>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait. Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury.

Probab=98.08 E-value=2.7e-05 Score=49.66 Aligned_cols=64 Identities=5% Similarity=0.007 Sum_probs=50.1 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC--C----CHHHCHHHHHHHHHHH Q ss_conf 99999999985565453479842667502899999999999996189--9----9456768899999997 Q gi|254780594|r 140 IARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGE--I----DWDTAPIVKEWYQRMK 203 (230) Q Consensus 140 ~~~~~l~~~l~~le~~l~~~~fl~Gd~~s~ADi~~~~~l~~~~~~~~--~----~~~~~p~l~~w~~r~~ 203 (230) T Consensus 57 evy~~a~~~l~aLS~~Lg~~~yffGd~Pt~lDA~vfg~la~il~~~lp~~~L~~~l~~~~NLv~fc~Ri~ 126 (126) T cd03211 57 QVIEEVDQCCQALSQRLGTQPYFFGDQPTELDALVFGHLFTILTTQLPNDELAEKVKKYSNLLAFCRRIE 126 (126) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHCC T ss_conf 9999999999999999777970579996099999999999998536998089999997866999997659

HHsearch alignment for GI: 254780594 and conserved domain: cd03211