HHsearch alignment for GI: 254780598 and conserved domain: COG3047

>COG3047 OmpW Outer membrane protein W [Cell envelope biogenesis, outer membrane].
Probab=99.04  E-value=1.8e-08  Score=61.32  Aligned_cols=130  Identities=14%  Similarity=0.104  Sum_probs=83.0

Q ss_pred             CCCCCEEEEEEEEEEECCCEEEEEEEEEEEC--CCCCCC----CCCCCCCEEEEEEEEEEEE---ECCCEEEEEEEEEEE
Q ss_conf             7776026899854640483799845101321--555666----6212232148999897543---127677898854477
Q gi|254780598|r   72 AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT--VPVLAD----NIHSLHGIGGSLRIRGGYE---VSDSLLLYATVGPDV  142 (205)
Q Consensus        72 ~~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~--~~~~~~----~~~~~~~~~~~~~~r~Gy~---~~~~~l~Y~~~G~a~  142 (205)
T Consensus        54 v~~~~~pgL~~TY~ftdN---i~vEli~~t~~~h~~g~~~~~~~g~i~~~~~lPpTlt~Qyhf~~~~s~frPYvGaG~nY  130 (213)
T COG3047          54 VSNNTQPGLTFTYFFTDN---IGVELIAATPFAHKIGVGGLGGLGKIGKTKHLPPTLTAQYHFGDASSKFRPYVGAGLNY  130 (213)
T ss_pred             ECCCCCCCEEEEEEEECC---EEEEEEEECCCCEEECCCCCCCCCCCCCEEEECCEEEEEEECCCCCCCCCCCEEECCCE
T ss_conf             736764433689997377---24677861340203055676555311417880868899973168655544214503334


Q ss_pred             EEEEECCCC-----CCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCC----------------CCCCCEEEEEEE
Q ss_conf             644431345-----55677520479973466100488679999999975056----------------556622699999
Q gi|254780598|r  143 AQKYETGKA-----GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGFYNTISLGV  201 (205)
Q Consensus       143 ~~~~~~~~~-----~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~----------------~~~~~~~~~~G~  201 (205)
T Consensus       131 t~f~~e~~~~~~~~~lkl~ns~G~a~q~G~Dy-~l~~~w~ln~dV~~~~i~t~a~~~~~~g~~~~~~kvkLdPwv~~~Gi  209 (213)
T COG3047         131 TTFFDEKFGSTGLSDLKLKDSWGAAGQAGVDY-MLNDDWLLNMDVKYMFIDTTAKYKAGLGGAKLKSKVKLDPWVFMIGI  209 (213)
T ss_pred             EEEEEECCCCCCCCEEEECCCCCEEEEEEEEE-EECCCEEEEEEEEEEECCCCEEECCCCCCCEEECCEECCCEEEEEEE
T ss_conf             89985014777754045135546116854558-90456188778899961554034246677505410341764999532


Q ss_pred             EEEC
Q ss_conf             8539
Q gi|254780598|r  202 GMKF  205 (205)
Q Consensus       202 ~ykF  205 (205)
T Consensus       210 gyRF  213 (213)
T COG3047         210 GYRF  213 (213)
T ss_pred             EECC
T ss_conf             6619