HHsearch alignment for GI: 254780598 and conserved domain: TIGR03016

>TIGR03016 pepcterm_hypo_1 uncharacterized protein, PEP-CTERM system associated. Members of this protein family are found predominantly in exopolysaccharide biosynthesis operons marked by the presence of the EpsH-family putative exosortase and presence in the genome of the PEP-CTERM protein sorting signal. Members of this family may be distantly related to the EpsL family modeled in TIGR03014.
Probab=96.55  E-value=0.035  Score=28.94  Aligned_cols=80  Identities=16%  Similarity=0.111  Sum_probs=53.1

Q ss_pred             EEEEEEEEECCCEEEEEEEEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCC----CCCCCE
Q ss_conf             9989754312767789885447764443134555677520479973466100488679999999975056----556622
Q gi|254780598|r  120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----VEGFYN  195 (205)
Q Consensus       120 ~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~~~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~----~~~~~~  195 (205)
T Consensus       348 ~~~~~~~~L~~rl~~~~~~~~~~~~~~--~~~---~~~d~~~~~~~gl~y-~l~~~~~~~l~Yry~~rdS~~~~~dy~~N  421 (431)
T TIGR03016       348 GSVLLTHRLSPRLTANLGLTYERNEGS--GTN---DQETDRTSVSAGLSY-QLGENTTGSLTYRYQERDSNFEATDYTEN  421 (431)
T ss_pred             EEEEEEEEECCCCEEEEEEEEEEEECC--CCC---CCCEEEEEEEEEEEE-EECCCEEEEEEEEEEECCCCCCCCCHHHH
T ss_conf             038999996513121489999972437--777---650469999998999-96386599999999970478766664551


Q ss_pred             EEEEEEEEEC
Q ss_conf             6999998539
Q gi|254780598|r  196 TISLGVGMKF  205 (205)
Q Consensus       196 ~~~~G~~ykF  205 (205)
T Consensus       422 ~v~~~l~~~F  431 (431)
T TIGR03016       422 RLMAEVTMTF  431 (431)
T ss_pred             EEEEEEEEEC
T ss_conf             2157787409