HHsearch alignment for GI: 254780598 and conserved domain: pfam06316

>pfam06316 Ail_Lom Enterobacterial Ail/Lom protein. This family consists of several bacterial and phage Ail/Lom-like proteins. The Yersinia enterocolitica Ail protein is a known virulence factor. Proteins in this family are predicted to consist of eight transmembrane beta-sheets and four cell surface-exposed loops. It is thought that Ail directly promotes invasion and loop 2 contains an active site, perhaps a receptor-binding domain. The phage protein Lom is expressed during lysogeny, and encode host-cell envelope proteins. Lom is found in the bacterial outer membrane, and is homologous to virulence proteins of two other enterobacterial genera. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis.
Probab=99.79  E-value=1.2e-17  Score=108.36  Aligned_cols=170  Identities=20%  Similarity=0.188  Sum_probs=112.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             94437899999999984100-00246654356666655563455444444115421000122333344667777760268
Q gi|254780598|r    1 MQKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGS   79 (205)
Q Consensus         1 Mkk~~la~av~~lal~~~~~-A~Aad~~~~~~~~~~~~~~~~~~~~~~~~~~~w~G~y~g~~~g~~~~~~~~~~~~~~~G   79 (205)
T Consensus         1 m~~~~~~~l~~~~~l~~~~~~a~A~~-----------------------~~sTvS~GYaQa~~~~~g-------~~~l~G   50 (199)
T pfam06316         1 MRKLCAAILSAAICLAAAGTPASAAE-----------------------HQSTLSAGYLHAHTDAPG-------SDDLNG   50 (199)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCHHHC-----------------------CCCEEEECEEEEECCCCC-------CCCCCC
T ss_conf             90177899999999997277311214-----------------------786686221003147566-------778885


Q ss_pred             EEEEEEEECCCEEEEEEEEEEECCCCCCCC----------CCCCCCEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEECC
Q ss_conf             998546404837998451013215556666----------2122321489998975431276778988544776444313
Q gi|254780598|r   80 IFAGYNVEDSCIMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG  149 (205)
Q Consensus        80 ~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~----------~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~  149 (205)
T Consensus        51 ~NlKYRYE~d~~-lGvIgSfTy~~~~~~~~~~~~~~~~~~~~~~~~-YySlmaGPsyR~Nd~vS~Ygl~G~a~~k~~~~~  128 (199)
T pfam06316        51 INVKYRYEFTDT-LGLITSFSYANAEDEQKTHYNDTRWHEDSVRNR-WFSVMAGPSVRVNEWFSAYALAGVAYARVSSFA  128 (199)
T ss_pred             EEEEEEEECCCC-EEEEEEEEEECCCCCCCEECCCCCCCCCCCCCE-EEEEEECCCEEECCEEEEEEECCEEEEEEEECC
T ss_conf             388866441798-078999999615653120205762025642203-899973462685110120121231367764024


Q ss_pred             ------------------CCCCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             ------------------45556775204799734661004886799999999750565566226999998539
Q gi|254780598|r  150 ------------------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       150 ------------------~~~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
T Consensus       129 ~d~~~~~~~~~~~~~~~~~s~~~s~s~tsfAyGAGvQfN-P~~nvaiD~gYEgS~~~d~~--~~gf~vGVGYRF  199 (199)
T pfam06316       129 GDYFRLTDDEGKKHDHLTGSDDARRSHTALAWGAGVQFN-PTENIAVDLAYEASGRGDWR--TDAFIVGTGYKF  199 (199)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEC-CCCCEEEEEEEEECCCCCCE--ECCEEEEEEECC
T ss_conf             650331255565455544444454443322442027971-57667999877630348705--175899514409