HHsearch alignment for GI: 254780598 and conserved domain: pfam06629

>pfam06629 MipA MltA-interacting protein MipA. This family consists of several bacterial MltA-interacting protein (MipA) like sequences. As well as interacting with the membrane-bound lytic transglycosylase MltA, MipA is known to bind to PBP1B, a bifunctional murein transglycosylase/transpeptidase. MipA is considered to be a structural protein mediating the assembly of MltA to PBP1B into a complex.
Probab=97.61  E-value=0.0028  Score=34.60  Aligned_cols=117  Identities=15%  Similarity=0.145  Sum_probs=70.4

Q ss_pred             EEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEECCCC------
Q ss_conf             68998546404837998451013215556666212232148999897543127677898854477644431345------
Q gi|254780598|r   78 GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------  151 (205)
Q Consensus        78 ~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~~------  151 (205)
T Consensus        87 ~G~~~--~~~~~~~~~~~~~~~dv~~--------~~~G~~~~~~~~~~~~~~~~~~l~~~~~~~~~s~~y~~yyyGV~~~  156 (226)
T pfam06629        87 GGLKA--AYDTGWGTVRAELEQDISN--------GSRGFVADIGLAATYDLGDRLSLSPSLGLSYASRKYNDYYFGVSAA  156 (226)
T ss_pred             EEEEE--EEECCCEEEEEEEEEECCC--------CCCCEEEEEEEEEEEECCCCEEEEEEEEEEECCHHHHHHHHCCCHH
T ss_conf             17899--9994888999999993246--------7388999999999996399779999789998677675655377978


Q ss_pred             -------CC-CCCCC-EEEEEEEEEEEECCCCCEEEEEEEEEEECCCC--------CCCCEEEEEEEEEEC
Q ss_conf             -------55-67752-04799734661004886799999999750565--------566226999998539
Q gi|254780598|r  152 -------GE-ITPIA-IGGTAGVGVEVGGLSESLVARLEYRASKYSKV--------EGFYNTISLGVGMKF  205 (205)
Q Consensus       152 -------~~-~~~~~-~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~--------~~~~~~~~~G~~ykF  205 (205)
T Consensus       157 ea~~s~~~~Y~a~~g~~~~~~~~~~~y-~l~~~w~~~~~~~~~~L~~~~~dSPiv~~~~~~~~~~g~~Y~F  226 (226)
T pfam06629       157 ESARSGLAQYNAGAGLWSAGLGLSATY-MLTDHWSALGSASYTRLSGDAADSPIVERRGQPSAGLGVAYRF  226 (226)
T ss_pred             HHHHCCCCCCCCCCCEEEEEEEEEEEE-EECCCEEEEEEEEEEECCCCHHCCCCEEECCCEEEEEEEEEEC
T ss_conf             961237864057877078999999999-9669999999999998488211499588678789999999989