>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=96.50 E-value=0.0061 Score=36.29 Aligned_cols=72 Identities=15% Similarity=0.020 Sum_probs=39.1 Q ss_pred CEEEEECC-CHHHHHHHHHHHHCCC-----E--EEEEECCH--HHHH----HHHHCCCEEEECCCCCCCHHHHHHHCCCC Q ss_conf 93999888-8889999999998898-----8--99996794--4634----55644982898067864023465411563 Q gi|254780595|r 1 MHLMIFGA-GYTGKFIADAALKVGV-----Y--TCGTTRSV--SNLL----TLKHKGISPFLFADQKINNLLREKLYFTT 66 (289) Q Consensus 1 MkIlI~Ga-G~iG~~l~~~L~~~g~-----~--V~~~~r~~--~~~~----~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 66 (289) T Consensus 1 ~KV~IiGA~G~IG~~la~~l~~~~l~g~~~~i~l~L~Di~~~~~~~~G~~mdl~~~a-~~~-~~~v~~~~~~~~~~~~aD 78 (323) T cd00704 1 LHVLITGAAGQIGYNLLFLIASGELFGDDQPVILHLLDIPPAMKALEGVVMELQDCA-FPL-LKGVVITTDPEEAFKDVD 78 (323) T ss_pred CEEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCC-CCC-CCCEEECCCHHHHHCCCC T ss_conf 989998999789999999997286369986008999758886555314878665346-655-587484288589837998 Q ss_pred EEEEEECC Q ss_conf 27876124 Q gi|254780595|r 67 HIVQCIKP 74 (289) Q Consensus 67 ~v~~~~~~ 74 (289) T Consensus 79 vViitaG~ 86 (323) T cd00704 79 VAILVGAF 86 (323) T ss_pred EEEECCCC T ss_conf 89982787

HHsearch alignment for GI: 254780595 and conserved domain: cd00704