HHsearch alignment for GI: 254780598 and conserved domain: PRK09408

>PRK09408 ompX outer membrane protein X; Provisional.
Probab=99.86  E-value=2.6e-20  Score=122.14  Aligned_cols=169  Identities=20%  Similarity=0.222  Sum_probs=121.4

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             94437899999999984100002466543566666555634554444441154210001223333446677777602689
Q gi|254780598|r    1 MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSI   80 (205)
Q Consensus         1 Mkk~~la~av~~lal~~~~~A~Aad~~~~~~~~~~~~~~~~~~~~~~~~~~~w~G~y~g~~~g~~~~~~~~~~~~~~~G~   80 (205)
T Consensus         1 mkk~~~~s~~~~~~~~~a~~a~A~~sT-------------------------vS~-------GYAQs~~~~~~n-~l~G~   47 (171)
T PRK09408          1 MKKIACLSALAAVLAFTAGTAVAATST-------------------------VTG-------GYAQSDAQGVAN-KMGGF   47 (171)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCE-------------------------EEE-------EEEEECCCCCCC-CCCCE
T ss_conf             922478999999988566666425766-------------------------987-------886420013467-86744


Q ss_pred             EEEEEEECCCEEEEEEEEEEECCCCCCCC-CCCCCCEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEECCC-CCCCCCCC
Q ss_conf             98546404837998451013215556666-21223214899989754312767789885447764443134-55567752
Q gi|254780598|r   81 FAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-AGEITPIA  158 (205)
Q Consensus        81 ~~GYn~q~~~~V~G~e~d~~~~~~~~~~~-~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~-~~~~~~~~  158 (205)
T Consensus        48 NlKYrYE~dn~~~Gvi~Sftyt~~d~~~~~~~~~~~~YySl~aGPsyR~NdyvS~Ygl~G~a~~k~~~~~~~~~~~s~s~  127 (171)
T PRK09408         48 NLKYRYEEDNSPLGVIGSFTYTEKSRTADSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSD  127 (171)
T ss_pred             EEEEEEEECCCCEEEEEEEEEECCCCCCCCCCCCEEEEEEEEECCEEEECCEEEEEEECCEEEEEEEECCCCCCCCCCCC
T ss_conf             88876673698677899999981665667753120469989534427862437522550133689973246764456110


Q ss_pred             EEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             04799734661004886799999999750565566226999998539
Q gi|254780598|r  159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       159 ~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
T Consensus       128 t~fayGAGvQ~N-P~~nvaid~gYE~S~~~~~~--~~~f~vGvGYRF  171 (171)
T PRK09408        128 YGFSYGAGLQFN-PMENVALDFSYEQSRIRSVD--VGTWIAGVGYRF  171 (171)
T ss_pred             CCEEEEEEEEEC-CCCCEEEEEEEEECCCCCEE--ECCEEEEEEECC
T ss_conf             214666547980-67787999876111458727--685998114139