>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit; InterPro: IPR006005 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate. 2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. This describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form of the NADPH-dependent or NADH-dependent glutamate synthase (1.4.1.13 from EC and 1.4.1.14 from EC respectively) small subunit. There is no corresponding large subunit. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.

Probab=96.10 E-value=0.043 Score=31.48 Aligned_cols=80 Identities=16% Similarity=0.092 Sum_probs=55.5 Q ss_pred EEEEECCCHHHHHHHHHHHHCCCEEEEEECC----------------------HHHHHHHHHCCCEEE----EC--CC-- Q ss_conf 3999888888999999999889889999679----------------------446345564498289----80--67-- Q gi|254780595|r 2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRS----------------------VSNLLTLKHKGISPF----LF--AD-- 51 (289) Q Consensus 2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~----------------------~~~~~~l~~~~~~~~----~~--~~-- 51 (289) T Consensus 153 kVAVVGSGPAGLAaA~qLnrAGH~VTVfER~DR~GGLL~YGIPnmKLdK~e~v~RRi~~l~aEG~~FvtnteiGdWdens 232 (517) T TIGR01317 153 KVAVVGSGPAGLAAADQLNRAGHTVTVFEREDRVGGLLRYGIPNMKLDKEEIVDRRIDLLEAEGVDFVTNTEIGDWDENS 232 (517) T ss_pred EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC T ss_conf 68997567579999999853588389974367888630248887433738899999999874784201783004653444 Q ss_pred -----CCCCHHHHHHHCCCCEEEEEECCCCCCCEE Q ss_conf -----864023465411563278761244433100 Q gi|254780595|r 52 -----QKINNLLREKLYFTTHIVQCIKPSSEGDPC 81 (289) Q Consensus 52 -----~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~ 81 (289) T Consensus 233 kitnlsk~di~~~~L~~~fDAVVLa~Ga~~pRDLp 267 (517) T TIGR01317 233 KITNLSKKDISADELKEDFDAVVLATGATKPRDLP 267 (517) T ss_pred CEECCCCCCCCHHHHHHHCCEEEEECCCCCCCCCC T ss_conf 20002234268799871469389833788601035

HHsearch alignment for GI: 254780595 and conserved domain: TIGR01317