HHsearch alignment for GI: 254780598 and conserved domain: COG3203

>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane].
Probab=96.91  E-value=0.019  Score=30.39  Aligned_cols=28  Identities=29%  Similarity=0.362  Sum_probs=16.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             944378999999999841000024665435
Q gi|254780598|r    1 MQKLFLAVGVSSLALASFCSAQAADPVRRA   30 (205)
Q Consensus         1 Mkk~~la~av~~lal~~~~~A~Aad~~~~~   30 (205)
T Consensus         1 ~~~~~~a~~~~a--~~aA~a~saatlYg~~   28 (354)
T COG3203           1 MKRKILALAVPA--LLAAGAANAAELYGKD   28 (354)
T ss_pred             CCHHHHHHHHHH--HHHHHHHHEEEEECCC
T ss_conf             905689999987--6765322058995314