RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780590|ref|YP_003065003.1| hypothetical protein CLIBASIA_02385 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|172503 PRK14002, PRK14002, potassium-transporting ATPase subunit C; Provisional. Length = 186 Score = 30.8 bits (70), Expect = 0.069 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 39 AEGIEPEIIANAAITQAIR-ETVRIHGEEKMESLLKSLMSRMLAGEFSPERV 89 G++P I AA Q R R EEK++ L+ + + L G F E+V Sbjct: 122 GSGLDPNISPQAAYVQVKRVAKARGMSEEKVKQLVDQHVEKPLLGMFGTEKV 173 >gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase. Characterized members of this protein family are L-lysine 6-transaminase, also called lysine epsilon-aminotransferase (LAT). The immediate product of the reaction of this enzyme on lysine, 2-aminoadipate 6-semialdehyde, becomes 1-piperideine 6-carboxylate, or P6C. This product may be converted subsequently to pipecolate or alpha-aminoadipate, lysine catabolites that may be precursors of certain seconary metabolites. Length = 431 Score = 28.6 bits (64), Expect = 0.41 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 2 ESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQ 54 E +R++ E DALL+ +++Q + AWA G++P+I+A TQ Sbjct: 239 EFLRAMRALCDEHDALLIFDEVQTGVGLTGTAWAY-QQLGVQPDIVAFGKKTQ 290 >gnl|CDD|162005 TIGR00707, argD, acetylornithine and succinylornithine aminotransferases. Members of this family may also act on ornithine, like ornithine aminotransferase (EC 2.6.1.13) (see MEDLINE:90337349) and on succinyldiaminopimelate, like N-succinyldiaminopmelate-aminotransferase (EC 2.6.1.17, DapC, an enzyme of lysine biosynthesis) (see MEDLINE:99175097). Length = 379 Score = 28.1 bits (63), Expect = 0.51 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query: 2 ESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANA 50 E ++++ + ++ DALL+ +++Q I + +A GIEP+II A Sbjct: 191 EFLKALREICKDKDALLIFDEVQTGIGRTGKFFAY-EHYGIEPDIITLA 238 >gnl|CDD|179861 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional. Length = 572 Score = 27.6 bits (61), Expect = 0.67 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 10/71 (14%) Query: 9 KKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQA-IRETVRIHGEEK 67 ++T F A L H +++A E+ NE E ++ IT A +R+ + +E+ Sbjct: 193 RQTLLFSATLSHRVLELAYEHMNEP---------EKLVVETETITAARVRQRIYFPADEE 243 Query: 68 MESLLKSLMSR 78 ++LL L+SR Sbjct: 244 KQTLLLGLLSR 254 >gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (Pfam:PF00072) and an associated transcriptional regulatory region (Pfam:PF00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. Length = 218 Score = 25.5 bits (56), Expect = 3.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Query: 55 AIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVI 90 R +RI K LL LM R GE P VI Sbjct: 139 VSRGNIRITLTRKEFQLLWLLMRR--TGEVLPRTVI 172 >gnl|CDD|181363 PRK08297, PRK08297, L-lysine aminotransferase; Provisional. Length = 443 Score = 24.9 bits (55), Expect = 4.8 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 2 ESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQ 54 E ++ + E DALL+ +++Q + AWA G+ P+I+A TQ Sbjct: 246 EFFAAMRELCDEHDALLIFDEVQTGVGLTGTAWAY-QQLGVRPDIVAFGKKTQ 297 >gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional. Length = 244 Score = 25.0 bits (55), Expect = 4.9 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Query: 41 GIEPEIIANAAITQAIRETV--RIHG-EEKMESL 71 G+ PE I AAIT A R + R HG +E+M+ L Sbjct: 163 GLNPEFIGPAAITLAHRYNLDSRDHGKKERMKQL 196 >gnl|CDD|179808 PRK04282, PRK04282, exosome complex RNA-binding protein Rrp42; Provisional. Length = 271 Score = 24.8 bits (55), Expect = 5.6 Identities = 8/28 (28%), Positives = 12/28 (42%) Query: 42 IEPEIIANAAITQAIRETVRIHGEEKME 69 +E E + +A IT E I +K Sbjct: 211 LEEESVMDARITITTDEDGNIVAIQKSG 238 >gnl|CDD|178579 PLN03002, PLN03002, oxidoreductase, 2OG-Fe(II) oxygenase family protein. Length = 332 Score = 24.7 bits (53), Expect = 6.5 Identities = 12/44 (27%), Positives = 26/44 (59%) Query: 2 ESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPE 45 E + V +++++F AL L EKM+V ++ + + E ++P+ Sbjct: 52 EFMDDVFEQSKKFFALPLEEKMKVLRNEKHRGYTPVLDEKLDPK 95 >gnl|CDD|149870 pfam08936, CsoSCA, Carboxysome Shell Carbonic Anhydrase. Carboxysome Shell Carbonic Anhydrase is a bacterial carbonic anhydrase localized in the carboxysome, where it converts bicarbonate ions to carbon dioxide for use in carbon fixation. It contains three domains, these being: (1) an N-terminal domain composed primarily of four alpha-helices; (2) a catalytic domain containing a tightly bound zinc ion and (3) a C-terminal domain with weak structural similarity to the catalytic domain. Length = 459 Score = 24.1 bits (53), Expect = 7.3 Identities = 9/38 (23%), Positives = 17/38 (44%) Query: 48 ANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFS 85 A AAI +A+ G + ++ ++R+L S Sbjct: 285 ARAAIAEAVAADGWAQGPGAPDPGMRRFIARLLENNLS 322 >gnl|CDD|182863 PRK10954, PRK10954, periplasmic protein disulfide isomerase I; Provisional. Length = 207 Score = 24.3 bits (53), Expect = 7.4 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 32 EAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEE 66 +AWA MA G+E ++ + + +++T I Sbjct: 92 QAWAVAMALGVEDKV--TPPLFEGVQKTQTIQSAA 124 >gnl|CDD|130391 TIGR01324, cysta_beta_ly_B, cystathionine beta-lyase, bacterial. This model represents cystathionine beta-lyase (alternate name: beta-cystathionase), one of several pyridoxal-dependent enzymes of cysteine, methionine, and homocysteine metabolism. This enzyme is involved in the biosynthesis of Met from Cys. Length = 377 Score = 24.5 bits (53), Expect = 7.5 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 6 SVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEP 44 S + T+ F ++L ++M V I Y + E +A I+P Sbjct: 97 SAYEPTRYFCDIVL-KRMGVDITYYDPLIGEDIATLIQP 134 >gnl|CDD|162317 TIGR01357, aroB, 3-dehydroquinate synthase. This model represents 3-dehydroquinate synthase, the enzyme catalyzing the second of seven steps in the shikimate pathway of chorismate biosynthesis. Chorismate is the last common intermediate in the biosynthesis of all three aromatic amino acids. Length = 344 Score = 24.1 bits (53), Expect = 7.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 34 WAEGMAEGIEPEIIANAAITQAIRE 58 GMAE I+ +IA+A + + Sbjct: 164 LRSGMAEVIKHGLIADAELFDELES 188 >gnl|CDD|128971 smart00732, YqgFc, Likely ribonuclease with RNase H fold. YqgF proteins are likely to function as an alternative to RuvC in most bacteria, and could be the principal holliday junction resolvases in low-GC Gram-positive bacteria. In Spt6p orthologues, the catalytic residues are substituted indicating that they lack enzymatic functions. Length = 99 Score = 24.1 bits (53), Expect = 8.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Query: 9 KKTQEFDALLLHEKMQVAIEYQNEAWA 35 ++T+E A LL E+ + + +E A Sbjct: 69 RETEEAFAELLKERFNLPVVLVDERLA 95 >gnl|CDD|178358 PLN02758, PLN02758, oxidoreductase, 2OG-Fe(II) oxygenase family protein. Length = 361 Score = 24.0 bits (52), Expect = 9.7 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 15/64 (23%) Query: 1 MESIRSVEKKTQEFDALLLHEKMQVAI---------------EYQNEAWAEGMAEGIEPE 45 +E + +EK +EF L L EK + + E Q W A G+EP Sbjct: 95 LELLEEIEKVAREFFMLPLEEKQKYPMAPGTVQGYGQAFVFSEDQKLDWCNMFALGVEPH 154 Query: 46 IIAN 49 I N Sbjct: 155 FIRN 158 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.127 0.333 Gapped Lambda K H 0.267 0.0836 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,440,287 Number of extensions: 77966 Number of successful extensions: 163 Number of sequences better than 10.0: 1 Number of HSP's gapped: 163 Number of HSP's successfully gapped: 33 Length of query: 91 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 32 Effective length of database: 4,719,601 Effective search space: 151027232 Effective search space used: 151027232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (22.8 bits)