HHsearch alignment for GI: 254780598 and conserved domain: pfam05736

>pfam05736 OprF OprF membrane domain. This domain represents the presumed membrane spanning region of the OprF proteins. This region is involved in channel formation and is thought to form an 8-stranded beta-barrel.
Probab=99.25  E-value=2.6e-10  Score=70.78  Aligned_cols=174  Identities=16%  Similarity=0.118  Sum_probs=101.1

Q ss_pred             CH-HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             94-43789999999998410000246654356666655563455444444115421000122333344667777760268
Q gi|254780598|r    1 MQ-KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGS   79 (205)
Q Consensus         1 Mk-k~~la~av~~lal~~~~~A~Aad~~~~~~~~~~~~~~~~~~~~~~~~~~~w~G~y~g~~~g~~~~~~~~~~~~~~~G   79 (205)
T Consensus         1 mklkntlg~aig~lvaa~s~~alAqgqgave----------------~e~---f~g~~~-------fDs~r~~~~g~~~G   54 (184)
T pfam05736         1 MKLKNTLGFAIGSLVAATSFGALAQGQGAVE----------------IEA---FYKKQY-------NDSVRNMKNGDLPG   54 (184)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCCEE----------------EEE---CCCEEE-------CCCCCCCCCCCCCE
T ss_conf             9532015578888888730167765467479----------------842---266475-------26313532489640


Q ss_pred             EEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCE-EEEEEEEEEEEE---CCCEEEEEEEEEEEEEEEECCCCCCCC
Q ss_conf             9985464048379984510132155566662122321-489998975431---276778988544776444313455567
Q gi|254780598|r   80 IFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI-GGSLRIRGGYEV---SDSLLLYATVGPDVAQKYETGKAGEIT  155 (205)
Q Consensus        80 ~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~~~~~~~~-~~~~~~r~Gy~~---~~~~l~Y~~~G~a~~~~~~~~~~~~~~  155 (205)
T Consensus        55 ~~iGY~lTdd---vsl~l~y~~~~~~r~~~~~g~~~i~g~~~rLDalYHF~~pg~~lrPYvs~G~gh~s~~~~~~g~~Gr  131 (184)
T pfam05736        55 GSIGYFLTDD---VELNLSYDETHDTRSTDGTGNQKVGGDLTSLDAQYHFGTPGDGLRPYVSAGFAHQSITNVADGSQGR  131 (184)
T ss_pred             EEEEEECCCC---EEEEEEECCCCCHHCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCEEEEECCCCCEEECCCCCCCCC
T ss_conf             3652571788---3899887342100013576661035634667779973898766337277314652000225687765


Q ss_pred             CCCEEEEEEEEEEEECCCCCEEEEEEEEE-EECCCCCCCCEEEEEEEEEEC
Q ss_conf             75204799734661004886799999999-750565566226999998539
Q gi|254780598|r  156 PIAIGGTAGVGVEVGGLSESLVARLEYRA-SKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       156 ~~~~g~~~G~Gvey~~it~~~~~r~EY~y-~df~~~~~~~~~~~~G~~ykF  205 (205)
T Consensus       132 d~sT~~N~G~G~Ky-~itdn~~aRa~vra~y~lD~~~~d-~~a~vGl~~~F  180 (184)
T pfam05736       132 DQSTFANIGAGAKY-YFTENFYARAGVEAQYGLDNGDWE-WAALVGLGVNF  180 (184)
T ss_pred             CCCEEEEECCCEEE-EECCCEEEEECHHHHCCCCCCCCC-EEEEEEEEEEC
T ss_conf             64416763452689-960544776132531047788612-00455249960