HHsearch alignment of GI: 254780598 and MMDB domain: 1uyn_X_

>1uyn_X (X:) NALP; autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel; HET: CXE; 2.6A {Neisseria meningitidis}
Probab=96.00  E-value=0.063  Score=27.32  Aligned_cols=69  Identities=19%  Similarity=0.138  Sum_probs=34.0

Q ss_pred             EEEEEEEEEEEEEC--CCEE--EEEEEEEEEEEEEE---CCC---CCCCCCC--CEEEEEEEEEEEECCCCC--EEEEEE
Q ss_conf             14899989754312--7677--89885447764443---134---5556775--204799734661004886--799999
Q gi|254780598|r  116 IGGSLRIRGGYEVS--DSLL--LYATVGPDVAQKYE---TGK---AGEITPI--AIGGTAGVGVEVGGLSES--LVARLE  181 (205)
Q Consensus       116 ~~~~~~~r~Gy~~~--~~~l--~Y~~~G~a~~~~~~---~~~---~~~~~~~--~~g~~~G~Gvey~~it~~--~~~r~E  181 (205)
                      ....+..++||++.  +++.  ||+.+.+.+.+.+.   ++.   ......+  .....+|+-+++ .+..+  +.++++
T Consensus       153 ~~~~~~~~~gy~~~~~~~~~l~P~~~l~~~~~~~~~~~e~g~~~~~~~~~~~~~~~~~~~G~~~~~-~~~~~~~~~~~~~  231 (308)
T 1uyn_X          153 TLMQLGALGGVNVPFAATGDLTVEGGLRYDLLKQDAFAEKGSALGWSGNSLTEGTLVGLAGLKLSQ-PLSDKAVLFATAG  231 (308)
T ss_dssp             EEEEEEEEEEECCC---CCEEEEEEEEEEEEEEECCEEEESCTTCCEECCEEEEEEEEEEEEEEEE-ECSSSEEEEEEEE
T ss_pred             EEEEEEEEEEEEEEECCCEEEEEEEEEEEEEEECCCEEEECCCEEEEECCCCCEEEEEEEEEEEEE-ECCCEEEEEEEEE
T ss_conf             179999999899982696599999875777862455075077416886256502666876899975-2155167989989


Q ss_pred             EEEE
Q ss_conf             9997
Q gi|254780598|r  182 YRAS  185 (205)
Q Consensus       182 Y~y~  185 (205)
                      |+|.
T Consensus       232 ~~~~  235 (308)
T 1uyn_X          232 VERD  235 (308)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9997