HHsearch alignment for GI: 254780598 and conserved domain: pfam11383

>pfam11383 DUF3187 Protein of unknown function (DUF3187). This family of proteins with unknown function appear to be restricted to Proteobacteria.
Probab=95.99  E-value=0.041  Score=28.61  Aligned_cols=119  Identities=14%  Similarity=0.117  Sum_probs=66.2

Q ss_pred             EEEEEEEEEC-C--CEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEECCCCCCCC
Q ss_conf             8998546404-8--379984510132155566662122321489998975431276778988544776444313455567
Q gi|254780598|r   79 SIFAGYNVED-S--CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT  155 (205)
Q Consensus        79 G~~~GYn~q~-~--~~V~G~e~d~~~~~~~~~~~~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~~~~~~  155 (205)
T Consensus       117 t~Y~qYql~~~~~hglS~GgSLyyN~--v~--~g~F~~~~FEQ~lQlNysy~~-~~h~~~s~lG~t~r~~~--~~~~~l~  189 (273)
T pfam11383       117 TLYLQYQLFQNEHHGLSIGGSLYYNN--VS--SGPFKGESFEQGLQLNYSYQK-DRHHFYSTLGVVFRNSD--EALNDLP  189 (273)
T ss_pred             HHHHHEEEECCCCCCEEEEEEEEECC--CC--CCCCCCCCHHHHHEEEEEEEC-CCCEEEEEEEEEEECCC--CCCCCCC
T ss_conf             87641243048875278779999546--46--776366652232113005543-77528889889983587--4236655


Q ss_pred             CCCEEEEEEEEEEEECCCCCEEEEEEEEEEECC-C----CCCCCEEEEEEEEEEC
Q ss_conf             752047997346610048867999999997505-6----5566226999998539
Q gi|254780598|r  156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-K----VEGFYNTISLGVGMKF  205 (205)
Q Consensus       156 ~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~-~----~~~~~~~~~~G~~ykF  205 (205)
T Consensus       190 ~k~~t~s~~~gY~Y-~l~~~H~ll~ey~~yqG~~~~~~~fse~SnE~~LGYRY~~  243 (273)
T pfam11383       190 YKKNTLSWAIGYEY-RLTERHHLLIEYHWYQGAVEGDTDFSEASNEAVLGYRYYM  243 (273)
T ss_pred             CCCCEEEEEEEEEE-EECCCHHHHHHHHHHCCCCCCCCHHCCCCCEEEEEEEEEE
T ss_conf             34415777721267-5237614654334333642686100112413578665773