HHsearch alignment for GI: 254780598 and conserved domain: pfam06551

>pfam06551 DUF1120 Protein of unknown function (DUF1120). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=93.25  E-value=0.055  Score=27.98  Aligned_cols=34  Identities=29%  Similarity=0.207  Sum_probs=23.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             9443789999999998410000246654356666
Q gi|254780598|r    1 MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGG   34 (205)
Q Consensus         1 Mkk~~la~av~~lal~~~~~A~Aad~~~~~~~~~   34 (205)
T Consensus         1 mkK~l~~~~i~a~l~~~~ssa~aa~~ta~LkV~G   34 (145)
T pfam06551         1 MKKNLAATAIAAGLAVLATSAQAADSTAVLKVTG   34 (145)
T ss_pred             CCHHHHHHHHHHHHHHHHCCHHHCCCCCEEEEEE
T ss_conf             9237899999999998603142257744699999