HHsearch alignment of GI: 254780598 and MMDB domain: 2o4v_A_

>2o4v_A (A:) Porin P; outer membrane, phosphate, transport, channel, membrane protein; HET: C8E; 1.94A {Pseudomonas aeruginosa PAO1}
Probab=95.44  E-value=0.11  Score=26.10  Aligned_cols=49  Identities=20%  Similarity=0.222  Sum_probs=39.5

Q ss_pred             CCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCC-----CCCCEEEEEEEEEEC
Q ss_conf             75204799734661004886799999999750565-----566226999998539
Q gi|254780598|r  156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----EGFYNTISLGVGMKF  205 (205)
Q Consensus       156 ~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~-----~~~~~~~~~G~~ykF  205 (205)
                      ....+..+-+|+.| .+++|+.+++||.|.+..+.     +-+.|.+++.+.|+|
T Consensus       358 ~~~~~~~~~~g~~~-~~~~n~~l~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~F  411 (411)
T 2o4v_A          358 GDAKGKTHTLGVNW-YANEAVKVSANYVKAKTDKISNANGDDSGDGLVMRLQYVF  411 (411)
T ss_dssp             SCEEEEEEEEEEEE-ECSSSEEEEEEEEEEEEESBCCTTCCCEEEEEEEEEEEEC
T ss_pred             CCCEEEEEEEEEEE-EECCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             77606999999999-9808999999999986665666778886558999988889