HHsearch alignment for GI: 254780598 and conserved domain: PRK10554

>PRK10554 outer membrane porin protein C; Provisional.
Probab=96.58  E-value=0.034  Score=29.05  Aligned_cols=43  Identities=14%  Similarity=0.326  Sum_probs=33.6

Q ss_pred             EEEEEEEEECCCCCEEEEEEEEEEECCCCC-------CCCEEEEEEEEEEC
Q ss_conf             997346610048867999999997505655-------66226999998539
Q gi|254780598|r  162 TAGVGVEVGGLSESLVARLEYRASKYSKVE-------GFYNTISLGVGMKF  205 (205)
Q Consensus       162 ~~G~Gvey~~it~~~~~r~EY~y~df~~~~-------~~~~~~~~G~~ykF  205 (205)
T Consensus       324 ~~~iga~Y-~FnkN~~~y~~Yk~NllD~~~~~~~~~~~~DD~~alGlrY~F  373 (373)
T PRK10554        324 YVDVGATY-YFNKNMSTYVDYKINLLDDNDFTRDAGINTDDIVALGLVYQF  373 (373)
T ss_pred             EEEEEEEE-EECCCEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             38976799-977872168888751367653100036776776999628819