RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780590|ref|YP_003065003.1| hypothetical protein CLIBASIA_02385 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} (A:113-319) Length = 207 Score = 25.2 bits (54), Expect = 3.5 Identities = 9/49 (18%), Positives = 19/49 (38%) Query: 2 ESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANA 50 + ++ D L + +++ E +A G+ P+II A Sbjct: 130 GYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKVFGVVPDIITFA 178 >2ija_A Arylamine N-acetyltransferase 1; arylamide acetylase 1, structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} PDB: 2pqt_A* 2pfr_A* (A:) Length = 295 Score = 24.6 bits (53), Expect = 4.6 Identities = 7/50 (14%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Query: 6 SVEKKTQEFDAL-LLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQ 54 + + + L + + A+ ++N G A + E I + + + Sbjct: 18 KKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAXDLGLEAIFDQVVRR 67 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.313 0.127 0.333 Gapped Lambda K H 0.267 0.0480 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 620,263 Number of extensions: 23188 Number of successful extensions: 60 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 10 Length of query: 91 Length of database: 4,956,049 Length adjustment: 52 Effective length of query: 39 Effective length of database: 3,198,189 Effective search space: 124729371 Effective search space used: 124729371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.6 bits)