RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780593|ref|YP_003065006.1| undecaprenyl pyrophosphate phosphatase [Candidatus Liberibacter asiaticus str. psy62] (266 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 27.4 bits (61), Expect = 2.0 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 227 ITSLLVIRSLFQVIAKRGYT 246 + ++ I SL +V+ RG T Sbjct: 2 LADVMSIESLVEVVFYRGMT 21 >3knz_A Putative sugar binding protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.50A {Salmonella enterica subsp} (A:34-182) Length = 149 Score = 26.9 bits (59), Expect = 2.5 Identities = 5/35 (14%), Positives = 14/35 (40%) Query: 209 VIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKR 243 ++ G+E + ++L + L +A + Sbjct: 112 ILTVPCGEETAGAKTKGYHCTVLNLXLLALAVAGQ 146 >2aml_A SIS domain protein; 46906266, LMO0035 protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes str} (A:27-183) Length = 157 Score = 27.1 bits (59), Expect = 2.8 Identities = 6/35 (17%), Positives = 12/35 (34%) Query: 209 VIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKR 243 + GKE + F ++L + A + Sbjct: 120 TLDIGSGKERVGYVTKGFTATVLTLXLTGLHFAYK 154 >1moq_A Glucosamine 6-phosphate synthase; glutamine amidotransferase; HET: GLP MES; 1.57A {Escherichia coli} (A:1-210) Length = 210 Score = 25.6 bits (55), Expect = 6.7 Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 210 IVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKR 243 ++ N G EI + +F T L V+ L +++ Sbjct: 149 LMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRL 182 >2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* (A:1-216) Length = 216 Score = 25.6 bits (55), Expect = 8.0 Identities = 12/80 (15%), Positives = 24/80 (30%), Gaps = 5/80 (6%) Query: 164 SRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFM 223 S+SG T + L K A + D + N G EI + Sbjct: 115 SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINA-----GPEIGVAST 169 Query: 224 ASFITSLLVIRSLFQVIAKR 243 ++ + + + ++ Sbjct: 170 KAYTSQFVSLVMFALMMCDD 189 >2poc_A D-fructose-6-, isomerase domain of glutamine-fructose-6- phosphate transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans SC5314} PDB: 2put_A* 2puv_A* 2puw_A* (A:1-206) Length = 206 Score = 25.2 bits (54), Expect = 8.2 Identities = 4/35 (11%), Positives = 13/35 (37%) Query: 209 VIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKR 243 + N G EI + ++ + + + ++ Sbjct: 145 GVHINAGPEIGVASTKAYTSQYIALVMFALSLSND 179 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.335 0.151 0.445 Gapped Lambda K H 0.267 0.0537 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,007,214 Number of extensions: 86884 Number of successful extensions: 282 Number of sequences better than 10.0: 1 Number of HSP's gapped: 281 Number of HSP's successfully gapped: 22 Length of query: 266 Length of database: 4,956,049 Length adjustment: 87 Effective length of query: 179 Effective length of database: 2,015,014 Effective search space: 360687506 Effective search space used: 360687506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 54 (25.0 bits)