HHsearch alignment for GI: 254780598 and conserved domain: pfam03797

>pfam03797 Autotransporter Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C terminus of the proteins it occurs in. The N terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.
Probab=96.68  E-value=0.029  Score=29.42  Aligned_cols=111  Identities=14%  Similarity=0.152  Sum_probs=52.5

Q ss_pred             CCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCC-------CCCCCCCEEEEEEEEEEEEEC--CCEE--EEEEEEEE
Q ss_conf             776026899854640483799845101321555666-------621223214899989754312--7677--89885447
Q gi|254780598|r   73 HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-------NIHSLHGIGGSLRIRGGYEVS--DSLL--LYATVGPD  141 (205)
Q Consensus        73 ~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~-------~~~~~~~~~~~~~~r~Gy~~~--~~~l--~Y~~~G~a  141 (205)
T Consensus        70 ~~~~~~g~y~~~~~~~-~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~gy~~~~~~~~~i~P~~~l~y~  148 (265)
T pfam03797        70 SDSYGAGLYAQWNFDG-GLYLDGVLAYGRFDNDVKRLGTSTGTAKGDYDSHGLGASLEAGYRFKLSGNLTLTPFAGLQYV  148 (265)
T ss_pred             EEEEEEEEEEEEECCC-CCEEEEEEEEEEEECEEEEECCCCCCCEEEEEEEEEEEEEEEEECCCCCCCEEEEEEEEEEEE
T ss_conf             6707999999998489-836976788899715048730678730222802499999998762332697599699999999


Q ss_pred             EEEEEE---CC------CCCCCCCCCEEEEEEEEEEEECCCC---CEEEEEEEEEE
Q ss_conf             764443---13------4555677520479973466100488---67999999997
Q gi|254780598|r  142 VAQKYE---TG------KAGEITPIAIGGTAGVGVEVGGLSE---SLVARLEYRAS  185 (205)
Q Consensus       142 ~~~~~~---~~------~~~~~~~~~~g~~~G~Gvey~~it~---~~~~r~EY~y~  185 (205)
T Consensus       149 ~~~~~~f~E~g~~~~~l~~~~~~~~~~~~~~G~~~~~-~~~~~~~~~~~~~~~~~~  203 (265)
T pfam03797       149 YLRQDGFTESGARSFALSVDSQSLTNLSGPLGLRLEY-RFSLRSLKPYATLGWAYE  203 (265)
T ss_pred             EEECCCEEEECCCCCCEEEECCCCCEEEEEEEEEEEE-EECCCEEEEEEEEEEEEE
T ss_conf             9876876670998435178446665899999999999-852873648999999999