +
Sbjct: 34  YLIYVSIDDSRLYVFKEGI-----LYKSYPISPGK-PSTP--------TPVGTFKIISKD 79

Query: 112 LNPNSKYFLSINIGFPNEFDKAHNRTGADLMIHGE--------CASAGCYAMNNKQMQEI 163
                     + +         + + G    IHG           S GC  M NK ++E+
Sbjct: 80  YWGEGFGGRWMGLN------VVYGKYG----IHGTIYENYIGAHVSKGCVRMLNKDVKEL 129

Query: 164 YAI--------VRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSF 204
           ++         + + + G  ++  +   +P       M + +      F
Sbjct: 130 FSYISVGTTVVISEGIYGEFRNGFRT-IYPGDTGEDVMAVQRRLKKLGF 177


>gi|78224173|ref|YP_385920.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
 gi|78195428|gb|ABB33195.1| ErfK/YbiS/YcfS/YnhG [Geobacter metallireducens GS-15]
          Length = 300

 Score = 46.4 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 39/127 (30%), Gaps = 30/127 (23%)

Query: 61  NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYFL 120
           + L ++         ++  + +   S         G ++ P G Y +     NP     L
Sbjct: 110 SELRLYFVPEGGTPRIV-SFPVGTGS--------EG-KETPLGVYRVTEKRANPAWHVPL 159

Query: 121 SI-------NIGFPNEFDKAHNR-----TGADLMIHGE--------CASAGCYAMNNKQM 160
           SI           P   D          T   LMIHG           S GC  +  + +
Sbjct: 160 SIRQERPRLPAVVPPGPDNPLGSHALRLTDDGLMIHGTNRPWGVGRNVSHGCIRLYPEDI 219

Query: 161 QEIYAIV 167
             ++ +V
Sbjct: 220 PVLFRLV 226


>gi|74317235|ref|YP_314975.1| hypothetical protein Tbd_1217 [Thiobacillus denitrificans ATCC
           25259]
 gi|74056730|gb|AAZ97170.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 164

 Score = 46.4 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 49/156 (31%), Gaps = 44/156 (28%)

Query: 53  VIRIFKNENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNL 112
           VI +      L +W+R  D +  L++EY +   +   G   ++G    P G + +     
Sbjct: 5   VIDVDIARQRLYLWERFPDGDM-LIREYPVSTAANGAGE--QSGSYCTPRGRHRVAQKI- 60

Query: 113 NPNSKYFLSI------------NIGFPNE---FDKAH---------NRT-GA-------D 140
              +  + +              +   N    +