HHsearch alignment for GI: 254780598 and conserved domain: pfam10082

>pfam10082 DUF2320 Uncharacterized protein conserved in bacteria (DUF2320). This domain, found in various hypothetical bacterial proteins, has no known function.
Probab=97.63  E-value=0.0026  Score=34.75  Aligned_cols=48  Identities=17%  Similarity=0.063  Sum_probs=36.2

Q ss_pred             CCEEEEEEEEEEEECCCCCEEEEEEEEEEECCC----CCCCCEEEEEEEEEEC
Q ss_conf             520479973466100488679999999975056----5566226999998539
Q gi|254780598|r  157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----VEGFYNTISLGVGMKF  205 (205)
Q Consensus       157 ~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~----~~~~~~~~~~G~~ykF  205 (205)
T Consensus       329 ~D~~~~~~~~l~Y-~~~r~l~l~~~y~~~~~~S~~~~~~y~~n~v~l~l~~~~  380 (380)
T pfam10082       329 KDETYSAEAGLTY-KLNRWLDLTAGVRYEDLDSNIPGRSYDANVVGLGLTLQR  380 (380)
T ss_pred             CCCEEEEEEEEEE-EEECCEEEEEEEEEEEEECCCCCCCEEEEEEEEEEEEEC
T ss_conf             0133999999999-841779999999999703788878625059999999979