HHsearch alignment for GI: 254780598 and conserved domain: pfam11854

>pfam11854 DUF3374 Protein of unknown function (DUF3374). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 665 to 712 amino acids in length.
Probab=97.26  E-value=0.0081  Score=32.23  Aligned_cols=42  Identities=21%  Similarity=0.312  Sum_probs=29.9

Q ss_pred             EEEEEEEEECCCCCEEEEEEEEEEECCCC---------------------CCCCEEEEEEEEEEC
Q ss_conf             99734661004886799999999750565---------------------566226999998539
Q gi|254780598|r  162 TAGVGVEVGGLSESLVARLEYRASKYSKV---------------------EGFYNTISLGVGMKF  205 (205)
Q Consensus       162 ~~G~Gvey~~it~~~~~r~EY~y~df~~~---------------------~~~~~~~~~G~~ykF  205 (205)
T Consensus       221 ~l~agv~~--~Gd~W~~~l~Y~gS~f~Nd~~~L~~~~~~~~~~~~~a~~PDN~ahqlslsG~y~l  283 (675)
T pfam11854       221 TLKAGVSL--SGDNWLADLSYNGSFFRNDISALSWDNAFNPYGGQLALAPDNQAHQLSLSGQYNL  283 (675)
T ss_pred             EEECCEEE--ECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHEEEEEEEEEC
T ss_conf             47204089--4565078667745676557430103777655445305599863436888778703